Release Notes For GenBank Release 168

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2008

               NCBI-GenBank Flat File Release 168.0

                    Distribution Release Notes

 96400790 loci, 97381682336 bases, from 96400790 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 168.0
1.2 Cutoff Date
1.3 Important Changes in Release 168.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 168.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 168.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 168.0, incorporates data available to the collaborating
databases as of October 27, 2008 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 168.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 60 with this release:

  - the BCT division is now comprised of  32 files (+2)
  - the CON division is now comprised of 103 files (+6)
  - the EST division is now comprised of 802 files (+40)
  - the GSS division is now comprised of 309 files (+3)
  - the HTG division is now comprised of 122 files (+2)
  - the PAT division is now comprised of  47 files (+1)
  - the PLN division is now comprised of  32 files (+2)
  - the STS division is now comprised of  18 files (+4)

  The total number of index files increased by 1 with this release:

  - the JOU index is now comprised of 6 files (+1)

1.3.2 Changes related to ncRNA features, /ncRNA_class, and /moltype

  The list of allowed values for the /ncRNA_class qualifier, which is
mandatory for all ncRNA features, has been expanded to include:

	/ncRNA_class="ribozyme"

Non-coding RNAs which are not yet in the INSDC's controlled vocabulary:

	http://www.insdc.org/page.php?page=rna_vocab

previously required /ncRNA_class="other" plus an accompanying /note
qualifer to describes the nature of the ncRNA. This requirement will
be changed, such that *either* a /product or a /note qualifier must
accompany "other" ncRNAs features.

  The list of allowed /mol_type qualifiers for the source feature
currently includes:

	/mol_type="snoRNA"
	/mol_type="snRNA"
	/mol_type="scRNA"
	/mol_type="tmRNA"

All of these molecule types have been collapsed into a single value:

	/mol_type="transcribed RNA"

Sequence records which represent one of these four types of molecules
will thus have:

	an ncRNA feature with /ncRNA_class of "snoRNA", "scRNA" or "snRNA"
	a source feature with /mol_type of "transcribed RNA"
or
	a tmRNA feature
	a source feature with /mol_type of "transcribed RNA"

All of these changes take effect with this October 2008 release.

1.3.3 Merging the satellite and repeat_unit features into repeat_region

  Satellites, minisatellites and microsatellites are comprised of repetitive
units of DNA, with a variety of lengths and repeat patterns. With the 
addition of a new qualifier (/satellite), the satellite and repeat_unit
features are now represented by the repeat_region feature.

   Qualifier       /satellite=

   Definition      identifier for satellite DNA marker; many tandem repeats 
                   (identical or related) of a short basic repeating unit; many 
                   have a base composition or other property different from the 
                   genome average that allows them to be separated from the bulk 
                   genomic DNA;

   Value format    "<satellite_type>[:<class>][ <identifier>]" 

                   where satellite_type is one of the following 
                   "satellite", "microsatellite", "minisatellite"

   Example         /satellite="satellite: S1a"
                   /satellite="satellite: alpha"
                   /satellite="satellite: gamma III"
                   /satellite="microsatellite: DC130"

  As of this October 2008 GenBank release, all satellite and repeat_unit
features have  been transformed into repeat_region features with an 
appropriate /satellite qualifier.
  
1.3.4 New /gene_synonym qualifier

  Gene symbols are presented via the /gene qualifier. When synonymous or 
alternative gene symbols are available, they have often been presented via
multiple /gene qualifiers.

  To distinguish what might be an approved or official gene symbol from its
synonyms or alternatives, a new /gene_synonym qualifier has been introduced
for GenBank Release 168.0 .

   Qualifier       /gene_synonym=

   Definition      synonymous or alternative symbol for a gene corresponding to
                   a sequence region
   Value format    "text"

   Examples        /gene="CF"
                   /gene="ABCC7"

1.3.5 New /mating_type qualifier

  Because the /sex qualifier has a free-text value format, is has been
innapropriately utilized for certain organisms, such as bacteria, fungi,
and some insects and worms. In such cases, a more appropriate term would
be 'mating type'.

  A new qualifier has been made available for non-sexual reproductive
strategies as of October 2008:

Qualifier       /mating_type=
Definition      mating type of the organism from which the sequence was
                obtained; mating type is used for prokaryotes, and for
                eukaryotes that undergo meiosis without sexually dimorphic
                gametes
Value format    "text"
Examples        /mating_type="MAT-1"
                /mating_type="plus"
                /mating_type="-"
                /mating_type="odd"
                /mating_type="even"
Comment         /mating_type="male" and /mating_type="female" are
                valid in the prokaryotes, but not in the eukaryotes;
                for more information, see the entry for /sex.

In light of the above, the definition for the /sex qualifier has been
refined:

Qualifier       /sex=
Definition      sex of the organism from which the sequence was obtained;
                sex is used for eukaryotic organisms that undergo meiosis
                and have sexually dimorphic gametes
Value format    "text"
Examples        /sex="female"
                /sex="male"
                /sex="hermaphrodite"
                /sex="unisexual"
                /sex="bisexual"
                /sex="asexual"
                /sex="monoecious" [or monecious]
                /sex="dioecious" [or diecious]
Comment         /sex should be used (instead of /mating_type)
                in the Metazoa, Embryophyta, Rhodophyta & Phaeophyceae;
                /mating_type should be used (instead of /sex)
                in the Bacteria, Archaea & Fungi;
                neither /sex nor /mating_type should be used
                in the viruses;
                outside of the taxa listed above, /mating_type
                should be used unless the value of the qualifier
                is taken from the vocabulary given in the examples
                above

  Records which inappropriately used the /sex qualifier have been updated,
to utilize the new /mating_type qualifier.

1.3.6 Renaming of /specific_host as /host

  The /specific_host qualifier has been renamed as /host for Release 168.0 .
From the Feature Table document:

Qualifier       /host=
Definition      natural (as opposed to laboratory) host to the organism from
                which sequenced molecule was obtained
Value format    "text"
Example         /host="Homo sapiens"
                /host="Homo sapiens 12 year old girl"
                /host="Rhizobium NGR234"

In contrast:

Qualifier       /lab_host=
Definition      scientific name of the laboratory host used to propagate the
                source organism from which the sequenced molecule was obtained
Value format    "text"
Example         /lab_host="Gallus gallus"
                /lab_host="Gallus gallus embryo"
                /lab_host="Escherichia coli strain DH5 alpha"
                /lab_host="Homo sapiens HeLa cells"
Comment         the full binomial scientific name of the host organism should
                be used when known; extra conditional information relating to
                the host may also be included

1.3.7 New value for /organelle

  As of October 2008, the list of allowed values for /organelle has been expanded
to include:

	/organelle="chromatophore"

1.3.8 Modification to value format for /frequency

  As of October 2008, the definition of /frequency has been expanded to
accomodate both the fraction of a population carrying a variation expressed
as a decimal value, and as the number of observed instances vs. the total
number of sequenced isolates:

Qualifier       /frequency=
Definition      frequency of the occurrence of a feature
Value format    text representing the proportion of a population carrying the
                feature expressed as a fraction
Example         /frequency="23/108"
                /frequency="1 in 12"
                /frequency=".85"

1.3.9 /cons_splice qualifier removed

  The /cons_splice qualifier has almost no usage within the sequence
database. In addition, it does not account for the variation in splice
signals that might be used by different classes of introns. So this
qualfier has been removed from sequence records, and the Feature Table
document, as of Release 168.0 .

1.3.10 /virion qualifier removed

  The intent of /virion was to indicate that a sequenced molecule
originates from an encapsidated viral particle (as opposed to the
proviral form of a virus, integrated into the host's genome). Viral
sequences derived from a blood sample taken from an infected organism
might be flagged with /virion, if it is believed that the sample
contained viral particles.

  However, a review of the database revealed that /virion was not
used consistently, and furthermore, submitters are often unable to
conclusively state that a virus sequence derives from the encapsidated
form. So the /virion qualifier has been removed from sequence records,
and the Feature Table document, as of Release 168.0 .

1.3.11 Updated value format for /exception

  Only three values for the /exception qualifier have been approved
for use by the INSDC : 

	"rearrangement required for product"
	"RNA editing"
	"reasons given in citation"

However, the definition of /exception in the Feature Table document
does not indicate that the contents of /exception are controlled.
This oversight has been corrected, and the definition of the qualifier
is now:

Qualifier       /exception=
Definition      indicates that the coding region cannot be translated using
                standard biological rules
Value format    "RNA editing", "reasons given in citation",
                "rearrangement required for product"
Example         /exception="RNA editing"
                /exception="reasons given in citation"
                /exception="rearrangement required for product"
Comment         only to be used to describe biological mechanisms such 
                as RNA editing;  where the exception cannot easily be described 
                a published citation must be referred to; protein translation of
                /exception CDS will be different from the according conceptual 
                translation; 
                - must not be used where transl_except would be adequate,
                  e.g. in case of stop codon completion use:
                /transl_except=(pos:6883,aa:TERM)
                /note="TAA stop codon is completed by addition of 3' A residues to   
                mRNA".
                - must not be used for ribosomal slippage, instead use join operator, 
                  e.g.: CDS   join(486..1784,1787..4810)
                              /note="ribosomal slip on tttt sequence at 1784..1787"

1.3.12 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.13 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
sixty of the GSS flatfiles in Release 168.0. Consider gbgss250.seq :

GBGSS1.SEQ           Genetic Sequence Data Bank
                          October 15 2008

                NCBI-GenBank Flat File Release 168.0

                           GSS Sequences (Part 1)

   87217 loci,    64373883 bases, from    87217 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "250" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 PROJECT linetype to be replaced by DBLINK (April 2009)

  The PROJECT linetype allows a sequence record to be linked to information
about the sequencing project that generated the data which ultimately
resulted in the record's submission to the International Nucleotide Sequence
Database ( INSD; see http://www.insdc.org ) .

  This complete bacterial GenBank record illustrates the use of the PROJECT
line:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471

  When viewed on the web in NCBI's Entrez:Nucleotide, the record's project
identifier (28471) links to an entry in the Genome Project Database (GPDB) :

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/sites/entrez?db=genomeprj&cmd=Retrieve&dopt=Overview&uid=28471

where information about the sequencing center, the bacterium, and other
GenBank records (eg, plasmids) associated with the sequencing project
can be found.

  Since the introduction of PROJECT, the scope of the "Genome" Project
Database has expanded, to include projects that are not necessarily targetted
to the sequencing of a complete genome.

  In addition, there can be other resources which underlie an INSD sequence
record, such as the Trace Assembly Archive at the NCBI:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/assembly/assmbrowser.cgi?cmd=show&f=tree&m=main&s=tree

  Because of the expanded scope of the GPDB, and because we anticipate a need
to link to more resources than just the GPDB, the PROJECT linetype is going to
be replaced by a new linetype:

   DBLINK

  Modifications to linetypes can be disruptive, so the switch to DBLINK
will occur in several stages. Starting in October 2008, links to the
NCBI Trace Assembly Archive will be supported via a line of text in the
COMMENT section of sequence records. Here is a mock-up, based on CP000964,
to illustrate this change:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471
....
COMMENT     Trace Assembly Archive:123456
            The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

Note: Use of the Trace Assembly Archive is still in its early stages, so only
a few records are expected to have these links in the short term.

  The new DBLINK linetype will be introduced as of GenBank Release 170.0 ,
on or near February 15, 2009 .

  The Genome Project ID and the Trace Assembly Archive ID will be presented
via DBLINK, and the existing PROJECT line will continue to be displayed:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

PROJECT and DBLINK will co-exist for one GenBank release, until Release 171.0
(April 15, 2009), at which point the PROJECT line will be removed. In its final
state, our mock-up for CP000964 becomes:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

  In summary: The PROJECT linetype will be replaced by DBLINK as of
Release 171.0 in April 2009.

  For those who process sequence data in NCBI's ASN.1 format: The
underlying representation for (Genome) Project IDs will remain unchanged.
There will be no changes to the ASN.1 User-object that is used to store them:

    user {
      type
        str "GenomeProjectsDB" ,
      data {
        {
          label
            str "ProjectID" ,
          data
            int 28471 } ,
        {
          label
            str "ParentID" ,
          data
            int 0 } } } ,

  However, to support linkages to other resources, such as the Trace
Assembly Archive, a new "DBLink" User-object will be introduced:

    user {
      type
        str "DBLink" ,
      data {
        {
          label
            str "Trace Assembly Archive" ,
          data
            ints { 123456 } } } }

  As new types of linkages are established, they will be added to
the DBLink User-object, and displayed via the DBLINK linetype in
the GenBank flatfile format. 

  There is a possibility that the GenomeProjectsDB User-object
might someday be incorporated into the new DBLink User-object.
But at the moment, there are no firm plans to do so.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1678 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut7.idx - Index of the entries according to author name, part 7.
61. gbaut8.idx - Index of the entries according to author name, part 8.
62. gbaut9.idx - Index of the entries according to author name, part 9.
63. gbbct1.seq - Bacterial sequence entries, part 1.
64. gbbct10.seq - Bacterial sequence entries, part 10.
65. gbbct11.seq - Bacterial sequence entries, part 11.
66. gbbct12.seq - Bacterial sequence entries, part 12.
67. gbbct13.seq - Bacterial sequence entries, part 13.
68. gbbct14.seq - Bacterial sequence entries, part 14.
69. gbbct15.seq - Bacterial sequence entries, part 15.
70. gbbct16.seq - Bacterial sequence entries, part 16.
71. gbbct17.seq - Bacterial sequence entries, part 17.
72. gbbct18.seq - Bacterial sequence entries, part 18.
73. gbbct19.seq - Bacterial sequence entries, part 19.
74. gbbct2.seq - Bacterial sequence entries, part 2.
75. gbbct20.seq - Bacterial sequence entries, part 20.
76. gbbct21.seq - Bacterial sequence entries, part 21.
77. gbbct22.seq - Bacterial sequence entries, part 22.
78. gbbct23.seq - Bacterial sequence entries, part 23.
79. gbbct24.seq - Bacterial sequence entries, part 24.
80. gbbct25.seq - Bacterial sequence entries, part 25.
81. gbbct26.seq - Bacterial sequence entries, part 26.
82. gbbct27.seq - Bacterial sequence entries, part 27.
83. gbbct28.seq - Bacterial sequence entries, part 28.
84. gbbct29.seq - Bacterial sequence entries, part 29.
85. gbbct3.seq - Bacterial sequence entries, part 3.
86. gbbct30.seq - Bacterial sequence entries, part 30.
87. gbbct31.seq - Bacterial sequence entries, part 31.
88. gbbct32.seq - Bacterial sequence entries, part 32.
89. gbbct4.seq - Bacterial sequence entries, part 4.
90. gbbct5.seq - Bacterial sequence entries, part 5.
91. gbbct6.seq - Bacterial sequence entries, part 6.
92. gbbct7.seq - Bacterial sequence entries, part 7.
93. gbbct8.seq - Bacterial sequence entries, part 8.
94. gbbct9.seq - Bacterial sequence entries, part 9.
95. gbchg.txt - Accession numbers of entries updated since the previous release.
96. gbcon1.seq - Constructed sequence entries, part 1.
97. gbcon10.seq - Constructed sequence entries, part 10.
98. gbcon100.seq - Constructed sequence entries, part 100.
99. gbcon101.seq - Constructed sequence entries, part 101.
100. gbcon102.seq - Constructed sequence entries, part 102.
101. gbcon103.seq - Constructed sequence entries, part 103.
102. gbcon11.seq - Constructed sequence entries, part 11.
103. gbcon12.seq - Constructed sequence entries, part 12.
104. gbcon13.seq - Constructed sequence entries, part 13.
105. gbcon14.seq - Constructed sequence entries, part 14.
106. gbcon15.seq - Constructed sequence entries, part 15.
107. gbcon16.seq - Constructed sequence entries, part 16.
108. gbcon17.seq - Constructed sequence entries, part 17.
109. gbcon18.seq - Constructed sequence entries, part 18.
110. gbcon19.seq - Constructed sequence entries, part 19.
111. gbcon2.seq - Constructed sequence entries, part 2.
112. gbcon20.seq - Constructed sequence entries, part 20.
113. gbcon21.seq - Constructed sequence entries, part 21.
114. gbcon22.seq - Constructed sequence entries, part 22.
115. gbcon23.seq - Constructed sequence entries, part 23.
116. gbcon24.seq - Constructed sequence entries, part 24.
117. gbcon25.seq - Constructed sequence entries, part 25.
118. gbcon26.seq - Constructed sequence entries, part 26.
119. gbcon27.seq - Constructed sequence entries, part 27.
120. gbcon28.seq - Constructed sequence entries, part 28.
121. gbcon29.seq - Constructed sequence entries, part 29.
122. gbcon3.seq - Constructed sequence entries, part 3.
123. gbcon30.seq - Constructed sequence entries, part 30.
124. gbcon31.seq - Constructed sequence entries, part 31.
125. gbcon32.seq - Constructed sequence entries, part 32.
126. gbcon33.seq - Constructed sequence entries, part 33.
127. gbcon34.seq - Constructed sequence entries, part 34.
128. gbcon35.seq - Constructed sequence entries, part 35.
129. gbcon36.seq - Constructed sequence entries, part 36.
130. gbcon37.seq - Constructed sequence entries, part 37.
131. gbcon38.seq - Constructed sequence entries, part 38.
132. gbcon39.seq - Constructed sequence entries, part 39.
133. gbcon4.seq - Constructed sequence entries, part 4.
134. gbcon40.seq - Constructed sequence entries, part 40.
135. gbcon41.seq - Constructed sequence entries, part 41.
136. gbcon42.seq - Constructed sequence entries, part 42.
137. gbcon43.seq - Constructed sequence entries, part 43.
138. gbcon44.seq - Constructed sequence entries, part 44.
139. gbcon45.seq - Constructed sequence entries, part 45.
140. gbcon46.seq - Constructed sequence entries, part 46.
141. gbcon47.seq - Constructed sequence entries, part 47.
142. gbcon48.seq - Constructed sequence entries, part 48.
143. gbcon49.seq - Constructed sequence entries, part 49.
144. gbcon5.seq - Constructed sequence entries, part 5.
145. gbcon50.seq - Constructed sequence entries, part 50.
146. gbcon51.seq - Constructed sequence entries, part 51.
147. gbcon52.seq - Constructed sequence entries, part 52.
148. gbcon53.seq - Constructed sequence entries, part 53.
149. gbcon54.seq - Constructed sequence entries, part 54.
150. gbcon55.seq - Constructed sequence entries, part 55.
151. gbcon56.seq - Constructed sequence entries, part 56.
152. gbcon57.seq - Constructed sequence entries, part 57.
153. gbcon58.seq - Constructed sequence entries, part 58.
154. gbcon59.seq - Constructed sequence entries, part 59.
155. gbcon6.seq - Constructed sequence entries, part 6.
156. gbcon60.seq - Constructed sequence entries, part 60.
157. gbcon61.seq - Constructed sequence entries, part 61.
158. gbcon62.seq - Constructed sequence entries, part 62.
159. gbcon63.seq - Constructed sequence entries, part 63.
160. gbcon64.seq - Constructed sequence entries, part 64.
161. gbcon65.seq - Constructed sequence entries, part 65.
162. gbcon66.seq - Constructed sequence entries, part 66.
163. gbcon67.seq - Constructed sequence entries, part 67.
164. gbcon68.seq - Constructed sequence entries, part 68.
165. gbcon69.seq - Constructed sequence entries, part 69.
166. gbcon7.seq - Constructed sequence entries, part 7.
167. gbcon70.seq - Constructed sequence entries, part 70.
168. gbcon71.seq - Constructed sequence entries, part 71.
169. gbcon72.seq - Constructed sequence entries, part 72.
170. gbcon73.seq - Constructed sequence entries, part 73.
171. gbcon74.seq - Constructed sequence entries, part 74.
172. gbcon75.seq - Constructed sequence entries, part 75.
173. gbcon76.seq - Constructed sequence entries, part 76.
174. gbcon77.seq - Constructed sequence entries, part 77.
175. gbcon78.seq - Constructed sequence entries, part 78.
176. gbcon79.seq - Constructed sequence entries, part 79.
177. gbcon8.seq - Constructed sequence entries, part 8.
178. gbcon80.seq - Constructed sequence entries, part 80.
179. gbcon81.seq - Constructed sequence entries, part 81.
180. gbcon82.seq - Constructed sequence entries, part 82.
181. gbcon83.seq - Constructed sequence entries, part 83.
182. gbcon84.seq - Constructed sequence entries, part 84.
183. gbcon85.seq - Constructed sequence entries, part 85.
184. gbcon86.seq - Constructed sequence entries, part 86.
185. gbcon87.seq - Constructed sequence entries, part 87.
186. gbcon88.seq - Constructed sequence entries, part 88.
187. gbcon89.seq - Constructed sequence entries, part 89.
188. gbcon9.seq - Constructed sequence entries, part 9.
189. gbcon90.seq - Constructed sequence entries, part 90.
190. gbcon91.seq - Constructed sequence entries, part 91.
191. gbcon92.seq - Constructed sequence entries, part 92.
192. gbcon93.seq - Constructed sequence entries, part 93.
193. gbcon94.seq - Constructed sequence entries, part 94.
194. gbcon95.seq - Constructed sequence entries, part 95.
195. gbcon96.seq - Constructed sequence entries, part 96.
196. gbcon97.seq - Constructed sequence entries, part 97.
197. gbcon98.seq - Constructed sequence entries, part 98.
198. gbcon99.seq - Constructed sequence entries, part 99.
199. gbdel.txt - Accession numbers of entries deleted since the previous release.
200. gbenv1.seq - Environmental sampling sequence entries, part 1.
201. gbenv10.seq - Environmental sampling sequence entries, part 10.
202. gbenv2.seq - Environmental sampling sequence entries, part 2.
203. gbenv3.seq - Environmental sampling sequence entries, part 3.
204. gbenv4.seq - Environmental sampling sequence entries, part 4.
205. gbenv5.seq - Environmental sampling sequence entries, part 5.
206. gbenv6.seq - Environmental sampling sequence entries, part 6.
207. gbenv7.seq - Environmental sampling sequence entries, part 7.
208. gbenv8.seq - Environmental sampling sequence entries, part 8.
209. gbenv9.seq - Environmental sampling sequence entries, part 9.
210. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
211. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
212. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
213. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
214. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
215. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
216. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
217. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
218. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
219. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
220. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
221. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
222. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
223. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
224. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
225. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
226. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
227. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
228. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
229. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
230. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
231. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
232. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
233. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
234. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
235. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
236. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
237. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
238. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
239. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
240. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
241. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
242. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
243. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
244. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
245. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
246. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
247. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
248. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
249. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
250. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
251. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
252. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
253. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
254. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
255. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
256. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
257. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
258. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
259. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
260. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
261. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
262. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
263. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
264. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
265. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
266. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
267. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
268. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
269. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
270. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
271. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
272. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
273. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
274. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
275. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
276. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
277. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
278. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
279. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
280. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
281. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
282. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
283. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
284. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
285. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
286. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
287. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
288. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
289. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
290. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
291. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
292. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
293. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
294. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
295. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
296. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
297. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
298. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
299. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
300. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
301. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
302. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
303. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
304. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
305. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
306. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
307. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
308. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
309. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
310. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
311. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
312. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
313. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
314. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
315. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
316. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
317. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
318. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
319. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
320. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
321. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
322. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
323. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
324. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
325. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
326. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
327. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
328. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
329. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
330. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
331. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
332. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
333. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
334. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
335. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
336. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
337. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
338. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
339. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
340. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
341. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
342. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
343. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
344. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
345. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
346. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
347. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
348. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
349. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
350. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
351. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
352. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
353. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
354. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
355. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
356. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
357. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
358. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
359. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
360. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
361. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
362. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
363. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
364. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
365. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
366. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
367. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
368. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
369. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
370. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
371. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
372. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
373. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
374. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
375. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
376. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
377. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
378. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
379. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
380. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
381. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
382. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
383. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
384. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
385. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
386. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
387. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
388. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
389. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
390. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
391. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
392. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
393. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
394. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
395. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
396. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
397. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
398. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
399. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
400. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
401. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
402. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
403. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
404. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
405. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
406. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
407. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
408. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
409. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
410. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
411. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
412. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
413. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
414. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
415. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
416. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
417. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
418. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
419. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
420. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
421. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
422. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
423. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
424. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
425. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
426. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
427. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
428. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
429. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
430. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
431. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
432. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
433. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
434. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
435. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
436. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
437. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
438. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
439. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
440. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
441. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
442. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
443. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
444. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
445. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
446. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
447. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
448. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
449. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
450. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
451. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
452. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
453. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
454. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
455. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
456. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
457. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
458. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
459. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
460. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
461. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
462. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
463. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
464. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
465. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
466. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
467. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
468. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
469. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
470. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
471. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
472. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
473. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
474. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
475. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
476. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
477. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
478. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
479. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
480. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
481. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
482. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
483. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
484. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
485. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
486. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
487. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
488. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
489. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
490. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
491. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
492. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
493. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
494. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
495. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
496. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
497. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
498. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
499. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
500. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
501. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
502. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
503. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
504. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
505. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
506. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
507. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
508. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
509. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
510. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
511. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
512. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
513. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
514. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
515. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
516. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
517. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
518. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
519. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
520. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
521. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
522. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
523. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
524. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
525. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
526. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
527. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
528. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
529. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
530. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
531. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
532. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
533. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
534. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
535. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
536. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
537. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
538. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
539. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
540. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
541. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
542. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
543. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
544. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
545. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
546. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
547. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
548. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
549. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
550. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
551. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
552. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
553. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
554. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
555. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
556. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
557. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
558. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
559. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
560. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
561. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
562. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
563. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
564. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
565. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
566. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
567. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
568. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
569. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
570. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
571. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
572. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
573. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
574. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
575. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
576. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
577. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
578. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
579. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
580. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
581. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
582. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
583. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
584. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
585. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
586. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
587. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
588. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
589. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
590. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
591. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
592. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
593. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
594. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
595. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
596. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
597. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
598. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
599. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
600. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
601. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
602. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
603. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
604. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
605. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
606. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
607. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
608. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
609. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
610. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
611. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
612. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
613. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
614. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
615. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
616. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
617. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
618. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
619. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
620. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
621. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
622. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
623. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
624. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
625. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
626. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
627. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
628. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
629. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
630. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
631. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
632. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
633. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
634. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
635. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
636. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
637. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
638. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
639. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
640. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
641. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
642. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
643. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
644. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
645. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
646. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
647. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
648. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
649. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
650. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
651. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
652. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
653. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
654. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
655. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
656. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
657. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
658. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
659. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
660. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
661. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
662. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
663. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
664. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
665. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
666. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
667. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
668. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
669. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
670. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
671. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
672. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
673. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
674. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
675. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
676. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
677. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
678. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
679. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
680. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
681. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
682. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
683. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
684. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
685. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
686. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
687. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
688. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
689. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
690. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
691. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
692. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
693. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
694. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
695. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
696. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
697. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
698. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
699. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
700. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
701. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
702. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
703. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
704. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
705. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
706. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
707. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
708. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
709. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
710. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
711. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
712. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
713. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
714. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
715. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
716. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
717. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
718. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
719. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
720. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
721. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
722. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
723. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
724. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
725. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
726. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
727. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
728. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
729. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
730. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
731. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
732. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
733. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
734. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
735. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
736. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
737. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
738. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
739. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
740. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
741. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
742. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
743. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
744. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
745. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
746. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
747. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
748. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
749. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
750. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
751. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
752. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
753. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
754. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
755. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
756. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
757. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
758. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
759. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
760. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
761. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
762. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
763. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
764. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
765. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
766. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
767. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
768. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
769. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
770. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
771. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
772. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
773. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
774. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
775. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
776. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
777. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
778. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
779. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
780. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
781. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
782. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
783. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
784. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
785. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
786. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
787. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
788. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
789. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
790. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
791. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
792. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
793. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
794. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
795. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
796. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
797. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
798. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
799. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
800. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
801. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
802. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
803. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
804. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
805. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
806. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
807. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
808. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
809. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
810. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
811. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
812. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
813. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
814. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
815. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
816. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
817. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
818. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
819. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
820. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
821. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
822. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
823. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
824. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
825. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
826. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
827. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
828. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
829. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
830. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
831. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
832. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
833. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
834. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
835. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
836. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
837. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
838. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
839. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
840. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
841. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
842. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
843. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
844. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
845. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
846. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
847. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
848. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
849. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
850. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
851. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
852. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
853. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
854. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
855. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
856. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
857. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
858. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
859. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
860. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
861. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
862. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
863. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
864. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
865. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
866. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
867. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
868. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
869. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
870. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
871. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
872. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
873. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
874. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
875. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
876. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
877. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
878. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
879. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
880. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
881. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
882. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
883. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
884. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
885. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
886. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
887. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
888. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
889. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
890. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
891. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
892. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
893. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
894. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
895. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
896. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
897. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
898. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
899. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
900. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
901. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
902. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
903. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
904. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
905. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
906. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
907. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
908. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
909. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
910. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
911. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
912. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
913. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
914. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
915. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
916. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
917. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
918. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
919. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
920. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
921. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
922. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
923. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
924. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
925. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
926. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
927. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
928. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
929. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
930. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
931. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
932. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
933. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
934. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
935. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
936. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
937. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
938. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
939. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
940. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
941. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
942. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
943. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
944. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
945. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
946. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
947. gbest763.seq - EST (expressed sequence tag) sequence entries, part 763.
948. gbest764.seq - EST (expressed sequence tag) sequence entries, part 764.
949. gbest765.seq - EST (expressed sequence tag) sequence entries, part 765.
950. gbest766.seq - EST (expressed sequence tag) sequence entries, part 766.
951. gbest767.seq - EST (expressed sequence tag) sequence entries, part 767.
952. gbest768.seq - EST (expressed sequence tag) sequence entries, part 768.
953. gbest769.seq - EST (expressed sequence tag) sequence entries, part 769.
954. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
955. gbest770.seq - EST (expressed sequence tag) sequence entries, part 770.
956. gbest771.seq - EST (expressed sequence tag) sequence entries, part 771.
957. gbest772.seq - EST (expressed sequence tag) sequence entries, part 772.
958. gbest773.seq - EST (expressed sequence tag) sequence entries, part 773.
959. gbest774.seq - EST (expressed sequence tag) sequence entries, part 774.
960. gbest775.seq - EST (expressed sequence tag) sequence entries, part 775.
961. gbest776.seq - EST (expressed sequence tag) sequence entries, part 776.
962. gbest777.seq - EST (expressed sequence tag) sequence entries, part 777.
963. gbest778.seq - EST (expressed sequence tag) sequence entries, part 778.
964. gbest779.seq - EST (expressed sequence tag) sequence entries, part 779.
965. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
966. gbest780.seq - EST (expressed sequence tag) sequence entries, part 780.
967. gbest781.seq - EST (expressed sequence tag) sequence entries, part 781.
968. gbest782.seq - EST (expressed sequence tag) sequence entries, part 782.
969. gbest783.seq - EST (expressed sequence tag) sequence entries, part 783.
970. gbest784.seq - EST (expressed sequence tag) sequence entries, part 784.
971. gbest785.seq - EST (expressed sequence tag) sequence entries, part 785.
972. gbest786.seq - EST (expressed sequence tag) sequence entries, part 786.
973. gbest787.seq - EST (expressed sequence tag) sequence entries, part 787.
974. gbest788.seq - EST (expressed sequence tag) sequence entries, part 788.
975. gbest789.seq - EST (expressed sequence tag) sequence entries, part 789.
976. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
977. gbest790.seq - EST (expressed sequence tag) sequence entries, part 790.
978. gbest791.seq - EST (expressed sequence tag) sequence entries, part 791.
979. gbest792.seq - EST (expressed sequence tag) sequence entries, part 792.
980. gbest793.seq - EST (expressed sequence tag) sequence entries, part 793.
981. gbest794.seq - EST (expressed sequence tag) sequence entries, part 794.
982. gbest795.seq - EST (expressed sequence tag) sequence entries, part 795.
983. gbest796.seq - EST (expressed sequence tag) sequence entries, part 796.
984. gbest797.seq - EST (expressed sequence tag) sequence entries, part 797.
985. gbest798.seq - EST (expressed sequence tag) sequence entries, part 798.
986. gbest799.seq - EST (expressed sequence tag) sequence entries, part 799.
987. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
988. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
989. gbest800.seq - EST (expressed sequence tag) sequence entries, part 800.
990. gbest801.seq - EST (expressed sequence tag) sequence entries, part 801.
991. gbest802.seq - EST (expressed sequence tag) sequence entries, part 802.
992. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
993. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
994. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
995. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
996. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
997. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
998. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
999. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1000. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1001. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1002. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1003. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1004. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1005. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1006. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1007. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1008. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1009. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1010. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1011. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1012. gbgen.idx - Index of the entries according to gene symbols.
1013. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1014. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1015. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1016. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1017. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1018. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1019. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1020. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1021. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1022. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1023. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1024. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1025. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1026. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1027. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1028. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1029. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1030. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1031. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1032. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1033. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1034. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1035. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1036. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1037. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1038. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1039. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1040. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1041. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1042. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1043. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1044. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1045. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1046. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1047. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1048. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1049. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1050. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1051. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1052. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1053. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1054. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1055. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1056. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1057. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1058. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1059. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1060. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1061. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1062. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1063. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1064. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1065. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1066. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1067. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1068. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1069. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1070. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1071. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1072. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1073. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1074. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1075. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1076. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1077. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1078. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1079. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1080. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1081. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1082. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1083. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1084. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1085. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1086. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1087. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1088. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1089. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1090. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1091. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1092. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1093. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1094. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1095. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1096. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1097. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1098. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1099. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1100. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1101. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1102. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1103. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1104. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1105. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1106. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1107. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1108. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1109. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1110. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1111. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1112. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1113. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1114. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1115. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1116. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1117. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1118. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1119. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1120. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1121. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1122. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1123. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1124. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1125. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1126. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1127. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1128. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1129. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1130. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1131. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1132. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1133. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1134. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1135. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1136. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1137. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1138. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1139. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1140. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1141. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1142. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1143. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1144. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1145. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1146. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1147. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1148. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1149. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1150. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1151. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1152. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1153. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1154. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1155. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1156. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1157. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1158. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1159. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1160. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1161. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1162. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1163. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1164. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1165. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1166. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1167. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1168. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1169. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1170. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1171. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1172. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1173. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1174. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1175. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1176. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1177. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1178. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1179. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1180. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1181. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1182. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1183. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1184. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1185. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1186. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1187. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1188. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1189. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1190. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1191. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1192. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1193. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1194. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1195. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1196. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1197. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1198. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1199. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1200. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1201. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1202. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1203. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1204. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1205. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1206. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1207. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1208. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1209. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1210. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1211. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1212. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1213. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1214. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1215. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1216. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1217. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1218. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1219. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1220. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1221. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1222. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1223. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1224. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1225. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1226. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1227. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1228. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1229. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1230. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1231. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1232. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1233. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1234. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1235. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1236. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1237. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1238. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1239. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1240. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1241. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1242. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1243. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1244. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1245. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1246. gbgss309.seq - GSS (genome survey sequence) sequence entries, part 309.
1247. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1248. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1249. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1250. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1251. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1252. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1253. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1254. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1255. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1256. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1257. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1258. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1259. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1260. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1261. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1262. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1263. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1264. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1265. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1266. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1267. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1268. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1269. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1270. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1271. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1272. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1273. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1274. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1275. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1276. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1277. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1278. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1279. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1280. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1281. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1282. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1283. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1284. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1285. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1286. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1287. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1288. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1289. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1290. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1291. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1292. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1293. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1294. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1295. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1296. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1297. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1298. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1299. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1300. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1301. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1302. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1303. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1304. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1305. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1306. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1307. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1308. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1309. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1310. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1311. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1312. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1313. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1314. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1315. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1316. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1317. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1318. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1319. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1320. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1321. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1322. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1323. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1324. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1325. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1326. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1327. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1328. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1329. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1330. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1331. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1332. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1333. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1334. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1335. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1336. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1337. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1338. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1339. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1340. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1341. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1342. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1343. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1344. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1345. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1346. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1347. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1348. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1349. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1350. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1351. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1352. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1353. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1354. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1355. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1356. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1357. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1358. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1359. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1360. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1361. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1362. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1363. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1364. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1365. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1366. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1367. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1368. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1369. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1370. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1371. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1372. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1373. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1374. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1375. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1376. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1377. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1378. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1379. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1380. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1381. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1382. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1383. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1384. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1385. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1386. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1387. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1388. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1389. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1390. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1391. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1392. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1393. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1394. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1395. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1396. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1397. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1398. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1399. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1400. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1401. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1402. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1403. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1404. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1405. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1406. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1407. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1408. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1409. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1410. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1411. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1412. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1413. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1414. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1415. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1416. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1417. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1418. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1419. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1420. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1421. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1422. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1423. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1424. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1425. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1426. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1427. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1428. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1429. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1430. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1431. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1432. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1433. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1434. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1435. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1436. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1437. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1438. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1439. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1440. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1441. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1442. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1443. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1444. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1445. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1446. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1447. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1448. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1449. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1450. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1451. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1452. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1453. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1454. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1455. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1456. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1457. gbinv1.seq - Invertebrate sequence entries, part 1.
1458. gbinv10.seq - Invertebrate sequence entries, part 10.
1459. gbinv11.seq - Invertebrate sequence entries, part 11.
1460. gbinv12.seq - Invertebrate sequence entries, part 12.
1461. gbinv13.seq - Invertebrate sequence entries, part 13.
1462. gbinv2.seq - Invertebrate sequence entries, part 2.
1463. gbinv3.seq - Invertebrate sequence entries, part 3.
1464. gbinv4.seq - Invertebrate sequence entries, part 4.
1465. gbinv5.seq - Invertebrate sequence entries, part 5.
1466. gbinv6.seq - Invertebrate sequence entries, part 6.
1467. gbinv7.seq - Invertebrate sequence entries, part 7.
1468. gbinv8.seq - Invertebrate sequence entries, part 8.
1469. gbinv9.seq - Invertebrate sequence entries, part 9.
1470. gbjou1.idx - Index of the entries according to journal citation, part 1.
1471. gbjou2.idx - Index of the entries according to journal citation, part 2.
1472. gbjou3.idx - Index of the entries according to journal citation, part 3.
1473. gbjou4.idx - Index of the entries according to journal citation, part 4.
1474. gbjou5.idx - Index of the entries according to journal citation, part 5.
1475. gbjou6.idx - Index of the entries according to journal citation, part 6.
1476. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1477. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1478. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1479. gbmam1.seq - Other mammalian sequence entries, part 1.
1480. gbmam2.seq - Other mammalian sequence entries, part 2.
1481. gbmam3.seq - Other mammalian sequence entries, part 3.
1482. gbmam4.seq - Other mammalian sequence entries, part 4.
1483. gbnew.txt - Accession numbers of entries new since the previous release.
1484. gbpat1.seq - Patent sequence entries, part 1.
1485. gbpat10.seq - Patent sequence entries, part 10.
1486. gbpat11.seq - Patent sequence entries, part 11.
1487. gbpat12.seq - Patent sequence entries, part 12.
1488. gbpat13.seq - Patent sequence entries, part 13.
1489. gbpat14.seq - Patent sequence entries, part 14.
1490. gbpat15.seq - Patent sequence entries, part 15.
1491. gbpat16.seq - Patent sequence entries, part 16.
1492. gbpat17.seq - Patent sequence entries, part 17.
1493. gbpat18.seq - Patent sequence entries, part 18.
1494. gbpat19.seq - Patent sequence entries, part 19.
1495. gbpat2.seq - Patent sequence entries, part 2.
1496. gbpat20.seq - Patent sequence entries, part 20.
1497. gbpat21.seq - Patent sequence entries, part 21.
1498. gbpat22.seq - Patent sequence entries, part 22.
1499. gbpat23.seq - Patent sequence entries, part 23.
1500. gbpat24.seq - Patent sequence entries, part 24.
1501. gbpat25.seq - Patent sequence entries, part 25.
1502. gbpat26.seq - Patent sequence entries, part 26.
1503. gbpat27.seq - Patent sequence entries, part 27.
1504. gbpat28.seq - Patent sequence entries, part 28.
1505. gbpat29.seq - Patent sequence entries, part 29.
1506. gbpat3.seq - Patent sequence entries, part 3.
1507. gbpat30.seq - Patent sequence entries, part 30.
1508. gbpat31.seq - Patent sequence entries, part 31.
1509. gbpat32.seq - Patent sequence entries, part 32.
1510. gbpat33.seq - Patent sequence entries, part 33.
1511. gbpat34.seq - Patent sequence entries, part 34.
1512. gbpat35.seq - Patent sequence entries, part 35.
1513. gbpat36.seq - Patent sequence entries, part 36.
1514. gbpat37.seq - Patent sequence entries, part 37.
1515. gbpat38.seq - Patent sequence entries, part 38.
1516. gbpat39.seq - Patent sequence entries, part 39.
1517. gbpat4.seq - Patent sequence entries, part 4.
1518. gbpat40.seq - Patent sequence entries, part 40.
1519. gbpat41.seq - Patent sequence entries, part 41.
1520. gbpat42.seq - Patent sequence entries, part 42.
1521. gbpat43.seq - Patent sequence entries, part 43.
1522. gbpat44.seq - Patent sequence entries, part 44.
1523. gbpat45.seq - Patent sequence entries, part 45.
1524. gbpat46.seq - Patent sequence entries, part 46.
1525. gbpat47.seq - Patent sequence entries, part 47.
1526. gbpat5.seq - Patent sequence entries, part 5.
1527. gbpat6.seq - Patent sequence entries, part 6.
1528. gbpat7.seq - Patent sequence entries, part 7.
1529. gbpat8.seq - Patent sequence entries, part 8.
1530. gbpat9.seq - Patent sequence entries, part 9.
1531. gbphg.seq - Phage sequence entries.
1532. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1533. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1534. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1535. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1536. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1537. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1538. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1539. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1540. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1541. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1542. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1543. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1544. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1545. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1546. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1547. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1548. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1549. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1550. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1551. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1552. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1553. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1554. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1555. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1556. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1557. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1558. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1559. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1560. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1561. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1562. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1563. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1564. gbpri1.seq - Primate sequence entries, part 1.
1565. gbpri10.seq - Primate sequence entries, part 10.
1566. gbpri11.seq - Primate sequence entries, part 11.
1567. gbpri12.seq - Primate sequence entries, part 12.
1568. gbpri13.seq - Primate sequence entries, part 13.
1569. gbpri14.seq - Primate sequence entries, part 14.
1570. gbpri15.seq - Primate sequence entries, part 15.
1571. gbpri16.seq - Primate sequence entries, part 16.
1572. gbpri17.seq - Primate sequence entries, part 17.
1573. gbpri18.seq - Primate sequence entries, part 18.
1574. gbpri19.seq - Primate sequence entries, part 19.
1575. gbpri2.seq - Primate sequence entries, part 2.
1576. gbpri20.seq - Primate sequence entries, part 20.
1577. gbpri21.seq - Primate sequence entries, part 21.
1578. gbpri22.seq - Primate sequence entries, part 22.
1579. gbpri23.seq - Primate sequence entries, part 23.
1580. gbpri24.seq - Primate sequence entries, part 24.
1581. gbpri25.seq - Primate sequence entries, part 25.
1582. gbpri26.seq - Primate sequence entries, part 26.
1583. gbpri27.seq - Primate sequence entries, part 27.
1584. gbpri28.seq - Primate sequence entries, part 28.
1585. gbpri29.seq - Primate sequence entries, part 29.
1586. gbpri3.seq - Primate sequence entries, part 3.
1587. gbpri30.seq - Primate sequence entries, part 30.
1588. gbpri31.seq - Primate sequence entries, part 31.
1589. gbpri32.seq - Primate sequence entries, part 32.
1590. gbpri33.seq - Primate sequence entries, part 33.
1591. gbpri34.seq - Primate sequence entries, part 34.
1592. gbpri35.seq - Primate sequence entries, part 35.
1593. gbpri36.seq - Primate sequence entries, part 36.
1594. gbpri4.seq - Primate sequence entries, part 4.
1595. gbpri5.seq - Primate sequence entries, part 5.
1596. gbpri6.seq - Primate sequence entries, part 6.
1597. gbpri7.seq - Primate sequence entries, part 7.
1598. gbpri8.seq - Primate sequence entries, part 8.
1599. gbpri9.seq - Primate sequence entries, part 9.
1600. gbrel.txt - Release notes (this document).
1601. gbrod1.seq - Rodent sequence entries, part 1.
1602. gbrod10.seq - Rodent sequence entries, part 10.
1603. gbrod11.seq - Rodent sequence entries, part 11.
1604. gbrod12.seq - Rodent sequence entries, part 12.
1605. gbrod13.seq - Rodent sequence entries, part 13.
1606. gbrod14.seq - Rodent sequence entries, part 14.
1607. gbrod15.seq - Rodent sequence entries, part 15.
1608. gbrod16.seq - Rodent sequence entries, part 16.
1609. gbrod17.seq - Rodent sequence entries, part 17.
1610. gbrod18.seq - Rodent sequence entries, part 18.
1611. gbrod19.seq - Rodent sequence entries, part 19.
1612. gbrod2.seq - Rodent sequence entries, part 2.
1613. gbrod20.seq - Rodent sequence entries, part 20.
1614. gbrod21.seq - Rodent sequence entries, part 21.
1615. gbrod22.seq - Rodent sequence entries, part 22.
1616. gbrod23.seq - Rodent sequence entries, part 23.
1617. gbrod24.seq - Rodent sequence entries, part 24.
1618. gbrod25.seq - Rodent sequence entries, part 25.
1619. gbrod26.seq - Rodent sequence entries, part 26.
1620. gbrod3.seq - Rodent sequence entries, part 3.
1621. gbrod4.seq - Rodent sequence entries, part 4.
1622. gbrod5.seq - Rodent sequence entries, part 5.
1623. gbrod6.seq - Rodent sequence entries, part 6.
1624. gbrod7.seq - Rodent sequence entries, part 7.
1625. gbrod8.seq - Rodent sequence entries, part 8.
1626. gbrod9.seq - Rodent sequence entries, part 9.
1627. gbsdr1.txt - Short directory of the data bank, part 1.
1628. gbsdr2.txt - Short directory of the data bank, part 2.
1629. gbsdr3.txt - Short directory of the data bank, part 3.
1630. gbsec.idx - Index of the entries according to secondary accession number.
1631. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1632. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1633. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1634. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1635. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1636. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1637. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1638. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1639. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1640. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1641. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1642. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1643. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1644. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1645. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1646. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1647. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1648. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1649. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1650. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1651. gbtsa.seq - TSA (transcriptome shotgun assembly) sequence entries.
1652. gbuna.seq - Unannotated sequence entries.
1653. gbvrl1.seq - Viral sequence entries, part 1.
1654. gbvrl10.seq - Viral sequence entries, part 10.
1655. gbvrl2.seq - Viral sequence entries, part 2.
1656. gbvrl3.seq - Viral sequence entries, part 3.
1657. gbvrl4.seq - Viral sequence entries, part 4.
1658. gbvrl5.seq - Viral sequence entries, part 5.
1659. gbvrl6.seq - Viral sequence entries, part 6.
1660. gbvrl7.seq - Viral sequence entries, part 7.
1661. gbvrl8.seq - Viral sequence entries, part 8.
1662. gbvrl9.seq - Viral sequence entries, part 9.
1663. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1664. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1665. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1666. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1667. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1668. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1669. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1670. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1671. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1672. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1673. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1674. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1675. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1676. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1677. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1678. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 168.0 flatfiles require roughly 371 GB (sequence
files only) or 396 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 815223248     gbacc1.idx
1893265746     gbacc2.idx
 632946177     gbacc3.idx
 241838890     gbaut1.idx
 185730191     gbaut10.idx
 192619518     gbaut11.idx
 183931792     gbaut12.idx
 233470934     gbaut13.idx
 244225583     gbaut14.idx
 253407063     gbaut15.idx
 252352341     gbaut16.idx
 184330642     gbaut17.idx
 183861860     gbaut18.idx
 193457922     gbaut19.idx
 239275649     gbaut2.idx
 185775663     gbaut20.idx
 185802922     gbaut21.idx
 212442774     gbaut22.idx
 183961741     gbaut23.idx
 185809815     gbaut24.idx
 185485326     gbaut25.idx
 186274510     gbaut26.idx
 183963625     gbaut27.idx
 234618607     gbaut28.idx
 186718918     gbaut29.idx
 184660104     gbaut3.idx
 185033708     gbaut30.idx
 186246514     gbaut31.idx
 184308579     gbaut32.idx
 190479762     gbaut33.idx
 186950421     gbaut34.idx
 204624373     gbaut35.idx
 184125727     gbaut36.idx
 184034436     gbaut37.idx
 184521089     gbaut38.idx
 184413988     gbaut39.idx
 187723686     gbaut4.idx
 185297530     gbaut40.idx
 186337409     gbaut41.idx
 244045630     gbaut42.idx
 235475962     gbaut43.idx
 188390384     gbaut44.idx
 184247953     gbaut45.idx
 219689487     gbaut46.idx
 228267008     gbaut47.idx
 229947828     gbaut48.idx
 185810865     gbaut49.idx
 255369346     gbaut5.idx
 245811541     gbaut50.idx
 183847512     gbaut51.idx
 243545298     gbaut52.idx
 185134222     gbaut53.idx
 192655610     gbaut54.idx
 190564616     gbaut55.idx
 186495907     gbaut56.idx
 190957564     gbaut57.idx
 183995843     gbaut58.idx
 156729081     gbaut59.idx
 185778791     gbaut6.idx
 184143673     gbaut7.idx
 183740308     gbaut8.idx
 184823485     gbaut9.idx
 259272212     gbbct1.seq
 258064950     gbbct10.seq
 250272017     gbbct11.seq
 258097908     gbbct12.seq
 252516856     gbbct13.seq
 250359183     gbbct14.seq
 254604217     gbbct15.seq
 256913166     gbbct16.seq
 255194170     gbbct17.seq
 250626718     gbbct18.seq
 250544249     gbbct19.seq
 254539944     gbbct2.seq
 256788464     gbbct20.seq
 253685285     gbbct21.seq
 256390637     gbbct22.seq
 254016209     gbbct23.seq
 251806581     gbbct24.seq
 254120394     gbbct25.seq
 253839294     gbbct26.seq
 252204379     gbbct27.seq
 250290731     gbbct28.seq
 250131491     gbbct29.seq
 259802647     gbbct3.seq
 250001718     gbbct30.seq
 250004617     gbbct31.seq
  48327488     gbbct32.seq
 250001896     gbbct4.seq
 250048730     gbbct5.seq
 252957865     gbbct6.seq
 254333842     gbbct7.seq
 250442157     gbbct8.seq
 250002573     gbbct9.seq
  17122661     gbchg.txt
 250151094     gbcon1.seq
 250611722     gbcon10.seq
 250000921     gbcon100.seq
 250010435     gbcon101.seq
 119328127     gbcon102.seq
  21414393     gbcon103.seq
 255476342     gbcon11.seq
 250000016     gbcon12.seq
 251339002     gbcon13.seq
 250002238     gbcon14.seq
 250001621     gbcon15.seq
 250002154     gbcon16.seq
 250885385     gbcon17.seq
 250000851     gbcon18.seq
 250000813     gbcon19.seq
 251535851     gbcon2.seq
 250000565     gbcon20.seq
 250000459     gbcon21.seq
 250002045     gbcon22.seq
 250000537     gbcon23.seq
 250000166     gbcon24.seq
 250000151     gbcon25.seq
 250001072     gbcon26.seq
 250002199     gbcon27.seq
 250005509     gbcon28.seq
 250003296     gbcon29.seq
 250010803     gbcon3.seq
 250002929     gbcon30.seq
 250002442     gbcon31.seq
 250004672     gbcon32.seq
 250004740     gbcon33.seq
 250002947     gbcon34.seq
 250000771     gbcon35.seq
 250004119     gbcon36.seq
 250003089     gbcon37.seq
 250000463     gbcon38.seq
 250005149     gbcon39.seq
 250136530     gbcon4.seq
 250002220     gbcon40.seq
 250001292     gbcon41.seq
 250003484     gbcon42.seq
 250000067     gbcon43.seq
 250003093     gbcon44.seq
 250002278     gbcon45.seq
 250000425     gbcon46.seq
 250002300     gbcon47.seq
 250001796     gbcon48.seq
 250000201     gbcon49.seq
 250004520     gbcon5.seq
 250000649     gbcon50.seq
 250004334     gbcon51.seq
 250002514     gbcon52.seq
 250005185     gbcon53.seq
 250002853     gbcon54.seq
 250000263     gbcon55.seq
 250001594     gbcon56.seq
 250002918     gbcon57.seq
 250001641     gbcon58.seq
 250000063     gbcon59.seq
 250006032     gbcon6.seq
 250002959     gbcon60.seq
 250001386     gbcon61.seq
 250003293     gbcon62.seq
 250005862     gbcon63.seq
 250002063     gbcon64.seq
 250000064     gbcon65.seq
 250000119     gbcon66.seq
 250001304     gbcon67.seq
 250000466     gbcon68.seq
 250004987     gbcon69.seq
 250234579     gbcon7.seq
 250002755     gbcon70.seq
 250000374     gbcon71.seq
 250002219     gbcon72.seq
 250005406     gbcon73.seq
 250003865     gbcon74.seq
 250000674     gbcon75.seq
 250003756     gbcon76.seq
 250000145     gbcon77.seq
 250001028     gbcon78.seq
 250004011     gbcon79.seq
 250533530     gbcon8.seq
 250004679     gbcon80.seq
 250004778     gbcon81.seq
 250001645     gbcon82.seq
 250000778     gbcon83.seq
 250002590     gbcon84.seq
 250003129     gbcon85.seq
 250001088     gbcon86.seq
 250004213     gbcon87.seq
 250004083     gbcon88.seq
 250004909     gbcon89.seq
 250000476     gbcon9.seq
 250004145     gbcon90.seq
 250001079     gbcon91.seq
 250001232     gbcon92.seq
 250010822     gbcon93.seq
 250000577     gbcon94.seq
 250000351     gbcon95.seq
 250004127     gbcon96.seq
 250000192     gbcon97.seq
 250002284     gbcon98.seq
 250001517     gbcon99.seq
   5063860     gbdel.txt
 250002496     gbenv1.seq
 159570563     gbenv10.seq
 250001061     gbenv2.seq
 250000757     gbenv3.seq
 250000250     gbenv4.seq
 250000747     gbenv5.seq
 250000852     gbenv6.seq
 250000803     gbenv7.seq
 250000025     gbenv8.seq
 250002567     gbenv9.seq
 230688615     gbest1.seq
 230687850     gbest10.seq
 230688348     gbest100.seq
 230689403     gbest101.seq
 230687717     gbest102.seq
 230690223     gbest103.seq
 230688898     gbest104.seq
 230689610     gbest105.seq
 230689549     gbest106.seq
 230688622     gbest107.seq
 230688313     gbest108.seq
 230688152     gbest109.seq
 230688467     gbest11.seq
 230689276     gbest110.seq
 230691029     gbest111.seq
 230690588     gbest112.seq
 230689460     gbest113.seq
 230689891     gbest114.seq
 230690439     gbest115.seq
 230690609     gbest116.seq
 230689284     gbest117.seq
 230687658     gbest118.seq
 230624213     gbest119.seq
 230689872     gbest12.seq
 230689713     gbest120.seq
 230687979     gbest121.seq
 230688921     gbest122.seq
 230689431     gbest123.seq
 230689060     gbest124.seq
 230689825     gbest125.seq
 230687934     gbest126.seq
 230688185     gbest127.seq
 230689313     gbest128.seq
 230687474     gbest129.seq
 230689821     gbest13.seq
 230690579     gbest130.seq
 230688915     gbest131.seq
 230689203     gbest132.seq
 230688752     gbest133.seq
 230688582     gbest134.seq
 230687927     gbest135.seq
 230689423     gbest136.seq
 230688494     gbest137.seq
 230689583     gbest138.seq
 230689936     gbest139.seq
 230689501     gbest14.seq
 230689905     gbest140.seq
 230687669     gbest141.seq
 230687589     gbest142.seq
 230687604     gbest143.seq
 230689823     gbest144.seq
 230689350     gbest145.seq
 230689019     gbest146.seq
 230688669     gbest147.seq
 230689024     gbest148.seq
 230688775     gbest149.seq
 230688549     gbest15.seq
 230689108     gbest150.seq
 230688193     gbest151.seq
 230688457     gbest152.seq
 230689658     gbest153.seq
 230687568     gbest154.seq
 230688979     gbest155.seq
 230687751     gbest156.seq
 230690284     gbest157.seq
 230688985     gbest158.seq
 230690658     gbest159.seq
 230688764     gbest16.seq
 230688550     gbest160.seq
 230691337     gbest161.seq
 230688856     gbest162.seq
 230689243     gbest163.seq
 230688043     gbest164.seq
 230696078     gbest165.seq
 230689476     gbest166.seq
 230688595     gbest167.seq
 230688809     gbest168.seq
 230688231     gbest169.seq
 230688328     gbest17.seq
 230691248     gbest170.seq
 230690635     gbest171.seq
 230688656     gbest172.seq
 230689772     gbest173.seq
 230688150     gbest174.seq
 230690026     gbest175.seq
 230687978     gbest176.seq
 230687837     gbest177.seq
 230688733     gbest178.seq
 230689219     gbest179.seq
 230688107     gbest18.seq
 230689055     gbest180.seq
 230689416     gbest181.seq
 230689617     gbest182.seq
 230687667     gbest183.seq
 230688056     gbest184.seq
 230688627     gbest185.seq
 230690102     gbest186.seq
 230689492     gbest187.seq
 230690243     gbest188.seq
 229111824     gbest189.seq
 230690091     gbest19.seq
 230689171     gbest190.seq
 230687986     gbest191.seq
 230688212     gbest192.seq
 230689221     gbest193.seq
 230688151     gbest194.seq
 230687632     gbest195.seq
 230688749     gbest196.seq
 230687837     gbest197.seq
 230688540     gbest198.seq
 230689419     gbest199.seq
 230689833     gbest2.seq
 230689487     gbest20.seq
 230690353     gbest200.seq
 230689756     gbest201.seq
 230687879     gbest202.seq
 230688388     gbest203.seq
 230689606     gbest204.seq
 230688007     gbest205.seq
 230690261     gbest206.seq
 230687525     gbest207.seq
 230689221     gbest208.seq
 230689873     gbest209.seq
 230688612     gbest21.seq
 230687540     gbest210.seq
 230687537     gbest211.seq
 230688956     gbest212.seq
 230688595     gbest213.seq
 230687936     gbest214.seq
 230689087     gbest215.seq
 230687754     gbest216.seq
 230688876     gbest217.seq
 230688195     gbest218.seq
 230687562     gbest219.seq
 230689308     gbest22.seq
 230688538     gbest220.seq
 230689495     gbest221.seq
 230689861     gbest222.seq
 230688482     gbest223.seq
 230688793     gbest224.seq
 230688884     gbest225.seq
 230690846     gbest226.seq
 230689439     gbest227.seq
 230689281     gbest228.seq
 230688154     gbest229.seq
 230689102     gbest23.seq
 230689666     gbest230.seq
 196192105     gbest231.seq
 161660341     gbest232.seq
 161859322     gbest233.seq
 169827386     gbest234.seq
 168523336     gbest235.seq
 163452766     gbest236.seq
 164114088     gbest237.seq
 163673318     gbest238.seq
 162887431     gbest239.seq
 230689629     gbest24.seq
 163532114     gbest240.seq
 163019019     gbest241.seq
 163141795     gbest242.seq
 161893174     gbest243.seq
 167285028     gbest244.seq
 161451437     gbest245.seq
 161761251     gbest246.seq
 166076666     gbest247.seq
 166790125     gbest248.seq
 164795894     gbest249.seq
 230690547     gbest25.seq
 164650774     gbest250.seq
 164245538     gbest251.seq
 164073235     gbest252.seq
 163169072     gbest253.seq
 163098989     gbest254.seq
 164039369     gbest255.seq
 164235387     gbest256.seq
 179868784     gbest257.seq
 171003204     gbest258.seq
 187095968     gbest259.seq
 230688489     gbest26.seq
 230688853     gbest260.seq
 230691090     gbest261.seq
 230688868     gbest262.seq
 230689481     gbest263.seq
 230690672     gbest264.seq
 230689211     gbest265.seq
 230689948     gbest266.seq
 230689260     gbest267.seq
 230689080     gbest268.seq
 230689114     gbest269.seq
 230689532     gbest27.seq
 230687614     gbest270.seq
 230687673     gbest271.seq
 230689412     gbest272.seq
 230688872     gbest273.seq
 230687506     gbest274.seq
 230688532     gbest275.seq
 230689105     gbest276.seq
 230688358     gbest277.seq
 230689947     gbest278.seq
 230690564     gbest279.seq
 230688330     gbest28.seq
 230689761     gbest280.seq
 230689912     gbest281.seq
 230688874     gbest282.seq
 230688240     gbest283.seq
 230688384     gbest284.seq
 230689111     gbest285.seq
 230690031     gbest286.seq
 230688048     gbest287.seq
 230687517     gbest288.seq
 230690716     gbest289.seq
 230688529     gbest29.seq
 230689514     gbest290.seq
 216519174     gbest291.seq
 210353721     gbest292.seq
 230687773     gbest293.seq
 230690862     gbest294.seq
 230690380     gbest295.seq
 230687526     gbest296.seq
 230688729     gbest297.seq
 230687970     gbest298.seq
 230688617     gbest299.seq
 230690315     gbest3.seq
 230688054     gbest30.seq
 230689496     gbest300.seq
 230688645     gbest301.seq
 230688126     gbest302.seq
 230689434     gbest303.seq
 230687703     gbest304.seq
 230689950     gbest305.seq
 230688999     gbest306.seq
 230690863     gbest307.seq
 230689466     gbest308.seq
 230689772     gbest309.seq
 230689729     gbest31.seq
 230688761     gbest310.seq
 230690162     gbest311.seq
 230689201     gbest312.seq
 230688847     gbest313.seq
 230687791     gbest314.seq
 230691049     gbest315.seq
 227889862     gbest316.seq
 230691003     gbest317.seq
 230688472     gbest318.seq
 230690424     gbest319.seq
 230688154     gbest32.seq
 230691050     gbest320.seq
 230690882     gbest321.seq
 230688392     gbest322.seq
 230690356     gbest323.seq
 230689197     gbest324.seq
 230689308     gbest325.seq
 230687941     gbest326.seq
 230690129     gbest327.seq
 230688526     gbest328.seq
 230690648     gbest329.seq
 230688396     gbest33.seq
 230688545     gbest330.seq
 230688812     gbest331.seq
 230689833     gbest332.seq
 230687995     gbest333.seq
 230689044     gbest334.seq
 230689116     gbest335.seq
 230690291     gbest336.seq
 230689587     gbest337.seq
 230689331     gbest338.seq
 230687786     gbest339.seq
 230689383     gbest34.seq
 230687885     gbest340.seq
 230689854     gbest341.seq
 230689644     gbest342.seq
 204869021     gbest343.seq
 230690034     gbest344.seq
 230689711     gbest345.seq
 230690347     gbest346.seq
 230689518     gbest347.seq
 230687734     gbest348.seq
 230687651     gbest349.seq
 230688213     gbest35.seq
 143433252     gbest350.seq
 175596923     gbest351.seq
 230689471     gbest352.seq
 230688347     gbest353.seq
 230689405     gbest354.seq
 230690358     gbest355.seq
 230688123     gbest356.seq
 230689464     gbest357.seq
 230688710     gbest358.seq
 230689269     gbest359.seq
 230688906     gbest36.seq
 230688792     gbest360.seq
 230689440     gbest361.seq
 230688199     gbest362.seq
 230690347     gbest363.seq
 230688417     gbest364.seq
 230688054     gbest365.seq
 230687811     gbest366.seq
 230687563     gbest367.seq
 230691504     gbest368.seq
 230688316     gbest369.seq
 230689771     gbest37.seq
 230689254     gbest370.seq
 230688515     gbest371.seq
 230690144     gbest372.seq
 230690251     gbest373.seq
 230687888     gbest374.seq
 230687922     gbest375.seq
 230687724     gbest376.seq
 230687753     gbest377.seq
 230689948     gbest378.seq
 230688043     gbest379.seq
 230688105     gbest38.seq
 230688174     gbest380.seq
 230688010     gbest381.seq
 230690355     gbest382.seq
 230688282     gbest383.seq
 230694935     gbest384.seq
 230694621     gbest385.seq
 230688221     gbest386.seq
 230689719     gbest387.seq
 230688142     gbest388.seq
 230687870     gbest389.seq
 230687714     gbest39.seq
 230689749     gbest390.seq
 230689514     gbest391.seq
 230689834     gbest392.seq
 230690062     gbest393.seq
 230687736     gbest394.seq
 230689800     gbest395.seq
 222233514     gbest396.seq
 230688591     gbest397.seq
 230689602     gbest398.seq
 230690382     gbest399.seq
 230688895     gbest4.seq
 230691043     gbest40.seq
 230688732     gbest400.seq
 230687705     gbest401.seq
 222632816     gbest402.seq
 230688619     gbest403.seq
 230690964     gbest404.seq
 230688441     gbest405.seq
 230688253     gbest406.seq
 230688291     gbest407.seq
 230689179     gbest408.seq
 223536688     gbest409.seq
 230687776     gbest41.seq
 230689254     gbest410.seq
 230691478     gbest411.seq
 230688125     gbest412.seq
 230688177     gbest413.seq
 230687857     gbest414.seq
 230688404     gbest415.seq
 230689327     gbest416.seq
 230691515     gbest417.seq
 230690881     gbest418.seq
 230688831     gbest419.seq
 230689066     gbest42.seq
 230689760     gbest420.seq
 230689246     gbest421.seq
 230691414     gbest422.seq
 230688286     gbest423.seq
 230690733     gbest424.seq
 230689290     gbest425.seq
 230688589     gbest426.seq
 210656244     gbest427.seq
 208300415     gbest428.seq
 208245152     gbest429.seq
 230688456     gbest43.seq
 208383496     gbest430.seq
 208347588     gbest431.seq
 208502812     gbest432.seq
 209169954     gbest433.seq
 209781924     gbest434.seq
 209546479     gbest435.seq
 209608199     gbest436.seq
 212106910     gbest437.seq
 209631726     gbest438.seq
 208664231     gbest439.seq
 230687561     gbest44.seq
 208803736     gbest440.seq
 208800104     gbest441.seq
 208223577     gbest442.seq
 208266323     gbest443.seq
 208258224     gbest444.seq
 208241157     gbest445.seq
 219329210     gbest446.seq
 230687754     gbest447.seq
 230687651     gbest448.seq
 230690063     gbest449.seq
 230688396     gbest45.seq
 230689233     gbest450.seq
 230690077     gbest451.seq
 230689701     gbest452.seq
 230689326     gbest453.seq
 230688234     gbest454.seq
 230688156     gbest455.seq
 230689584     gbest456.seq
 230687860     gbest457.seq
 230689283     gbest458.seq
 230689449     gbest459.seq
 230689344     gbest46.seq
 230688251     gbest460.seq
 230691245     gbest461.seq
 230689702     gbest462.seq
 230689018     gbest463.seq
 230688615     gbest464.seq
 230688137     gbest465.seq
 230688001     gbest466.seq
 230691778     gbest467.seq
 230689831     gbest468.seq
 230691771     gbest469.seq
 189041900     gbest47.seq
 230688942     gbest470.seq
 230689191     gbest471.seq
 230688507     gbest472.seq
 230689550     gbest473.seq
 230690097     gbest474.seq
 230689013     gbest475.seq
 230689136     gbest476.seq
 230687703     gbest477.seq
 230689820     gbest478.seq
 230687993     gbest479.seq
 188241195     gbest48.seq
 230687751     gbest480.seq
 230689407     gbest481.seq
 230688906     gbest482.seq
 230687565     gbest483.seq
 230689544     gbest484.seq
 230688188     gbest485.seq
 230687676     gbest486.seq
 230687510     gbest487.seq
 230691659     gbest488.seq
 230690956     gbest489.seq
 204743919     gbest49.seq
 230687557     gbest490.seq
 230689931     gbest491.seq
 230690997     gbest492.seq
 230690690     gbest493.seq
 230689568     gbest494.seq
 230688427     gbest495.seq
 230687635     gbest496.seq
 230688267     gbest497.seq
 230690537     gbest498.seq
 230688288     gbest499.seq
 164142208     gbest5.seq
 215053205     gbest50.seq
 230691067     gbest500.seq
 230688732     gbest501.seq
 230687636     gbest502.seq
 230689913     gbest503.seq
 230689051     gbest504.seq
 230690512     gbest505.seq
 230689363     gbest506.seq
 230688882     gbest507.seq
 230688838     gbest508.seq
 225450206     gbest509.seq
 214776070     gbest51.seq
 230688979     gbest510.seq
 230687795     gbest511.seq
 230688132     gbest512.seq
 230687824     gbest513.seq
 230688220     gbest514.seq
 230687878     gbest515.seq
 230688617     gbest516.seq
 230689954     gbest517.seq
 230690021     gbest518.seq
 230690038     gbest519.seq
 215563786     gbest52.seq
 230687455     gbest520.seq
 230689007     gbest521.seq
 230688644     gbest522.seq
 225474749     gbest523.seq
 226487502     gbest524.seq
 230690541     gbest525.seq
 230691031     gbest526.seq
 230689866     gbest527.seq
 230687620     gbest528.seq
 230687864     gbest529.seq
 228893666     gbest53.seq
 230688823     gbest530.seq
 230687872     gbest531.seq
 230688688     gbest532.seq
 230691300     gbest533.seq
 230689769     gbest534.seq
 230688204     gbest535.seq
 230689391     gbest536.seq
 230689543     gbest537.seq
 226988160     gbest538.seq
 196092768     gbest539.seq
 230688969     gbest54.seq
 223769735     gbest540.seq
 230687546     gbest541.seq
 230689817     gbest542.seq
 230688098     gbest543.seq
 230687573     gbest544.seq
 230690590     gbest545.seq
 230688816     gbest546.seq
 230688431     gbest547.seq
 230689684     gbest548.seq
 230688305     gbest549.seq
 230688215     gbest55.seq
 230687811     gbest550.seq
 230688824     gbest551.seq
 230690023     gbest552.seq
 222000248     gbest553.seq
 221924435     gbest554.seq
 230689176     gbest555.seq
 230689267     gbest556.seq
 230688736     gbest557.seq
 230689137     gbest558.seq
 230690368     gbest559.seq
 230687962     gbest56.seq
 230687920     gbest560.seq
 219046805     gbest561.seq
 215460639     gbest562.seq
 230687697     gbest563.seq
 230687670     gbest564.seq
 230689772     gbest565.seq
 230688776     gbest566.seq
 230687947     gbest567.seq
 230688795     gbest568.seq
 230688277     gbest569.seq
 224224094     gbest57.seq
 230689557     gbest570.seq
 230689995     gbest571.seq
 230689301     gbest572.seq
 230687957     gbest573.seq
 230687933     gbest574.seq
 230691175     gbest575.seq
 230688493     gbest576.seq
 224198333     gbest577.seq
 230687956     gbest578.seq
 230689012     gbest579.seq
 230687680     gbest58.seq
 230688086     gbest580.seq
 230688052     gbest581.seq
 230688863     gbest582.seq
 230689714     gbest583.seq
 230689265     gbest584.seq
 230689669     gbest585.seq
 230689683     gbest586.seq
 230689531     gbest587.seq
 230690025     gbest588.seq
 230687555     gbest589.seq
 230687976     gbest59.seq
 230689628     gbest590.seq
 230688923     gbest591.seq
 230689841     gbest592.seq
 230689096     gbest593.seq
 230688857     gbest594.seq
 230689143     gbest595.seq
 230688167     gbest596.seq
 230689472     gbest597.seq
 220230182     gbest598.seq
 230690120     gbest599.seq
 177420861     gbest6.seq
 230689352     gbest60.seq
 230688218     gbest600.seq
 230689230     gbest601.seq
 230689689     gbest602.seq
 230691718     gbest603.seq
 230691614     gbest604.seq
 230688872     gbest605.seq
 230689609     gbest606.seq
 230688634     gbest607.seq
 230688647     gbest608.seq
 230688047     gbest609.seq
 230689614     gbest61.seq
 230687466     gbest610.seq
 230688509     gbest611.seq
 230690815     gbest612.seq
 230690746     gbest613.seq
 230689576     gbest614.seq
 230688105     gbest615.seq
 230689069     gbest616.seq
 230688175     gbest617.seq
 230687629     gbest618.seq
 230689597     gbest619.seq
 230690030     gbest62.seq
 230689016     gbest620.seq
 230688970     gbest621.seq
 230688882     gbest622.seq
 230688950     gbest623.seq
 230689440     gbest624.seq
 230688059     gbest625.seq
 230688589     gbest626.seq
 230688570     gbest627.seq
 230690552     gbest628.seq
 230689193     gbest629.seq
 230688627     gbest63.seq
 230690795     gbest630.seq
 230688318     gbest631.seq
 230688122     gbest632.seq
 230690668     gbest633.seq
 230688815     gbest634.seq
 230689311     gbest635.seq
 230690215     gbest636.seq
 230688517     gbest637.seq
 230688209     gbest638.seq
 230687935     gbest639.seq
 230687708     gbest64.seq
 221085326     gbest640.seq
 217363111     gbest641.seq
 230688461     gbest642.seq
 220946650     gbest643.seq
 190676939     gbest644.seq
 190509982     gbest645.seq
 193513700     gbest646.seq
 192241380     gbest647.seq
 191648228     gbest648.seq
 191695040     gbest649.seq
 230690379     gbest65.seq
 193157105     gbest650.seq
 191853500     gbest651.seq
 191289889     gbest652.seq
 191324080     gbest653.seq
 230687466     gbest654.seq
 230688399     gbest655.seq
 230687505     gbest656.seq
 230687965     gbest657.seq
 230690304     gbest658.seq
 230689638     gbest659.seq
 230689173     gbest66.seq
 230688776     gbest660.seq
 179572306     gbest661.seq
 181403392     gbest662.seq
 230687486     gbest663.seq
 230687440     gbest664.seq
 230688129     gbest665.seq
 230688097     gbest666.seq
 230689642     gbest667.seq
 230688724     gbest668.seq
 230690868     gbest669.seq
 230687888     gbest67.seq
 230689015     gbest670.seq
 230689673     gbest671.seq
 230691025     gbest672.seq
 230687861     gbest673.seq
 230689584     gbest674.seq
 230687666     gbest675.seq
 230688478     gbest676.seq
 230690556     gbest677.seq
 230689432     gbest678.seq
 230689140     gbest679.seq
 230688905     gbest68.seq
 230688230     gbest680.seq
 230688789     gbest681.seq
 230690384     gbest682.seq
 230688251     gbest683.seq
 230688062     gbest684.seq
 230687669     gbest685.seq
 230690512     gbest686.seq
 230689922     gbest687.seq
 230688277     gbest688.seq
 230689663     gbest689.seq
 230688636     gbest69.seq
 230688917     gbest690.seq
 230690245     gbest691.seq
 230690381     gbest692.seq
 230691868     gbest693.seq
 230688847     gbest694.seq
 230688431     gbest695.seq
 230690593     gbest696.seq
 230688690     gbest697.seq
 230689015     gbest698.seq
 230688542     gbest699.seq
 230687843     gbest7.seq
 230687985     gbest70.seq
 220767200     gbest700.seq
 216334915     gbest701.seq
 218478741     gbest702.seq
 217243574     gbest703.seq
 214949101     gbest704.seq
 230689985     gbest705.seq
 230687490     gbest706.seq
 230689011     gbest707.seq
 230691155     gbest708.seq
 230688015     gbest709.seq
 229944368     gbest71.seq
 230689424     gbest710.seq
 230687992     gbest711.seq
 230689487     gbest712.seq
 230689411     gbest713.seq
 230689729     gbest714.seq
 230688214     gbest715.seq
 230688881     gbest716.seq
 230687736     gbest717.seq
 230690016     gbest718.seq
 230689778     gbest719.seq
 230688289     gbest72.seq
 230687707     gbest720.seq
 230688760     gbest721.seq
 230688721     gbest722.seq
 230690582     gbest723.seq
 230689442     gbest724.seq
 230688847     gbest725.seq
 230687933     gbest726.seq
 230687855     gbest727.seq
 230688525     gbest728.seq
 230687756     gbest729.seq
 209652443     gbest73.seq
 205399734     gbest730.seq
 225087751     gbest731.seq
 230688571     gbest732.seq
 230687623     gbest733.seq
 230689925     gbest734.seq
 230688851     gbest735.seq
 230688460     gbest736.seq
 230688507     gbest737.seq
 230690918     gbest738.seq
 230687607     gbest739.seq
 208185320     gbest74.seq
 230687759     gbest740.seq
 230688681     gbest741.seq
 230690953     gbest742.seq
 230688523     gbest743.seq
 230689724     gbest744.seq
 230688576     gbest745.seq
 230690179     gbest746.seq
 198035273     gbest747.seq
 219236697     gbest748.seq
 230688152     gbest749.seq
 207500258     gbest75.seq
 230690058     gbest750.seq
 230694369     gbest751.seq
 230691141     gbest752.seq
 230690215     gbest753.seq
 230693432     gbest754.seq
 230689470     gbest755.seq
 230691094     gbest756.seq
 230690088     gbest757.seq
 230690674     gbest758.seq
 230690863     gbest759.seq
 207829812     gbest76.seq
 230690300     gbest760.seq
 230689682     gbest761.seq
 230688619     gbest762.seq
 230689119     gbest763.seq
 230687504     gbest764.seq
 230688457     gbest765.seq
 230688874     gbest766.seq
 230689703     gbest767.seq
 230687633     gbest768.seq
 230687586     gbest769.seq
 208396764     gbest77.seq
 230689736     gbest770.seq
 230689491     gbest771.seq
 230688917     gbest772.seq
 230689023     gbest773.seq
 230687515     gbest774.seq
 230689743     gbest775.seq
 230688925     gbest776.seq
 230687803     gbest777.seq
 230688917     gbest778.seq
 230689805     gbest779.seq
 209258342     gbest78.seq
 230687930     gbest780.seq
 230689824     gbest781.seq
 230689923     gbest782.seq
 230690515     gbest783.seq
 230688522     gbest784.seq
 230688391     gbest785.seq
 230690356     gbest786.seq
 230688100     gbest787.seq
 230688234     gbest788.seq
 230689361     gbest789.seq
 208502973     gbest79.seq
 230689465     gbest790.seq
 230688102     gbest791.seq
 230689118     gbest792.seq
 230691456     gbest793.seq
 230689593     gbest794.seq
 230690282     gbest795.seq
 230687708     gbest796.seq
 230688723     gbest797.seq
 230689437     gbest798.seq
 228617168     gbest799.seq
 230688355     gbest8.seq
 207043740     gbest80.seq
 230687860     gbest800.seq
 230690961     gbest801.seq
  61974859     gbest802.seq
 209016164     gbest81.seq
 207141074     gbest82.seq
 204119490     gbest83.seq
 207238233     gbest84.seq
 206904658     gbest85.seq
 210534732     gbest86.seq
 226422334     gbest87.seq
 230690196     gbest88.seq
 230691865     gbest89.seq
 230689534     gbest9.seq
 217435667     gbest90.seq
 213212965     gbest91.seq
 214483164     gbest92.seq
 230690196     gbest93.seq
 230688270     gbest94.seq
 230687550     gbest95.seq
 230688793     gbest96.seq
 230687772     gbest97.seq
 230687987     gbest98.seq
 230688538     gbest99.seq
  93390688     gbgen.idx
 230688979     gbgss1.seq
 230690079     gbgss10.seq
 230687985     gbgss100.seq
 227641348     gbgss101.seq
 228853960     gbgss102.seq
 228577797     gbgss103.seq
 228616146     gbgss104.seq
 227678395     gbgss105.seq
 230160460     gbgss106.seq
 230687600     gbgss107.seq
 230687841     gbgss108.seq
 230688889     gbgss109.seq
 230689764     gbgss11.seq
 230689869     gbgss110.seq
 230689355     gbgss111.seq
 230690249     gbgss112.seq
 230688184     gbgss113.seq
 230687967     gbgss114.seq
 230687862     gbgss115.seq
 230687621     gbgss116.seq
 230689054     gbgss117.seq
 230689483     gbgss118.seq
 230687486     gbgss119.seq
 230687679     gbgss12.seq
 230689336     gbgss120.seq
 230688021     gbgss121.seq
 230687870     gbgss122.seq
 230688758     gbgss123.seq
 230688880     gbgss124.seq
 230688977     gbgss125.seq
 230688685     gbgss126.seq
 230689349     gbgss127.seq
 230687906     gbgss128.seq
 230690119     gbgss129.seq
 230690347     gbgss13.seq
 230690398     gbgss130.seq
 230688922     gbgss131.seq
 230689134     gbgss132.seq
 230688439     gbgss133.seq
 230689347     gbgss134.seq
 230689748     gbgss135.seq
 230689964     gbgss136.seq
 230688112     gbgss137.seq
 230687742     gbgss138.seq
 230689718     gbgss139.seq
 230689893     gbgss14.seq
 230688478     gbgss140.seq
 230688707     gbgss141.seq
 230689457     gbgss142.seq
 230688982     gbgss143.seq
 230689993     gbgss144.seq
 224594908     gbgss145.seq
 230689546     gbgss146.seq
 230688800     gbgss147.seq
 199924220     gbgss148.seq
 230688073     gbgss149.seq
 230689648     gbgss15.seq
 230689711     gbgss150.seq
 230690053     gbgss151.seq
 230688865     gbgss152.seq
 230688117     gbgss153.seq
 230688653     gbgss154.seq
 230687819     gbgss155.seq
 230689649     gbgss156.seq
 230688254     gbgss157.seq
 230688636     gbgss158.seq
 230689115     gbgss159.seq
 230689778     gbgss16.seq
 230688125     gbgss160.seq
 230689092     gbgss161.seq
 230687565     gbgss162.seq
 230690435     gbgss163.seq
 230688975     gbgss164.seq
 230689820     gbgss165.seq
 230690358     gbgss166.seq
 230688195     gbgss167.seq
 230688649     gbgss168.seq
 230687939     gbgss169.seq
 230688655     gbgss17.seq
 230687786     gbgss170.seq
 230690628     gbgss171.seq
 230688753     gbgss172.seq
 230689866     gbgss173.seq
 214234374     gbgss174.seq
 207652763     gbgss175.seq
 210029902     gbgss176.seq
 210673597     gbgss177.seq
 209682506     gbgss178.seq
 209419696     gbgss179.seq
 230688580     gbgss18.seq
 207488635     gbgss180.seq
 207258577     gbgss181.seq
 207746380     gbgss182.seq
 209291952     gbgss183.seq
 209292380     gbgss184.seq
 208633065     gbgss185.seq
 205852670     gbgss186.seq
 205577964     gbgss187.seq
 205287210     gbgss188.seq
 205470985     gbgss189.seq
 230688247     gbgss19.seq
 205274354     gbgss190.seq
 206072341     gbgss191.seq
 207491979     gbgss192.seq
 208618555     gbgss193.seq
 207877722     gbgss194.seq
 207953298     gbgss195.seq
 208773455     gbgss196.seq
 208858885     gbgss197.seq
 208917427     gbgss198.seq
 205751013     gbgss199.seq
 230688628     gbgss2.seq
 230689216     gbgss20.seq
 206170487     gbgss200.seq
 206444670     gbgss201.seq
 205511262     gbgss202.seq
 206017096     gbgss203.seq
 207311310     gbgss204.seq
 207135375     gbgss205.seq
 207106981     gbgss206.seq
 207240819     gbgss207.seq
 207061813     gbgss208.seq
 207144730     gbgss209.seq
 230687808     gbgss21.seq
 206853951     gbgss210.seq
 206971386     gbgss211.seq
 206675485     gbgss212.seq
 207873505     gbgss213.seq
 207898181     gbgss214.seq
 209406955     gbgss215.seq
 210074945     gbgss216.seq
 209275082     gbgss217.seq
 210247069     gbgss218.seq
 218148117     gbgss219.seq
 230691288     gbgss22.seq
 218861353     gbgss220.seq
 230688875     gbgss221.seq
 230690563     gbgss222.seq
 230689823     gbgss223.seq
 230688527     gbgss224.seq
 230688485     gbgss225.seq
 230689035     gbgss226.seq
 217911552     gbgss227.seq
 217928427     gbgss228.seq
 230688758     gbgss229.seq
 230690275     gbgss23.seq
 230688350     gbgss230.seq
 230689525     gbgss231.seq
 230688559     gbgss232.seq
 230688966     gbgss233.seq
 230688949     gbgss234.seq
 230688928     gbgss235.seq
 230688305     gbgss236.seq
 230689957     gbgss237.seq
 230688421     gbgss238.seq
 230687448     gbgss239.seq
 230687584     gbgss24.seq
 230687779     gbgss240.seq
 230689645     gbgss241.seq
 230689324     gbgss242.seq
 230687963     gbgss243.seq
 230688174     gbgss244.seq
 230689620     gbgss245.seq
 230687509     gbgss246.seq
 230689905     gbgss247.seq
 230690104     gbgss248.seq
 161458931     gbgss249.seq
 230688860     gbgss25.seq
 250002175     gbgss250.seq
 250001328     gbgss251.seq
 250000873     gbgss252.seq
 250001928     gbgss253.seq
 250001271     gbgss254.seq
 250003080     gbgss255.seq
 250001929     gbgss256.seq
 250003093     gbgss257.seq
 250002648     gbgss258.seq
 250003042     gbgss259.seq
 230689933     gbgss26.seq
 250002054     gbgss260.seq
 250001763     gbgss261.seq
 250002572     gbgss262.seq
 250002725     gbgss263.seq
 250000573     gbgss264.seq
 250001742     gbgss265.seq
 250000825     gbgss266.seq
 250000536     gbgss267.seq
 250003350     gbgss268.seq
 250000266     gbgss269.seq
 230687500     gbgss27.seq
 250000155     gbgss270.seq
 250003096     gbgss271.seq
 250001287     gbgss272.seq
 250000181     gbgss273.seq
 250000404     gbgss274.seq
 250001698     gbgss275.seq
 250001008     gbgss276.seq
 250001653     gbgss277.seq
 250001664     gbgss278.seq
 250000344     gbgss279.seq
 230691150     gbgss28.seq
 250002121     gbgss280.seq
 250001583     gbgss281.seq
 250002312     gbgss282.seq
 250001183     gbgss283.seq
 250000821     gbgss284.seq
 250001600     gbgss285.seq
 250000327     gbgss286.seq
 250001458     gbgss287.seq
 250001105     gbgss288.seq
 250000505     gbgss289.seq
 230689347     gbgss29.seq
 250001343     gbgss290.seq
 250000778     gbgss291.seq
 250000545     gbgss292.seq
 250002059     gbgss293.seq
 250002081     gbgss294.seq
 250000146     gbgss295.seq
 250000065     gbgss296.seq
 250000138     gbgss297.seq
 250000490     gbgss298.seq
 250000185     gbgss299.seq
 230689286     gbgss3.seq
 230689385     gbgss30.seq
 250001880     gbgss300.seq
 250002287     gbgss301.seq
 250002478     gbgss302.seq
 250001084     gbgss303.seq
 250001211     gbgss304.seq
 250001535     gbgss305.seq
 250002217     gbgss306.seq
 250002283     gbgss307.seq
 250001993     gbgss308.seq
  32274227     gbgss309.seq
 230690225     gbgss31.seq
 230688976     gbgss32.seq
 230688128     gbgss33.seq
 230690193     gbgss34.seq
 230688810     gbgss35.seq
 230689089     gbgss36.seq
 230689278     gbgss37.seq
 230688359     gbgss38.seq
 230689487     gbgss39.seq
 230688064     gbgss4.seq
 230688189     gbgss40.seq
 230687914     gbgss41.seq
 230689468     gbgss42.seq
 230689860     gbgss43.seq
 230688625     gbgss44.seq
 230688829     gbgss45.seq
 230690346     gbgss46.seq
 230688963     gbgss47.seq
 230687625     gbgss48.seq
 230688321     gbgss49.seq
 230688342     gbgss5.seq
 230688467     gbgss50.seq
 230688749     gbgss51.seq
 230689377     gbgss52.seq
 230689505     gbgss53.seq
 230690049     gbgss54.seq
 230688759     gbgss55.seq
 230687592     gbgss56.seq
 230688956     gbgss57.seq
 230690150     gbgss58.seq
 230688240     gbgss59.seq
 230689182     gbgss6.seq
 230689458     gbgss60.seq
 228978887     gbgss61.seq
 230688786     gbgss62.seq
 230688562     gbgss63.seq
 230688493     gbgss64.seq
 230688511     gbgss65.seq
 230688084     gbgss66.seq
 230688090     gbgss67.seq
 230687948     gbgss68.seq
 230687896     gbgss69.seq
 230687458     gbgss7.seq
 230689872     gbgss70.seq
 230689371     gbgss71.seq
 230689612     gbgss72.seq
 230689793     gbgss73.seq
 230688465     gbgss74.seq
 230687944     gbgss75.seq
 230688682     gbgss76.seq
 230688590     gbgss77.seq
 230688102     gbgss78.seq
 230688694     gbgss79.seq
 230690430     gbgss8.seq
 230688922     gbgss80.seq
 225707360     gbgss81.seq
 194162099     gbgss82.seq
 194321118     gbgss83.seq
 230691378     gbgss84.seq
 230689444     gbgss85.seq
 230688634     gbgss86.seq
 230689771     gbgss87.seq
 230688430     gbgss88.seq
 230689328     gbgss89.seq
 230689298     gbgss9.seq
 230689609     gbgss90.seq
 230689497     gbgss91.seq
 230687463     gbgss92.seq
 230688240     gbgss93.seq
 230689328     gbgss94.seq
 230690844     gbgss95.seq
 230688483     gbgss96.seq
 230689657     gbgss97.seq
 230688630     gbgss98.seq
 230689972     gbgss99.seq
 250011893     gbhtc1.seq
 250001450     gbhtc10.seq
 250001155     gbhtc11.seq
 250001364     gbhtc12.seq
  12611206     gbhtc13.seq
 250015867     gbhtc2.seq
 250012618     gbhtc3.seq
 250003132     gbhtc4.seq
 250000802     gbhtc5.seq
 250002862     gbhtc6.seq
 250003280     gbhtc7.seq
 250000604     gbhtc8.seq
 250005061     gbhtc9.seq
 250096978     gbhtg1.seq
 250061283     gbhtg10.seq
 250221451     gbhtg100.seq
 250197475     gbhtg101.seq
 250078972     gbhtg102.seq
 250057678     gbhtg103.seq
 250231976     gbhtg104.seq
 250095667     gbhtg105.seq
 251076061     gbhtg106.seq
 250093336     gbhtg107.seq
 250087182     gbhtg108.seq
 250111042     gbhtg109.seq
 250044302     gbhtg11.seq
 250210143     gbhtg110.seq
 250355482     gbhtg111.seq
 250212361     gbhtg112.seq
 250128493     gbhtg113.seq
 250120793     gbhtg114.seq
 250034784     gbhtg115.seq
 250003366     gbhtg116.seq
 250076530     gbhtg117.seq
 250089768     gbhtg118.seq
 250135489     gbhtg119.seq
 250316839     gbhtg12.seq
 250169215     gbhtg120.seq
 250107955     gbhtg121.seq
 112015211     gbhtg122.seq
 250262395     gbhtg13.seq
 250035129     gbhtg14.seq
 250133266     gbhtg15.seq
 250076344     gbhtg16.seq
 250178723     gbhtg17.seq
 250091540     gbhtg18.seq
 250147774     gbhtg19.seq
 250023304     gbhtg2.seq
 250182078     gbhtg20.seq
 250082633     gbhtg21.seq
 250033574     gbhtg22.seq
 250235175     gbhtg23.seq
 250258936     gbhtg24.seq
 250096493     gbhtg25.seq
 250296347     gbhtg26.seq
 250257898     gbhtg27.seq
 250252130     gbhtg28.seq
 250053426     gbhtg29.seq
 250041103     gbhtg3.seq
 250017542     gbhtg30.seq
 250019041     gbhtg31.seq
 250192741     gbhtg32.seq
 250064205     gbhtg33.seq
 250100700     gbhtg34.seq
 250087680     gbhtg35.seq
 250183191     gbhtg36.seq
 250178284     gbhtg37.seq
 250043485     gbhtg38.seq
 250254386     gbhtg39.seq
 250103738     gbhtg4.seq
 250056767     gbhtg40.seq
 250165562     gbhtg41.seq
 250149847     gbhtg42.seq
 250096938     gbhtg43.seq
 250007616     gbhtg44.seq
 250101256     gbhtg45.seq
 250494564     gbhtg46.seq
 250128822     gbhtg47.seq
 250249866     gbhtg48.seq
 250181462     gbhtg49.seq
 250212018     gbhtg5.seq
 250256783     gbhtg50.seq
 250189960     gbhtg51.seq
 250018478     gbhtg52.seq
 250057699     gbhtg53.seq
 250125419     gbhtg54.seq
 250238545     gbhtg55.seq
 250078161     gbhtg56.seq
 250246531     gbhtg57.seq
 250017186     gbhtg58.seq
 250131935     gbhtg59.seq
 250055961     gbhtg6.seq
 250119043     gbhtg60.seq
 250123761     gbhtg61.seq
 250226301     gbhtg62.seq
 250133978     gbhtg63.seq
 250178878     gbhtg64.seq
 250059819     gbhtg65.seq
 250184459     gbhtg66.seq
 250200618     gbhtg67.seq
 250128414     gbhtg68.seq
 250154873     gbhtg69.seq
 250006820     gbhtg7.seq
 250001719     gbhtg70.seq
 250021443     gbhtg71.seq
 250090925     gbhtg72.seq
 250214423     gbhtg73.seq
 250032714     gbhtg74.seq
 250139620     gbhtg75.seq
 250094947     gbhtg76.seq
 250112163     gbhtg77.seq
 250190545     gbhtg78.seq
 250029568     gbhtg79.seq
 250126658     gbhtg8.seq
 250219716     gbhtg80.seq
 250123836     gbhtg81.seq
 250137234     gbhtg82.seq
 250099027     gbhtg83.seq
 250020182     gbhtg84.seq
 250212661     gbhtg85.seq
 250220384     gbhtg86.seq
 250196276     gbhtg87.seq
 250229275     gbhtg88.seq
 250202164     gbhtg89.seq
 250011311     gbhtg9.seq
 250099412     gbhtg90.seq
 250012111     gbhtg91.seq
 250196800     gbhtg92.seq
 250108884     gbhtg93.seq
 250104562     gbhtg94.seq
 250204873     gbhtg95.seq
 250119686     gbhtg96.seq
 250054021     gbhtg97.seq
 250076172     gbhtg98.seq
 250172116     gbhtg99.seq
 250052201     gbinv1.seq
 250000533     gbinv10.seq
 250002704     gbinv11.seq
 250126428     gbinv12.seq
 149141990     gbinv13.seq
 250190796     gbinv2.seq
 277136152     gbinv3.seq
 250000185     gbinv4.seq
 250188345     gbinv5.seq
 249948982     gbinv6.seq
 250001771     gbinv7.seq
 250002199     gbinv8.seq
 250004429     gbinv9.seq
 141021828     gbjou1.idx
 148482681     gbjou2.idx
 207224509     gbjou3.idx
 281958631     gbjou4.idx
 256245843     gbjou5.idx
   9464718     gbjou6.idx
 185207511     gbkey1.idx
 256337691     gbkey2.idx
  63002388     gbkey3.idx
 250185260     gbmam1.seq
 250002153     gbmam2.seq
 250000661     gbmam3.seq
 189451332     gbmam4.seq
  66672277     gbnew.txt
 250000466     gbpat1.seq
 250004782     gbpat10.seq
 250000474     gbpat11.seq
 250000314     gbpat12.seq
 250000624     gbpat13.seq
 250002798     gbpat14.seq
 250000769     gbpat15.seq
 250000948     gbpat16.seq
 250005842     gbpat17.seq
 250000633     gbpat18.seq
 250002714     gbpat19.seq
 250007646     gbpat2.seq
 250000833     gbpat20.seq
 250000844     gbpat21.seq
 250054920     gbpat22.seq
 250000947     gbpat23.seq
 250000303     gbpat24.seq
 250007016     gbpat25.seq
 250000393     gbpat26.seq
 250000496     gbpat27.seq
 250001139     gbpat28.seq
 250097988     gbpat29.seq
 250000361     gbpat3.seq
 250001873     gbpat30.seq
 250000600     gbpat31.seq
 250000738     gbpat32.seq
 250003288     gbpat33.seq
 250001781     gbpat34.seq
 250000952     gbpat35.seq
 250001253     gbpat36.seq
 250002961     gbpat37.seq
 250000335     gbpat38.seq
 250001429     gbpat39.seq
 250003883     gbpat4.seq
 250000642     gbpat40.seq
 250016388     gbpat41.seq
 250001260     gbpat42.seq
 250000722     gbpat43.seq
 250000351     gbpat44.seq
 250000530     gbpat45.seq
 250000612     gbpat46.seq
 220669732     gbpat47.seq
 250001407     gbpat5.seq
 250000999     gbpat6.seq
 250000034     gbpat7.seq
 250002015     gbpat8.seq
 250002306     gbpat9.seq
  79484791     gbphg.seq
 250001591     gbpln1.seq
 250295714     gbpln10.seq
 250008370     gbpln11.seq
 250004416     gbpln12.seq
 250001230     gbpln13.seq
 250000589     gbpln14.seq
 250024593     gbpln15.seq
 252685629     gbpln16.seq
 295953043     gbpln17.seq
 251258781     gbpln18.seq
 250002193     gbpln19.seq
 250121696     gbpln2.seq
 250000924     gbpln20.seq
 250012961     gbpln21.seq
 250000344     gbpln22.seq
 250076206     gbpln23.seq
 254259000     gbpln24.seq
 250000365     gbpln25.seq
 250001398     gbpln26.seq
 250001190     gbpln27.seq
 250002062     gbpln28.seq
 250002064     gbpln29.seq
 250063659     gbpln3.seq
 250000496     gbpln30.seq
 250008383     gbpln31.seq
  50809181     gbpln32.seq
 250047515     gbpln4.seq
 250000447     gbpln5.seq
 250001251     gbpln6.seq
 250007082     gbpln7.seq
 250004660     gbpln8.seq
 250308908     gbpln9.seq
 250175129     gbpri1.seq
 250261801     gbpri10.seq
 250186277     gbpri11.seq
 250004885     gbpri12.seq
 250089133     gbpri13.seq
 250254497     gbpri14.seq
 250223316     gbpri15.seq
 250077694     gbpri16.seq
 250131249     gbpri17.seq
 250041332     gbpri18.seq
 250103287     gbpri19.seq
 250003502     gbpri2.seq
 250002034     gbpri20.seq
 250001856     gbpri21.seq
 250032903     gbpri22.seq
 250197320     gbpri23.seq
 250041193     gbpri24.seq
 250048733     gbpri25.seq
 250049987     gbpri26.seq
 250109407     gbpri27.seq
 250159568     gbpri28.seq
 250009929     gbpri29.seq
 250206247     gbpri3.seq
 250025537     gbpri30.seq
 250005489     gbpri31.seq
 250010337     gbpri32.seq
 250019925     gbpri33.seq
 250009336     gbpri34.seq
 250003693     gbpri35.seq
 189987572     gbpri36.seq
 250023802     gbpri4.seq
 250030668     gbpri5.seq
 250003826     gbpri6.seq
 250059387     gbpri7.seq
 250267513     gbpri8.seq
 250182875     gbpri9.seq
    325604     gbrel.txt
 250170470     gbrod1.seq
 250076277     gbrod10.seq
 250046491     gbrod11.seq
 250140011     gbrod12.seq
 250001460     gbrod13.seq
 250076451     gbrod14.seq
 250125238     gbrod15.seq
 250019831     gbrod16.seq
 250000477     gbrod17.seq
 250038782     gbrod18.seq
 250230008     gbrod19.seq
 250013655     gbrod2.seq
 250112663     gbrod20.seq
 250001241     gbrod21.seq
 250003855     gbrod22.seq
 250023675     gbrod23.seq
 250225220     gbrod24.seq
 250001558     gbrod25.seq
 181380023     gbrod26.seq
 250186463     gbrod3.seq
 250155443     gbrod4.seq
 250003494     gbrod5.seq
 250170395     gbrod6.seq
 250093824     gbrod7.seq
 250213886     gbrod8.seq
 250171009     gbrod9.seq
1552586792     gbsdr1.txt
4599825406     gbsdr2.txt
1967203095     gbsdr3.txt
 117934435     gbsec.idx
 250002840     gbsts1.seq
 250000051     gbsts10.seq
 250001117     gbsts11.seq
 250002763     gbsts12.seq
 250000666     gbsts13.seq
 250001496     gbsts14.seq
 250002313     gbsts15.seq
 250000949     gbsts16.seq
 250001651     gbsts17.seq
  48953338     gbsts18.seq
 250001798     gbsts2.seq
 250001049     gbsts3.seq
 250003031     gbsts4.seq
 250003373     gbsts5.seq
 250002668     gbsts6.seq
 250000183     gbsts7.seq
 250002100     gbsts8.seq
 250001612     gbsts9.seq
 250000732     gbsyn1.seq
 146220933     gbsyn2.seq
  10047685     gbtsa.seq
    430663     gbuna.seq
 250002557     gbvrl1.seq
  68868408     gbvrl10.seq
 250001325     gbvrl2.seq
 250005485     gbvrl3.seq
 250001532     gbvrl4.seq
 250002233     gbvrl5.seq
 250000623     gbvrl6.seq
 250000245     gbvrl7.seq
 250005685     gbvrl8.seq
 250000904     gbvrl9.seq
 250137525     gbvrt1.seq
 250013499     gbvrt10.seq
 250048806     gbvrt11.seq
 250108962     gbvrt12.seq
 250109989     gbvrt13.seq
 250001494     gbvrt14.seq
 250000597     gbvrt15.seq
 217803325     gbvrt16.seq
 250001474     gbvrt2.seq
 250117008     gbvrt3.seq
 250001555     gbvrt4.seq
 250000582     gbvrt5.seq
 250004164     gbvrt6.seq
 250259646     gbvrt7.seq
 250070111     gbvrt8.seq
 250109867     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         37985      103087307
BCT10        46128      97313396
BCT11        118        105721945
BCT12        140        104771590
BCT13        62         113763681
BCT14        47         112439895
BCT15        53         117813056
BCT16        53         116510730
BCT17        72         114855045
BCT18        40         111252551
BCT19        59         110053219
BCT2         3251       110513586
BCT20        66         113751799
BCT21        57         113214682
BCT22        66         109836677
BCT23        57         113012388
BCT24        48         110366471
BCT25        82         112049307
BCT26        66         111259766
BCT27        89         110223377
BCT28        267        103331657
BCT29        68110      83286227
BCT3         60         115722057
BCT30        77099      79700009
BCT31        47078      92212218
BCT32        7090       17695981
BCT4         22460      103645634
BCT5         54651      86880293
BCT6         5710       95834402
BCT7         13889      97090975
BCT8         5624       106922369
BCT9         23647      106459309
ENV1         91351      71716522
ENV10        59423      48626542
ENV2         95015      69338769
ENV3         83634      81639041
ENV4         89514      86660103
ENV5         110451     56163891
ENV6         125873     36804577
ENV7         89427      73983066
ENV8         86474      81951729
ENV9         79903      93673479
EST1         68125      26289403
EST10        76524      29834002
EST100       75486      34950706
EST101       75009      43146503
EST102       71268      36591486
EST103       74270      37011621
EST104       73086      40111802
EST105       74390      39713863
EST106       70390      39919818
EST107       68686      36533883
EST108       73300      36600330
EST109       72223      45448015
EST11        75175      28789926
EST110       72193      45587744
EST111       69910      43202474
EST112       72842      33133128
EST113       69573      29469615
EST114       67338      37812898
EST115       68175      36514923
EST116       68461      41647704
EST117       72429      36800803
EST118       75080      34648709
EST119       74542      27227139
EST12        77544      30745583
EST120       73706      34519684
EST121       73986      35748572
EST122       64719      36896553
EST123       80509      44758158
EST124       78080      43346741
EST125       68577      47951550
EST126       67580      39749692
EST127       74495      50929120
EST128       69124      41654243
EST129       74407      44783532
EST13        76983      29267115
EST130       73941      45645628
EST131       71491      49340319
EST132       72623      47801211
EST133       79066      44425836
EST134       75139      31080243
EST135       78167      34177166
EST136       79222      45795968
EST137       74706      43078198
EST138       64549      34648976
EST139       70669      36460001
EST14        78809      31965533
EST140       67838      37172271
EST141       65806      36675753
EST142       71503      43482741
EST143       72634      45635472
EST144       67822      39282225
EST145       68620      39487022
EST146       74391      45319848
EST147       67617      39739919
EST148       62619      35685308
EST149       99539      54163382
EST15        74538      31502042
EST150       79251      45321555
EST151       84675      44115275
EST152       104239     55162979
EST153       105251     57265407
EST154       98848      56443192
EST155       74313      44546078
EST156       93939      55920625
EST157       98630      59071549
EST158       92861      54892160
EST159       78938      45322109
EST16        75869      33347122
EST160       68819      37767828
EST161       66136      30117337
EST162       60230      27709054
EST163       56247      27399302
EST164       64846      31425958
EST165       54091      27153105
EST166       79645      53053897
EST167       67817      37281940
EST168       72142      52380947
EST169       72589      41383087
EST17        82082      33820980
EST170       60321      30330985
EST171       63787      37169603
EST172       65453      33509983
EST173       63502      45595034
EST174       62867      36341475
EST175       107318     47604843
EST176       87049      51634732
EST177       103581     59969743
EST178       107797     59386557
EST179       96684      52139246
EST18        80691      32364816
EST180       82347      38263897
EST181       96447      44801815
EST182       97699      48110595
EST183       93101      37430069
EST184       90219      43134393
EST185       63952      44504491
EST186       70649      37530862
EST187       57617      33931800
EST188       71410      43413528
EST189       72330      26720552
EST19        78660      31715009
EST190       75801      45463115
EST191       73142      36952723
EST192       68368      34780543
EST193       68283      39916018
EST194       69618      51893820
EST195       68858      39558133
EST196       67600      33738207
EST197       69082      52939799
EST198       68142      46192762
EST199       72239      37057510
EST2         74644      28643983
EST20        74627      30756939
EST200       68117      45884610
EST201       70146      58387505
EST202       63801      47386758
EST203       63471      46612088
EST204       63747      46092603
EST205       64768      45835795
EST206       66999      50504509
EST207       61579      40150072
EST208       61802      35613024
EST209       66472      37666254
EST21        74038      34350476
EST210       68494      38691675
EST211       91014      51446269
EST212       71549      50510267
EST213       88390      52011014
EST214       113229     69963858
EST215       115169     68308057
EST216       103648     62477629
EST217       98487      64055442
EST218       119097     56041036
EST219       97026      51727787
EST22        74912      30009022
EST220       85980      51939996
EST221       93071      41279998
EST222       86991      45350958
EST223       72479      47398662
EST224       66771      42928876
EST225       68624      57968316
EST226       67891      59149018
EST227       79814      40399524
EST228       80269      45454928
EST229       73734      52081037
EST23        77381      32705944
EST230       70884      51895428
EST231       45068      24453069
EST232       27996      10618419
EST233       27940      10318094
EST234       26571      9892410
EST235       26863      9084318
EST236       27701      9776844
EST237       27400      10160364
EST238       27383      9834708
EST239       27538      10325089
EST24        74758      32789050
EST240       27315      12196014
EST241       27425      11317294
EST242       27517      10196544
EST243       27825      9353317
EST244       27104      9280785
EST245       27996      11414942
EST246       27974      10889588
EST247       27228      11413228
EST248       26844      12062773
EST249       27279      11399609
EST25        74100      31976744
EST250       27246      11003114
EST251       27238      11659126
EST252       27354      11665319
EST253       27478      11099361
EST254       27473      10926209
EST255       27369      10558562
EST256       27320      11509141
EST257       24572      17398462
EST258       26014      17380933
EST259       48348      22474608
EST26        75168      31024583
EST260       89179      41025627
EST261       72612      42580904
EST262       71129      32872713
EST263       93068      40377357
EST264       70316      43884428
EST265       69181      44592907
EST266       69125      44316473
EST267       67575      41919486
EST268       73275      43087565
EST269       66323      38543559
EST27        74427      32413121
EST270       66492      50079207
EST271       60520      28515240
EST272       93544      45407733
EST273       95773      46623787
EST274       71523      40357408
EST275       61739      29840643
EST276       70725      36956160
EST277       70569      40456417
EST278       73717      34220756
EST279       70306      37812588
EST28        107890     51049016
EST280       70801      45050454
EST281       65092      37884455
EST282       69412      34008554
EST283       86423      46211890
EST284       73740      42032239
EST285       78466      55353947
EST286       86826      52022279
EST287       105794     47651268
EST288       78384      45804009
EST289       72078      41861241
EST29        97107      45876209
EST290       74041      39594740
EST291       68651      33258737
EST292       70410      28128399
EST293       66366      40016120
EST294       61814      35736284
EST295       66236      42195856
EST296       69234      39853105
EST297       63766      44075309
EST298       68707      34522092
EST299       81565      44042874
EST3         73730      29915710
EST30        98633      53896101
EST300       78864      42848127
EST301       86805      51731072
EST302       113226     51817153
EST303       108393     47992571
EST304       71316      37094364
EST305       67558      37166775
EST306       72369      46291458
EST307       80030      39051299
EST308       71245      43237517
EST309       70352      39285732
EST31        86682      50562197
EST310       59522      36367563
EST311       53187      29409755
EST312       69289      46764937
EST313       66378      41019242
EST314       69436      42878914
EST315       65481      38354401
EST316       77251      38626789
EST317       56926      30056266
EST318       55613      28401017
EST319       54255      29577469
EST32        65127      40693235
EST320       55139      28862193
EST321       53720      29174644
EST322       57434      25344145
EST323       58067      25479701
EST324       56609      23297168
EST325       57215      22954015
EST326       57141      22087248
EST327       58322      23787837
EST328       57303      22311117
EST329       58086      21507372
EST33        70612      57597862
EST330       60896      25065570
EST331       76008      42134245
EST332       76546      34969305
EST333       78610      32421943
EST334       76480      32285882
EST335       87434      53432093
EST336       62431      47840998
EST337       76116      49184417
EST338       96094      59504440
EST339       97717      57453064
EST34        84700      48512876
EST340       101679     57773126
EST341       99304      55057187
EST342       74296      38914310
EST343       69664      39876077
EST344       74231      44457163
EST345       61357      53900233
EST346       64849      46408051
EST347       62312      38130168
EST348       65326      40253448
EST349       71686      48431186
EST35        85782      42878242
EST350       47817      24035877
EST351       52529      26335987
EST352       74214      41324419
EST353       60932      31878262
EST354       60157      31270824
EST355       67090      43020806
EST356       83078      41794025
EST357       71160      41988443
EST358       68080      43724474
EST359       65020      37020821
EST36        89921      48471450
EST360       68092      44302365
EST361       86575      48927649
EST362       84715      50496830
EST363       75364      41456848
EST364       63039      36462720
EST365       67977      35031588
EST366       69545      38444161
EST367       47053      24082868
EST368       70797      40068962
EST369       70925      42669117
EST37        86717      61702415
EST370       98837      46115338
EST371       73863      47571653
EST372       70311      45478715
EST373       68931      44573942
EST374       63972      34961805
EST375       79608      37058077
EST376       77015      38608125
EST377       56814      39998217
EST378       59338      38844996
EST379       62386      38215242
EST38        77240      50263921
EST380       89621      51909731
EST381       86158      46280188
EST382       66303      44113378
EST383       77512      39650705
EST384       50395      31882473
EST385       44142      23145291
EST386       70312      45388789
EST387       79828      40708185
EST388       79143      46860770
EST389       73437      45806983
EST39        95857      56327670
EST390       77919      47326632
EST391       78267      50533959
EST392       86063      65022463
EST393       78437      69528821
EST394       87798      51844848
EST395       79650      54313041
EST396       71104      58449059
EST397       72262      39900123
EST398       60617      39289024
EST399       73604      40102845
EST4         74560      28391201
EST40        63845      49100302
EST400       53623      33222933
EST401       74611      31165183
EST402       79709      25495188
EST403       70040      45068532
EST404       66040      37882159
EST405       69684      36539984
EST406       66745      41194099
EST407       74239      47046786
EST408       65614      44249064
EST409       73787      43480367
EST41        78128      55394364
EST410       59359      32906931
EST411       64485      39217668
EST412       77718      50035756
EST413       83292      48432643
EST414       79838      44895069
EST415       58851      40761639
EST416       56024      40807329
EST417       56783      39973913
EST418       61424      39104047
EST419       75981      48250709
EST42        100768     48049302
EST420       51412      31063139
EST421       63089      38906743
EST422       60287      40004940
EST423       56438      41229367
EST424       60109      41572586
EST425       47538      33413124
EST426       84068      43110547
EST427       73743      39000920
EST428       70562      38852132
EST429       70629      38819220
EST43        75894      46167770
EST430       70496      39122103
EST431       70482      38957193
EST432       70382      39260112
EST433       69846      38818968
EST434       69826      38701057
EST435       69851      39690329
EST436       69523      38730834
EST437       68065      38508983
EST438       70121      39686343
EST439       70282      38522006
EST44        105048     44849434
EST440       70278      39067625
EST441       70286      38366001
EST442       70695      38691909
EST443       70588      38805844
EST444       70594      38741640
EST445       70746      38027405
EST446       81622      45637184
EST447       88178      47179705
EST448       82853      37832926
EST449       103509     59249272
EST45        92510      51445623
EST450       82599      45878976
EST451       75629      48298360
EST452       82601      47982456
EST453       88872      52539687
EST454       96939      60324012
EST455       82614      48995138
EST456       89184      49128672
EST457       87828      48333752
EST458       78728      57665706
EST459       91859      52548934
EST46        103526     45756218
EST460       76726      50871236
EST461       58417      41745465
EST462       96218      64918920
EST463       96661      66301168
EST464       102311     60842507
EST465       111840     44533562
EST466       78528      41807926
EST467       51621      40318776
EST468       67150      45242404
EST469       67040      37851428
EST47        70160      19034288
EST470       66101      39738701
EST471       105468     53575765
EST472       82622      49739509
EST473       87586      54559897
EST474       58540      40769550
EST475       45268      34516923
EST476       46873      58506267
EST477       65319      55879620
EST478       64504      41693534
EST479       73178      42570250
EST48        70451      18757242
EST480       72959      42879175
EST481       67111      43815166
EST482       67152      42364515
EST483       61356      50318264
EST484       109159     47959300
EST485       101107     48190246
EST486       67499      50208767
EST487       53763      38885575
EST488       57096      39670385
EST489       61997      41884419
EST49        72841      21728988
EST490       63883      48036126
EST491       63294      46342836
EST492       57531      39597257
EST493       50959      38534605
EST494       59084      40454816
EST495       58745      37930015
EST496       70847      41427766
EST497       60844      41282064
EST498       56896      38504908
EST499       62215      45430043
EST5         48193      15292118
EST50        44093      12154300
EST500       58389      45744287
EST501       66650      47325399
EST502       58092      40590334
EST503       56491      40623689
EST504       53040      34377424
EST505       56434      39472012
EST506       55266      36316228
EST507       77350      43252243
EST508       62689      51781877
EST509       73090      55337437
EST51        44038      12222409
EST510       77983      49310818
EST511       46691      56300035
EST512       53184      50460855
EST513       66770      53233997
EST514       57938      38937936
EST515       73077      39104489
EST516       84757      54944948
EST517       80885      53333832
EST518       73842      43973558
EST519       58706      38809506
EST52        43825      11870819
EST520       72628      47091676
EST521       81679      50049023
EST522       79291      55426850
EST523       71411      54861801
EST524       71445      50577074
EST525       65894      44295768
EST526       66011      50985546
EST527       62727      45397393
EST528       70341      44246631
EST529       78360      44833662
EST53        64243      24464286
EST530       97334      43199776
EST531       122707     46349975
EST532       87454      54569208
EST533       55387      49923185
EST534       56397      47724313
EST535       91952      21728728
EST536       99699      11057706
EST537       99477      12312203
EST538       94915      44544825
EST539       86887      31647465
EST54        96605      39158502
EST540       86053      34745006
EST541       61327      63756447
EST542       89690      56555707
EST543       82857      45736016
EST544       68719      42704514
EST545       71988      49383722
EST546       75926      48650885
EST547       89456      52581556
EST548       70777      51063898
EST549       69970      50182615
EST55        97045      42531157
EST550       69319      52045250
EST551       80723      54745251
EST552       86731      43702496
EST553       82803      47112218
EST554       83459      38828715
EST555       79142      41552292
EST556       79918      52295089
EST557       74291      55690279
EST558       71975      51921873
EST559       75928      44148850
EST56        97596      47119535
EST560       98336      49709354
EST561       112596     46994879
EST562       111414     48468020
EST563       130484     58927660
EST564       110969     53982038
EST565       77014      55394697
EST566       79432      33487464
EST567       84288      8748097
EST568       88182      25793658
EST569       115986     57006251
EST57        92584      46417811
EST570       93366      49298972
EST571       65959      43185627
EST572       70963      42369216
EST573       75655      51909119
EST574       70945      43292872
EST575       78070      46611413
EST576       68014      48541753
EST577       76125      52294453
EST578       98469      53296078
EST579       87235      42562485
EST58        103582     51181242
EST580       64340      41731363
EST581       62416      46892284
EST582       97217      59180062
EST583       89428      52172073
EST584       74795      42476755
EST585       86266      27567681
EST586       96768      10472272
EST587       96889      10256687
EST588       93106      25698031
EST589       70818      45048777
EST59        106437     54596694
EST590       94049      45472410
EST591       71411      50615628
EST592       78529      54904803
EST593       87515      53315928
EST594       85201      56269938
EST595       83037      55352867
EST596       81776      42577073
EST597       81449      48428741
EST598       72071      51452108
EST599       61412      40076625
EST6         54905      17436848
EST60        76030      33372423
EST600       80107      30959074
EST601       93669      40950861
EST602       49933      34816309
EST603       51543      31605926
EST604       50716      35445908
EST605       67500      42857357
EST606       67838      47160636
EST607       64704      47965285
EST608       119771     13985750
EST609       118201     14569998
EST61        66646      28476102
EST610       122569     11158624
EST611       122481     11293461
EST612       98250      26535040
EST613       64765      48473513
EST614       68220      47536566
EST615       78070      53534514
EST616       71032      49169390
EST617       67438      45805260
EST618       77696      44184166
EST619       63641      43191363
EST62        72722      32570189
EST620       73967      39317153
EST621       123631     15447395
EST622       127150     11897375
EST623       79132      41013805
EST624       74355      49330872
EST625       69951      50024025
EST626       94370      46445119
EST627       87507      56114673
EST628       63648      36735158
EST629       61663      32190263
EST63        70581      29993612
EST630       81413      63780151
EST631       71695      47120053
EST632       108438     47437252
EST633       84080      53697787
EST634       61407      48615922
EST635       64549      55311844
EST636       75846      42831334
EST637       82079      43922680
EST638       94002      55232100
EST639       83306      39410355
EST64        79688      32615418
EST640       74294      46667260
EST641       71396      47135776
EST642       70780      50971319
EST643       89071      39958565
EST644       77417      26374515
EST645       77602      24845622
EST646       75325      29422823
EST647       76380      26769187
EST648       76264      29234549
EST649       76225      29597083
EST65        77140      30252594
EST650       75633      28559706
EST651       76408      27937123
EST652       76503      29508321
EST653       76521      28899477
EST654       82094      44982558
EST655       80921      55574364
EST656       81953      59809341
EST657       83789      54943408
EST658       65063      33610533
EST659       61545      40750825
EST66        70458      28327055
EST660       79404      46712843
EST661       50372      25862426
EST662       41029      34315829
EST663       59651      45092113
EST664       58285      45169077
EST665       67520      46969453
EST666       81357      40426806
EST667       63689      39992663
EST668       89951      49284707
EST669       75329      43364031
EST67        64705      29620254
EST670       64626      42305813
EST671       78072      51321310
EST672       78960      42961700
EST673       62665      37117088
EST674       71441      50035141
EST675       73258      47143969
EST676       60338      41863769
EST677       70806      52316829
EST678       72040      47298594
EST679       74058      46317823
EST68        72963      32529439
EST680       68926      48414218
EST681       70553      52960589
EST682       81615      69549653
EST683       82049      69476646
EST684       80165      62741523
EST685       77410      39019138
EST686       71950      33063935
EST687       53183      30737501
EST688       68017      48385556
EST689       63489      40170500
EST69        79427      35592773
EST690       65935      48581781
EST691       68465      45958335
EST692       58573      39300588
EST693       56795      39026073
EST694       61882      41285125
EST695       68995      44165101
EST696       65198      44894671
EST697       65850      46031653
EST698       66079      45054368
EST699       69791      45596634
EST7         74531      29353676
EST70        73498      29341392
EST700       71056      39704004
EST701       68503      36136732
EST702       66624      40096994
EST703       67712      37677760
EST704       68980      40131265
EST705       69175      49501114
EST706       70938      56659969
EST707       64758      36091386
EST708       67406      40345625
EST709       67711      46330426
EST71        73806      25015643
EST710       59549      37150159
EST711       65477      40407962
EST712       62070      37753224
EST713       68706      43037643
EST714       92182      53224674
EST715       101720     50007173
EST716       70567      42877162
EST717       56900      27473267
EST718       52284      30868169
EST719       51834      31893909
EST72        86894      42217651
EST720       58634      40215591
EST721       60521      39342501
EST722       58276      37762087
EST723       66377      40776041
EST724       57211      37516113
EST725       54844      34270397
EST726       55504      34374362
EST727       79578      41149662
EST728       126780     37070130
EST729       80816      45191734
EST73        43954      12696003
EST730       73712      28622023
EST731       78899      37107706
EST732       64224      44535638
EST733       82407      46928454
EST734       81474      50115849
EST735       66873      43676041
EST736       81578      45140617
EST737       57406      38607877
EST738       57853      37522228
EST739       61392      42155735
EST74        40874      11260611
EST740       59765      39254963
EST741       60003      38666909
EST742       62780      41736758
EST743       80944      47945202
EST744       90425      63985894
EST745       81866      44259558
EST746       67098      36458888
EST747       59953      29971526
EST748       74874      41579261
EST749       82638      60936654
EST75        40850      12515453
EST750       77794      59354775
EST751       54051      38024103
EST752       32457      19723958
EST753       32684      19344556
EST754       32456      19594999
EST755       48532      26906616
EST756       61275      36615939
EST757       58776      35122822
EST758       58733      35230008
EST759       59116      34272301
EST76        41228      12730524
EST760       70792      19821459
EST761       70958      14800681
EST762       71293      13980470
EST763       70933      14825126
EST764       71210      14173458
EST765       69968      18811895
EST766       85121      45769118
EST767       78066      57976169
EST768       72445      44711386
EST769       61435      39710769
EST77        41274      12338337
EST770       60486      40029173
EST771       60418      38520099
EST772       61924      39446730
EST773       62621      37354338
EST774       64495      39316143
EST775       84142      49675029
EST776       77673      52478000
EST777       60905      35598437
EST778       77997      53696747
EST779       77318      14394300
EST78        41244      13330271
EST780       75576      5877015
EST781       75773      5850437
EST782       70484      6063071
EST783       69080      6166987
EST784       70524      10679667
EST785       70855      15006485
EST786       71143      14335785
EST787       71106      14420172
EST788       71046      14558093
EST789       71270      14034958
EST79        40995      13023750
EST790       70822      15084210
EST791       66737      42288473
EST792       64959      41029210
EST793       79659      40475846
EST794       83765      55730828
EST795       78393      40944688
EST796       71299      25372110
EST797       73084      27106466
EST798       72506      26258123
EST799       79251      26707064
EST8         75810      30584188
EST80        41041      12262440
EST800       72629      27332141
EST801       68007      28848589
EST802       24912      7783677
EST81        40611      12120632
EST82        41359      12908870
EST83        41909      11978787
EST84        41487      13235885
EST85        41351      13058500
EST86        42961      13082170
EST87        46667      17288181
EST88        43357      27222605
EST89        43050      19570387
EST9         77564      29870697
EST90        49439      20284334
EST91        51551      22240706
EST92        51014      22004749
EST93        84132      49835822
EST94        79483      38757178
EST95        72644      27616943
EST96        74542      29315402
EST97        74671      40808097
EST98        77241      40683215
EST99        76761      44064984
GSS1         90430      38662943
GSS10        74787      43607320
GSS100       80735      53971664
GSS101       74738      42240517
GSS102       73329      45795023
GSS103       73648      44992357
GSS104       73318      45586185
GSS105       73322      44678178
GSS106       74426      45470373
GSS107       81407      54214366
GSS108       83607      55584656
GSS109       80497      53099504
GSS11        70802      35983221
GSS110       83236      50414169
GSS111       84022      55210073
GSS112       79938      61714412
GSS113       90046      45964896
GSS114       90349      54605890
GSS115       75631      49835317
GSS116       87925      63549447
GSS117       82334      60106582
GSS118       75605      39949531
GSS119       81448      52672069
GSS12        73150      38495437
GSS120       95653      53247821
GSS121       84443      55332718
GSS122       85011      54678646
GSS123       82368      54883067
GSS124       76259      69411509
GSS125       76066      67163569
GSS126       79639      56039680
GSS127       72433      50238646
GSS128       72549      50010064
GSS129       73030      49226869
GSS13        76795      38906116
GSS130       72287      50500475
GSS131       73656      49939229
GSS132       83999      59977943
GSS133       81197      58380156
GSS134       70044      56408758
GSS135       70519      55044741
GSS136       75952      67607108
GSS137       75457      63186502
GSS138       77457      52326030
GSS139       85499      53662696
GSS14        71379      32114760
GSS140       94711      58049538
GSS141       93303      59893634
GSS142       81959      53930110
GSS143       89769      50596214
GSS144       72103      59090159
GSS145       114930     59510836
GSS146       111067     58394737
GSS147       86226      63647120
GSS148       55178      31343387
GSS149       67105      47299600
GSS15        70493      35055254
GSS150       72995      55896884
GSS151       72982      55920430
GSS152       73000      55888683
GSS153       73012      55866150
GSS154       72970      55939668
GSS155       72980      55922259
GSS156       75708      57785716
GSS157       83527      39195265
GSS158       88049      60128101
GSS159       86771      64920423
GSS16        78213      46093569
GSS160       88032      59819062
GSS161       92550      57472558
GSS162       82885      57227406
GSS163       76243      49677822
GSS164       75772      48590426
GSS165       92705      58637962
GSS166       88991      59730761
GSS167       85988      61453517
GSS168       102785     26254090
GSS169       103091     29421157
GSS17        70895      33315071
GSS170       78937      46757646
GSS171       80953      52896553
GSS172       54393      39355316
GSS173       52629      40815204
GSS174       61916      51489913
GSS175       59033      45447126
GSS176       57768      48361707
GSS177       57489      48794310
GSS178       58190      46599959
GSS179       58380      46034204
GSS18        58792      27918452
GSS180       58913      47990219
GSS181       58948      48421626
GSS182       58611      49465131
GSS183       58245      48434809
GSS184       58637      46079420
GSS185       58719      49348955
GSS186       60104      50321764
GSS187       60305      49772098
GSS188       60508      49164257
GSS189       60377      49554722
GSS19        56814      29015258
GSS190       60516      49138957
GSS191       60060      46962471
GSS192       59200      45202313
GSS193       58415      47678703
GSS194       58931      46062299
GSS195       58876      46232825
GSS196       58306      48020428
GSS197       58245      48210188
GSS198       58202      48387004
GSS199       60127      50007696
GSS2         89000      39334171
GSS20        57683      26671178
GSS200       59839      50876053
GSS201       59838      49497368
GSS202       60656      45813431
GSS203       60308      46895293
GSS204       59407      49677503
GSS205       59531      49301271
GSS206       59551      49239309
GSS207       59455      49530770
GSS208       59579      49152997
GSS209       59522      49326606
GSS21        61491      29519987
GSS210       59723      48712929
GSS211       59642      48960618
GSS212       59849      48330986
GSS213       58886      46171120
GSS214       58868      45994499
GSS215       58413      47567397
GSS216       58238      48171337
GSS217       58745      46253148
GSS218       57876      48032392
GSS219       64298      54163485
GSS22        64602      37591837
GSS220       64817      54769958
GSS221       89902      58795964
GSS222       84295      44773209
GSS223       78136      60371736
GSS224       83485      53267000
GSS225       91296      49820327
GSS226       75286      51935250
GSS227       71267      47113208
GSS228       71250      47155099
GSS229       95864      51401755
GSS23        57530      27078431
GSS230       99936      64620685
GSS231       86959      56293913
GSS232       96188      62489933
GSS233       95177      63748502
GSS234       96245      62423957
GSS235       95244      63549310
GSS236       95366      63292630
GSS237       92351      67045932
GSS238       94160      64797649
GSS239       94730      64082872
GSS24        66204      42045465
GSS240       92708      66603193
GSS241       93223      65960615
GSS242       93514      65605769
GSS243       92264      67436181
GSS244       94722      64620437
GSS245       90096      69967289
GSS246       88195      68094915
GSS247       74079      52063976
GSS248       57273      34832409
GSS249       38997      24737188
GSS25        68012      28208036
GSS250       87217      64373883
GSS251       83566      62776031
GSS252       103540     48483911
GSS253       68530      58477321
GSS254       68305      58780400
GSS255       69369      56628381
GSS256       69629      56122564
GSS257       70549      56031360
GSS258       76223      57617337
GSS259       75918      58207370
GSS26        58165      25385995
GSS260       87215      74862382
GSS261       81577      44450380
GSS262       92198      44663657
GSS263       84649      64710112
GSS264       71286      59060430
GSS265       69694      58679614
GSS266       65139      62481473
GSS267       72980      48816193
GSS268       86771      34797714
GSS269       112723     70591694
GSS27        65496      32012382
GSS270       94949      75105285
GSS271       94412      49704007
GSS272       106409     58075599
GSS273       120672     73157517
GSS274       117335     76455142
GSS275       105014     56031468
GSS276       82745      54504973
GSS277       95126      59659055
GSS278       107324     78645180
GSS279       108174     77737159
GSS28        65277      32524263
GSS280       106138     79943501
GSS281       105057     81113062
GSS282       76838      51605435
GSS283       108206     65748843
GSS284       109872     66411798
GSS285       106648     59622383
GSS286       68481      37441557
GSS287       70209      39114793
GSS288       88669      44463461
GSS289       81637      45113812
GSS29        77560      39751724
GSS290       109460     57442394
GSS291       85677      50315778
GSS292       105339     59012959
GSS293       115405     41727653
GSS294       115631     44545878
GSS295       94794      73330877
GSS296       95872      55062873
GSS297       95364      37373389
GSS298       95597      36967311
GSS299       95851      36540192
GSS3         87422      41844005
GSS30        82722      39709532
GSS300       94452      38888762
GSS301       102286     62831084
GSS302       94514      61248322
GSS303       94849      60760745
GSS304       95052      60468383
GSS305       84020      55739568
GSS306       83903      28239656
GSS307       84172      27748051
GSS308       85189      27626075
GSS309       12713      5752060
GSS31        74196      40403296
GSS32        70296      48150506
GSS33        79819      37806757
GSS34        75886      40326853
GSS35        74137      39965937
GSS36        87407      56321961
GSS37        87597      58175336
GSS38        85527      44938754
GSS39        86748      50382457
GSS4         79227      41150659
GSS40        86338      39890925
GSS41        83128      32053103
GSS42        81246      56934526
GSS43        80119      58036205
GSS44        72015      47522099
GSS45        72042      47418737
GSS46        77593      45700878
GSS47        77817      38710219
GSS48        83136      57946480
GSS49        86562      64736594
GSS5         78819      40567994
GSS50        81619      54415202
GSS51        93859      59286241
GSS52        88468      58760461
GSS53        76598      42227197
GSS54        72837      40526305
GSS55        86497      47027164
GSS56        88038      58467263
GSS57        76195      63888101
GSS58        70809      77994698
GSS59        85505      69015835
GSS6         78088      38842501
GSS60        89580      60228581
GSS61        63450      44798512
GSS62        66010      45382089
GSS63        89643      67177279
GSS64        84960      58429020
GSS65        86085      52989465
GSS66        85463      55672245
GSS67        93346      57853897
GSS68        97857      52536797
GSS69        97528      52972908
GSS7         77657      39174963
GSS70        98228      52048388
GSS71        99183      50781820
GSS72        99205      50753178
GSS73        99077      50923874
GSS74        99695      50102347
GSS75        97770      52652118
GSS76        91867      64654021
GSS77        89865      70740033
GSS78        88925      70111547
GSS79        87858      69635748
GSS8         75881      38134490
GSS80        87908      63986891
GSS81        88312      44882444
GSS82        78277      23271484
GSS83        78145      23584254
GSS84        84149      48917342
GSS85        77098      45548204
GSS86        88958      56028697
GSS87        84342      58665578
GSS88        75464      75654161
GSS89        78488      73099327
GSS9         72240      37167492
GSS90        83987      46687847
GSS91        85043      49406143
GSS92        73869      40395541
GSS93        80113      56218088
GSS94        76471      56905463
GSS95        82996      52877042
GSS96        82955      59174299
GSS97        85633      57672356
GSS98        86989      52201941
GSS99        82545      66443743
HTC1         25182      27239764
HTC10        63605      85166402
HTC11        67066      59970962
HTC12        70719      69845809
HTC13        4938       2858188
HTC2         16163      36534406
HTC3         16151      36807462
HTC4         16390      35877969
HTC5         16090      40454992
HTC6         16184      37874084
HTC7         55463      33965606
HTC8         82720      60349715
HTC9         74635      70557423
HTG1         1318       188929277
HTG10        1300       186477873
HTG100       1335       191169917
HTG101       1122       190121876
HTG102       1144       190022286
HTG103       1401       190534721
HTG104       1129       190599436
HTG105       1129       187012231
HTG106       1600       189291361
HTG107       979        193491311
HTG108       748        168963944
HTG109       1091       193951064
HTG11        1452       184100451
HTG110       1105       193259844
HTG111       1014       190148563
HTG112       1086       192314399
HTG113       1082       192481525
HTG114       1140       192248015
HTG115       1095       192447207
HTG116       1191       192637170
HTG117       1176       192563319
HTG118       1177       192258939
HTG119       1176       191712283
HTG12        876        192056419
HTG120       1309       191377529
HTG121       1259       191122780
HTG122       627        85461866
HTG13        750        192437652
HTG14        744        192158023
HTG15        782        192230176
HTG16        803        192009637
HTG17        769        192283132
HTG18        2064       171033537
HTG19        1071       187903257
HTG2         2465       186071856
HTG20        963        189548030
HTG21        784        191909290
HTG22        923        190306412
HTG23        902        190717511
HTG24        811        191592140
HTG25        776        192067539
HTG26        868        191479631
HTG27        889        190824411
HTG28        946        190172111
HTG29        899        191050856
HTG3         2517       185290576
HTG30        927        190341026
HTG31        870        191282856
HTG32        966        189711739
HTG33        883        191133821
HTG34        862        191459235
HTG35        822        191882341
HTG36        946        190165839
HTG37        931        190844490
HTG38        936        190384520
HTG39        1042       189423264
HTG4         2553       188532563
HTG40        1206       186874595
HTG41        1261       188238239
HTG42        1174       188051970
HTG43        1153       187982687
HTG44        1118       191410240
HTG45        1273       190757992
HTG46        1178       191498464
HTG47        1132       191453158
HTG48        1039       191574728
HTG49        1021       189959989
HTG5         1284       185715991
HTG50        1125       190248413
HTG51        973        190405971
HTG52        1105       190251567
HTG53        1046       190377837
HTG54        1015       189931982
HTG55        971        189376471
HTG56        1021       189604526
HTG57        1026       190156085
HTG58        1054       188046885
HTG59        1107       188062998
HTG6         1274       185234665
HTG60        1136       189437349
HTG61        1090       189732943
HTG62        1067       189743769
HTG63        1171       188988580
HTG64        1180       187691324
HTG65        1284       184555785
HTG66        1231       185463155
HTG67        1241       184776066
HTG68        1246       184744581
HTG69        1199       187559518
HTG7         1277       185414872
HTG70        1126       188979507
HTG71        1120       188563221
HTG72        1102       190976099
HTG73        1137       191173960
HTG74        1185       190996133
HTG75        1124       190606322
HTG76        1174       190515264
HTG77        1115       190280633
HTG78        1211       190271712
HTG79        1130       189978873
HTG8         1459       184762119
HTG80        1110       190259336
HTG81        1258       188355805
HTG82        1244       188502138
HTG83        1155       190302692
HTG84        1155       190103622
HTG85        1118       190497013
HTG86        1208       190439612
HTG87        1132       190664360
HTG88        1165       190760701
HTG89        1116       191202227
HTG9         1200       186999351
HTG90        1164       191395340
HTG91        1084       191360949
HTG92        1192       191643774
HTG93        1064       189768677
HTG94        1081       189812497
HTG95        1012       190052551
HTG96        1031       189827775
HTG97        991        189677269
HTG98        1003       189498664
HTG99        983        189592922
INV1         85671      63199158
INV10        85083      66089514
INV11        86386      64971472
INV12        70058      79172830
INV13        15900      67982201
INV2         1562       185483388
INV3         808        169978320
INV4         50407      96928913
INV5         70955      81072849
INV6         23522      127817507
INV7         71508      74138353
INV8         77385      71421640
INV9         65038      84051987
MAM1         12528      166101030
MAM2         62931      96031336
MAM3         34571      123466322
MAM4         62037      56656025
PAT1         222610     70141260
PAT10        125342     99572764
PAT11        141789     62565327
PAT12        105812     59886069
PAT13        103596     50198861
PAT14        121372     53373401
PAT15        113141     61257330
PAT16        145008     54908547
PAT17        155446     69964752
PAT18        97460      122619004
PAT19        147659     87305490
PAT2         194518     84660818
PAT20        117456     104509866
PAT21        123746     103451965
PAT22        119070     106228471
PAT23        146385     86147274
PAT24        175166     64143344
PAT25        140457     60991542
PAT26        100419     79520850
PAT27        108681     70815145
PAT28        111348     66577932
PAT29        113617     67410371
PAT3         171986     95895471
PAT30        129236     68268266
PAT31        111310     78154097
PAT32        138112     29117385
PAT33        158493     24106566
PAT34        114730     48995774
PAT35        88806      90774757
PAT36        104028     74640478
PAT37        133470     96740386
PAT38        161843     99371034
PAT39        125372     122622690
PAT4         153751     106059941
PAT40        159973     97932114
PAT41        134261     117307395
PAT42        23257      183481910
PAT43        166307     103291734
PAT44        281017     7025425
PAT45        236564     35276126
PAT46        342936     8573400
PAT47        179736     74053626
PAT5         184019     85620296
PAT6         156350     93374367
PAT7         152370     81741138
PAT8         104607     119444729
PAT9         143602     89174290
PHG          4015       32181914
PLN1         60238      93165167
PLN10        13800      133911748
PLN11        20815      136855916
PLN12        17710      145992003
PLN13        17571      146271860
PLN14        22755      139854469
PLN15        6324       157777111
PLN16        1470       171685373
PLN17        81         186636665
PLN18        6          163930483
PLN19        21817      143421195
PLN2         2129       164274056
PLN20        68475      70215225
PLN21        74523      79819811
PLN22        72671      76559194
PLN23        8755       134096755
PLN24        26232      135853046
PLN25        68521      88436254
PLN26        75668      78556644
PLN27        97709      54484171
PLN28        81577      73972655
PLN29        81103      71860990
PLN3         1563       182734671
PLN30        105625     56734993
PLN31        77359      76672209
PLN32        8778       19961000
PLN4         1978       191132159
PLN5         21209      144993446
PLN6         75914      78900236
PLN7         73956      76350546
PLN8         40075      52871852
PLN9         34258      83177385
PRI1         33835      116081062
PRI10        1448       182648841
PRI11        1285       179415902
PRI12        1448       177690472
PRI13        1592       180381653
PRI14        1592       182043355
PRI15        1286       191964893
PRI16        1139       193830345
PRI17        1100       194432678
PRI18        1197       193587602
PRI19        2154       190045022
PRI2         1643       172574468
PRI20        44646      117733208
PRI21        64672      81021282
PRI22        36166      85407539
PRI23        2615       178135054
PRI24        2183       182432282
PRI25        1603       182787810
PRI26        2010       182650725
PRI27        2110       182044752
PRI28        12853      157049945
PRI29        1661       177354804
PRI3         1308       183438540
PRI30        56574      88820446
PRI31        35384      69245637
PRI32        21284      109401951
PRI33        19364      149232213
PRI34        66669      86920294
PRI35        60550      86130909
PRI36        42149      79654092
PRI4         1347       185576366
PRI5         1199       181070059
PRI6         1185       179128978
PRI7         1233       180935126
PRI8         1320       176677110
PRI9         1248       174806991
ROD1         29398      145248238
ROD10        975        181407723
ROD11        1036       185791334
ROD12        942        183003719
ROD13        1039       189331709
ROD14        950        180462863
ROD15        968        182164790
ROD16        994        186082703
ROD17        9713       175698049
ROD18        27390      139621421
ROD19        1133       183070945
ROD2         912        175008954
ROD20        1184       184215986
ROD21        12964      165105579
ROD22        38800      70250821
ROD23        20460      110834116
ROD24        1515       190168095
ROD25        146312     22150978
ROD26        53229      56439883
ROD3         913        173613772
ROD4         903        174113178
ROD5         929        174104515
ROD6         982        179430604
ROD7         957        179789624
ROD8         994        182313248
ROD9         1002       182289292
STS1         84909      36523903
STS10        57981      44440179
STS11        57899      43582829
STS12        66657      42476872
STS13        98620      33511784
STS14        107138     27754813
STS15        106069     28906628
STS16        85236      34563504
STS17        103976     32718013
STS18        21441      6430967
STS2         84931      49980847
STS3         70631      26651644
STS4         74027      37508620
STS5         54834      32081262
STS6         54794      32059771
STS7         54680      32178936
STS8         55872      37166887
STS9         57890      44468176
SYN1         48035      72250618
SYN2         28875      39557582
TSA          3209       2720551
UNA          214        116246
VRL1         71934      66630875
VRL10        19163      19051912
VRL2         70781      64781746
VRL3         73266      63361163
VRL4         68950      70031637
VRL5         52875      74728114
VRL6         63366      71853056
VRL7         68591      67095916
VRL8         59541      72710832
VRL9         65827      72698939
VRT1         24134      153989282
VRT10        11271      175613247
VRT11        10826      177363122
VRT12        6675       180757038
VRT13        4654       186202503
VRT14        56556      104720673
VRT15        80091      68926338
VRT16        69112      58798607
VRT2         42581      130562205
VRT3         31174      139936296
VRT4         52986      107316473
VRT5         62896      66384336
VRT6         32492      62267814
VRT7         10589      173583017
VRT8         1278       190483884
VRT9         1284       189957007

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 168.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

11550460 13148670755   Homo sapiens
7255650   8361230436   Mus musculus
1757685   6060823765   Rattus norvegicus
2086880   5235078866   Bos taurus
3181318   4600009751   Zea mays
2489204   3551438061   Sus scrofa
1591342   2978804803   Danio rerio
1205529   1533859717   Oryza sativa Japonica Group
228091    1352737662   Strongylocentrotus purpuratus
1673038   1142531302   Nicotiana tabacum
1413112   1088892839   Xenopus (Silurana) tropicalis
212967     996533885   Pan troglodytes
780860     913586921   Drosophila melanogaster
2211104    912500625   Arabidopsis thaliana
650374     905797007   Vitis vinifera
804246     871336795   Gallus gallus
77069      803847320   Macaca mulatta
1215319    748031972   Ciona intestinalis
1224224    744373069   Canis lupus familiaris
1725913    680988452   Glycine max

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          October 15 2008

                NCBI-GenBank Flat File Release 168.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 168.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev

User Support
	Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian, David Wheeler

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center