Release Notes For GenBank Release 169

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2008

               NCBI-GenBank Flat File Release 169.0

                    Distribution Release Notes

 98868465 loci, 99116431942 bases, from 98868465 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 169.0
1.2 Cutoff Date
1.3 Important Changes in Release 169.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 169.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 169.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 169.0, incorporates data available to the collaborating
databases as of December 11, 2008 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 169.0

1.3.1 Organizational changes

  As described in a post to the GenBank Newsgroup on December 11, 2008, the
number of sequence data files associated with this GenBank release has 
increased by a larger-than-usual amount, due to changes in the way that data
are processed and stored at NCBI. Thus the per-division increases described
below reflect both the storage-related changes *and* actual database growth.

  In addition, GenBank divisions which consist of a single data file now
include a number in their names:

     gbtsa.seq -> gbtsa1.seq
     gbuna.seq -> gbuna1.seq

The total number of sequence data files increased by 94 with this release:

  - the BCT division is now composed of  34 files (+2)
  - the CON division is now composed of 128 files (+25)
  - the ENV division is now composed of  11 files (+1)
  - the EST division is now composed of 822 files (+20)
  - the GSS division is now composed of 319 files (+10)
  - the HTC division is now composed of  13 files (+1)
  - the HTG division is now composed of 134 files (+12)
  - the INV division is now composed of  14 files (+1)
  - the PAT division is now composed of  55 files (+8)
  - the PLN division is now composed of  37 files (+5)
  - the PRI division is now composed of  39 files (+3)
  - the ROD division is now composed of  28 files (+2)
  - the STS division is now composed of  20 files (+2)
  - the VRL division is now composed of  11 files (+1)
  - the VRT division is now composed of  17 files (+1)

In addition, the total number of index files increased by 3 with this release:

  - the AUT index is now composed of 62 files (+3)

1.3.2 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
sixty-nine of the GSS flatfiles in Release 169.0. Consider gbgss251.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        December 15 2008

                NCBI-GenBank Flat File Release 169.0

                           GSS Sequences (Part 1)

   87209 loci,    64341123 bases, from    87209 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "251" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 PROJECT linetype to be replaced by DBLINK (April 2009)

  The PROJECT linetype allows a sequence record to be linked to information
about the sequencing project that generated the data which ultimately
resulted in the record's submission to the International Nucleotide Sequence
Database ( INSD; see http://www.insdc.org ) .

  This complete bacterial GenBank record illustrates the use of the PROJECT
line:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471

  When viewed on the web in NCBI's Entrez:Nucleotide, the record's project
identifier (28471) links to an entry in the Genome Project Database (GPDB) :

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/sites/entrez?db=genomeprj&cmd=Retrieve&dopt=Overview&uid=28471

where information about the sequencing center, the bacterium, and other
GenBank records (eg, plasmids) associated with the sequencing project
can be found.

  Since the introduction of PROJECT, the scope of the "Genome" Project
Database has expanded, to include projects that are not necessarily targetted
to the sequencing of a complete genome.

  In addition, there can be other resources which underlie an INSD sequence
record, such as the Trace Assembly Archive at the NCBI:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/assembly/assmbrowser.cgi?cmd=show&f=tree&m=main&s=tree

  Because of the expanded scope of the GPDB, and because we anticipate a need
to link to more resources than just the GPDB, the PROJECT linetype is going to
be replaced by a new linetype:

   DBLINK

  Modifications to linetypes can be disruptive, so the switch to DBLINK will occur
in several stages. As of October 2008, links to the NCBI Trace Assembly Archive are
displayed via a line of text in the COMMENT section of sequence records. Here is a
mock-up, based on CP000964, to illustrate that initial change:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471
....
COMMENT     Trace Assembly Archive:123456
            The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

Note: Use of the Trace Assembly Archive is still in its early stages, so only
a few records are expected to have these links in the short term.

  The new DBLINK linetype will then be introduced with GenBank Release 170.0 ,
on or near February 15, 2009 .

  The Genome Project ID and the Trace Assembly Archive ID will be presented
via DBLINK, and the existing PROJECT line will continue to be displayed:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

PROJECT and DBLINK will co-exist for one GenBank release, until Release 171.0
(April 15, 2009), at which point the PROJECT line will be removed. In its final
state, our mock-up for CP000964 becomes:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

  In summary: The PROJECT linetype will be replaced by DBLINK as of GenBank
Release 171.0 in April 2009.

  For those who process sequence data in NCBI's ASN.1 format: The
underlying representation for (Genome) Project IDs will remain unchanged.
There will be no changes to the ASN.1 User-object that is used to store them:

    user {
      type
        str "GenomeProjectsDB" ,
      data {
        {
          label
            str "ProjectID" ,
          data
            int 28471 } ,
        {
          label
            str "ParentID" ,
          data
            int 0 } } } ,

  However, to support linkages to other resources, such as the Trace
Assembly Archive, a new "DBLink" User-object will be introduced:

    user {
      type
        str "DBLink" ,
      data {
        {
          label
            str "Trace Assembly Archive" ,
          data
            ints { 123456 } } } }

  As new types of linkages are established, they will be added to
the DBLink User-object, and displayed via the DBLINK linetype in
the GenBank flatfile format. 

  There is a possibility that the GenomeProjectsDB User-object
might someday be incorporated into the new DBLink User-object.
But at the moment, there are no firm plans to do so.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1775 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut7.idx - Index of the entries according to author name, part 7.
64. gbaut8.idx - Index of the entries according to author name, part 8.
65. gbaut9.idx - Index of the entries according to author name, part 9.
66. gbbct1.seq - Bacterial sequence entries, part 1.
67. gbbct10.seq - Bacterial sequence entries, part 10.
68. gbbct11.seq - Bacterial sequence entries, part 11.
69. gbbct12.seq - Bacterial sequence entries, part 12.
70. gbbct13.seq - Bacterial sequence entries, part 13.
71. gbbct14.seq - Bacterial sequence entries, part 14.
72. gbbct15.seq - Bacterial sequence entries, part 15.
73. gbbct16.seq - Bacterial sequence entries, part 16.
74. gbbct17.seq - Bacterial sequence entries, part 17.
75. gbbct18.seq - Bacterial sequence entries, part 18.
76. gbbct19.seq - Bacterial sequence entries, part 19.
77. gbbct2.seq - Bacterial sequence entries, part 2.
78. gbbct20.seq - Bacterial sequence entries, part 20.
79. gbbct21.seq - Bacterial sequence entries, part 21.
80. gbbct22.seq - Bacterial sequence entries, part 22.
81. gbbct23.seq - Bacterial sequence entries, part 23.
82. gbbct24.seq - Bacterial sequence entries, part 24.
83. gbbct25.seq - Bacterial sequence entries, part 25.
84. gbbct26.seq - Bacterial sequence entries, part 26.
85. gbbct27.seq - Bacterial sequence entries, part 27.
86. gbbct28.seq - Bacterial sequence entries, part 28.
87. gbbct29.seq - Bacterial sequence entries, part 29.
88. gbbct3.seq - Bacterial sequence entries, part 3.
89. gbbct30.seq - Bacterial sequence entries, part 30.
90. gbbct31.seq - Bacterial sequence entries, part 31.
91. gbbct32.seq - Bacterial sequence entries, part 32.
92. gbbct33.seq - Bacterial sequence entries, part 33.
93. gbbct34.seq - Bacterial sequence entries, part 34.
94. gbbct4.seq - Bacterial sequence entries, part 4.
95. gbbct5.seq - Bacterial sequence entries, part 5.
96. gbbct6.seq - Bacterial sequence entries, part 6.
97. gbbct7.seq - Bacterial sequence entries, part 7.
98. gbbct8.seq - Bacterial sequence entries, part 8.
99. gbbct9.seq - Bacterial sequence entries, part 9.
100. gbchg.txt - Accession numbers of entries updated since the previous release.
101. gbcon1.seq - Constructed sequence entries, part 1.
102. gbcon10.seq - Constructed sequence entries, part 10.
103. gbcon100.seq - Constructed sequence entries, part 100.
104. gbcon101.seq - Constructed sequence entries, part 101.
105. gbcon102.seq - Constructed sequence entries, part 102.
106. gbcon103.seq - Constructed sequence entries, part 103.
107. gbcon104.seq - Constructed sequence entries, part 104.
108. gbcon105.seq - Constructed sequence entries, part 105.
109. gbcon106.seq - Constructed sequence entries, part 106.
110. gbcon107.seq - Constructed sequence entries, part 107.
111. gbcon108.seq - Constructed sequence entries, part 108.
112. gbcon109.seq - Constructed sequence entries, part 109.
113. gbcon11.seq - Constructed sequence entries, part 11.
114. gbcon110.seq - Constructed sequence entries, part 110.
115. gbcon111.seq - Constructed sequence entries, part 111.
116. gbcon112.seq - Constructed sequence entries, part 112.
117. gbcon113.seq - Constructed sequence entries, part 113.
118. gbcon114.seq - Constructed sequence entries, part 114.
119. gbcon115.seq - Constructed sequence entries, part 115.
120. gbcon116.seq - Constructed sequence entries, part 116.
121. gbcon117.seq - Constructed sequence entries, part 117.
122. gbcon118.seq - Constructed sequence entries, part 118.
123. gbcon119.seq - Constructed sequence entries, part 119.
124. gbcon12.seq - Constructed sequence entries, part 12.
125. gbcon120.seq - Constructed sequence entries, part 120.
126. gbcon121.seq - Constructed sequence entries, part 121.
127. gbcon122.seq - Constructed sequence entries, part 122.
128. gbcon123.seq - Constructed sequence entries, part 123.
129. gbcon124.seq - Constructed sequence entries, part 124.
130. gbcon125.seq - Constructed sequence entries, part 125.
131. gbcon126.seq - Constructed sequence entries, part 126.
132. gbcon127.seq - Constructed sequence entries, part 127.
133. gbcon128.seq - Constructed sequence entries, part 128.
134. gbcon13.seq - Constructed sequence entries, part 13.
135. gbcon14.seq - Constructed sequence entries, part 14.
136. gbcon15.seq - Constructed sequence entries, part 15.
137. gbcon16.seq - Constructed sequence entries, part 16.
138. gbcon17.seq - Constructed sequence entries, part 17.
139. gbcon18.seq - Constructed sequence entries, part 18.
140. gbcon19.seq - Constructed sequence entries, part 19.
141. gbcon2.seq - Constructed sequence entries, part 2.
142. gbcon20.seq - Constructed sequence entries, part 20.
143. gbcon21.seq - Constructed sequence entries, part 21.
144. gbcon22.seq - Constructed sequence entries, part 22.
145. gbcon23.seq - Constructed sequence entries, part 23.
146. gbcon24.seq - Constructed sequence entries, part 24.
147. gbcon25.seq - Constructed sequence entries, part 25.
148. gbcon26.seq - Constructed sequence entries, part 26.
149. gbcon27.seq - Constructed sequence entries, part 27.
150. gbcon28.seq - Constructed sequence entries, part 28.
151. gbcon29.seq - Constructed sequence entries, part 29.
152. gbcon3.seq - Constructed sequence entries, part 3.
153. gbcon30.seq - Constructed sequence entries, part 30.
154. gbcon31.seq - Constructed sequence entries, part 31.
155. gbcon32.seq - Constructed sequence entries, part 32.
156. gbcon33.seq - Constructed sequence entries, part 33.
157. gbcon34.seq - Constructed sequence entries, part 34.
158. gbcon35.seq - Constructed sequence entries, part 35.
159. gbcon36.seq - Constructed sequence entries, part 36.
160. gbcon37.seq - Constructed sequence entries, part 37.
161. gbcon38.seq - Constructed sequence entries, part 38.
162. gbcon39.seq - Constructed sequence entries, part 39.
163. gbcon4.seq - Constructed sequence entries, part 4.
164. gbcon40.seq - Constructed sequence entries, part 40.
165. gbcon41.seq - Constructed sequence entries, part 41.
166. gbcon42.seq - Constructed sequence entries, part 42.
167. gbcon43.seq - Constructed sequence entries, part 43.
168. gbcon44.seq - Constructed sequence entries, part 44.
169. gbcon45.seq - Constructed sequence entries, part 45.
170. gbcon46.seq - Constructed sequence entries, part 46.
171. gbcon47.seq - Constructed sequence entries, part 47.
172. gbcon48.seq - Constructed sequence entries, part 48.
173. gbcon49.seq - Constructed sequence entries, part 49.
174. gbcon5.seq - Constructed sequence entries, part 5.
175. gbcon50.seq - Constructed sequence entries, part 50.
176. gbcon51.seq - Constructed sequence entries, part 51.
177. gbcon52.seq - Constructed sequence entries, part 52.
178. gbcon53.seq - Constructed sequence entries, part 53.
179. gbcon54.seq - Constructed sequence entries, part 54.
180. gbcon55.seq - Constructed sequence entries, part 55.
181. gbcon56.seq - Constructed sequence entries, part 56.
182. gbcon57.seq - Constructed sequence entries, part 57.
183. gbcon58.seq - Constructed sequence entries, part 58.
184. gbcon59.seq - Constructed sequence entries, part 59.
185. gbcon6.seq - Constructed sequence entries, part 6.
186. gbcon60.seq - Constructed sequence entries, part 60.
187. gbcon61.seq - Constructed sequence entries, part 61.
188. gbcon62.seq - Constructed sequence entries, part 62.
189. gbcon63.seq - Constructed sequence entries, part 63.
190. gbcon64.seq - Constructed sequence entries, part 64.
191. gbcon65.seq - Constructed sequence entries, part 65.
192. gbcon66.seq - Constructed sequence entries, part 66.
193. gbcon67.seq - Constructed sequence entries, part 67.
194. gbcon68.seq - Constructed sequence entries, part 68.
195. gbcon69.seq - Constructed sequence entries, part 69.
196. gbcon7.seq - Constructed sequence entries, part 7.
197. gbcon70.seq - Constructed sequence entries, part 70.
198. gbcon71.seq - Constructed sequence entries, part 71.
199. gbcon72.seq - Constructed sequence entries, part 72.
200. gbcon73.seq - Constructed sequence entries, part 73.
201. gbcon74.seq - Constructed sequence entries, part 74.
202. gbcon75.seq - Constructed sequence entries, part 75.
203. gbcon76.seq - Constructed sequence entries, part 76.
204. gbcon77.seq - Constructed sequence entries, part 77.
205. gbcon78.seq - Constructed sequence entries, part 78.
206. gbcon79.seq - Constructed sequence entries, part 79.
207. gbcon8.seq - Constructed sequence entries, part 8.
208. gbcon80.seq - Constructed sequence entries, part 80.
209. gbcon81.seq - Constructed sequence entries, part 81.
210. gbcon82.seq - Constructed sequence entries, part 82.
211. gbcon83.seq - Constructed sequence entries, part 83.
212. gbcon84.seq - Constructed sequence entries, part 84.
213. gbcon85.seq - Constructed sequence entries, part 85.
214. gbcon86.seq - Constructed sequence entries, part 86.
215. gbcon87.seq - Constructed sequence entries, part 87.
216. gbcon88.seq - Constructed sequence entries, part 88.
217. gbcon89.seq - Constructed sequence entries, part 89.
218. gbcon9.seq - Constructed sequence entries, part 9.
219. gbcon90.seq - Constructed sequence entries, part 90.
220. gbcon91.seq - Constructed sequence entries, part 91.
221. gbcon92.seq - Constructed sequence entries, part 92.
222. gbcon93.seq - Constructed sequence entries, part 93.
223. gbcon94.seq - Constructed sequence entries, part 94.
224. gbcon95.seq - Constructed sequence entries, part 95.
225. gbcon96.seq - Constructed sequence entries, part 96.
226. gbcon97.seq - Constructed sequence entries, part 97.
227. gbcon98.seq - Constructed sequence entries, part 98.
228. gbcon99.seq - Constructed sequence entries, part 99.
229. gbdel.txt - Accession numbers of entries deleted since the previous release.
230. gbenv1.seq - Environmental sampling sequence entries, part 1.
231. gbenv10.seq - Environmental sampling sequence entries, part 10.
232. gbenv11.seq - Environmental sampling sequence entries, part 11.
233. gbenv2.seq - Environmental sampling sequence entries, part 2.
234. gbenv3.seq - Environmental sampling sequence entries, part 3.
235. gbenv4.seq - Environmental sampling sequence entries, part 4.
236. gbenv5.seq - Environmental sampling sequence entries, part 5.
237. gbenv6.seq - Environmental sampling sequence entries, part 6.
238. gbenv7.seq - Environmental sampling sequence entries, part 7.
239. gbenv8.seq - Environmental sampling sequence entries, part 8.
240. gbenv9.seq - Environmental sampling sequence entries, part 9.
241. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
242. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
243. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
244. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
245. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
246. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
247. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
248. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
249. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
250. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
251. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
252. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
253. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
254. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
255. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
256. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
257. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
258. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
259. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
260. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
261. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
262. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
263. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
264. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
265. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
266. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
267. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
268. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
269. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
270. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
271. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
272. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
273. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
274. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
275. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
276. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
277. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
278. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
279. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
280. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
281. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
282. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
283. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
284. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
285. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
286. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
287. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
288. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
289. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
290. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
291. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
292. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
293. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
294. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
295. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
296. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
297. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
298. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
299. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
300. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
301. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
302. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
303. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
304. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
305. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
306. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
307. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
308. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
309. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
310. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
311. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
312. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
313. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
314. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
315. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
316. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
317. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
318. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
319. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
320. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
321. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
322. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
323. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
324. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
325. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
326. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
327. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
328. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
329. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
330. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
331. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
332. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
333. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
334. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
335. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
336. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
337. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
338. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
339. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
340. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
341. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
342. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
343. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
344. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
345. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
346. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
347. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
348. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
349. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
350. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
351. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
352. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
353. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
354. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
355. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
356. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
357. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
358. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
359. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
360. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
361. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
362. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
363. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
364. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
365. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
366. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
367. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
368. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
369. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
370. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
371. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
372. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
373. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
374. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
375. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
376. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
377. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
378. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
379. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
380. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
381. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
382. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
383. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
384. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
385. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
386. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
387. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
388. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
389. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
390. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
391. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
392. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
393. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
394. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
395. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
396. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
397. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
398. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
399. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
400. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
401. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
402. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
403. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
404. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
405. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
406. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
407. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
408. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
409. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
410. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
411. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
412. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
413. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
414. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
415. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
416. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
417. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
418. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
419. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
420. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
421. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
422. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
423. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
424. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
425. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
426. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
427. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
428. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
429. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
430. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
431. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
432. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
433. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
434. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
435. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
436. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
437. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
438. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
439. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
440. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
441. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
442. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
443. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
444. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
445. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
446. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
447. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
448. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
449. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
450. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
451. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
452. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
453. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
454. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
455. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
456. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
457. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
458. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
459. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
460. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
461. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
462. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
463. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
464. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
465. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
466. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
467. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
468. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
469. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
470. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
471. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
472. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
473. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
474. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
475. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
476. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
477. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
478. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
479. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
480. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
481. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
482. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
483. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
484. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
485. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
486. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
487. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
488. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
489. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
490. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
491. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
492. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
493. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
494. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
495. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
496. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
497. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
498. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
499. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
500. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
501. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
502. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
503. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
504. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
505. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
506. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
507. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
508. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
509. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
510. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
511. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
512. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
513. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
514. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
515. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
516. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
517. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
518. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
519. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
520. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
521. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
522. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
523. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
524. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
525. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
526. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
527. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
528. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
529. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
530. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
531. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
532. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
533. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
534. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
535. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
536. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
537. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
538. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
539. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
540. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
541. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
542. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
543. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
544. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
545. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
546. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
547. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
548. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
549. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
550. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
551. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
552. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
553. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
554. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
555. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
556. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
557. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
558. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
559. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
560. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
561. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
562. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
563. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
564. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
565. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
566. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
567. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
568. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
569. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
570. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
571. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
572. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
573. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
574. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
575. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
576. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
577. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
578. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
579. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
580. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
581. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
582. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
583. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
584. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
585. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
586. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
587. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
588. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
589. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
590. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
591. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
592. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
593. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
594. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
595. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
596. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
597. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
598. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
599. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
600. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
601. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
602. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
603. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
604. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
605. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
606. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
607. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
608. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
609. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
610. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
611. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
612. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
613. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
614. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
615. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
616. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
617. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
618. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
619. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
620. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
621. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
622. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
623. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
624. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
625. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
626. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
627. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
628. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
629. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
630. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
631. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
632. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
633. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
634. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
635. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
636. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
637. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
638. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
639. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
640. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
641. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
642. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
643. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
644. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
645. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
646. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
647. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
648. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
649. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
650. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
651. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
652. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
653. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
654. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
655. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
656. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
657. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
658. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
659. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
660. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
661. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
662. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
663. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
664. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
665. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
666. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
667. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
668. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
669. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
670. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
671. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
672. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
673. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
674. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
675. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
676. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
677. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
678. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
679. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
680. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
681. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
682. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
683. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
684. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
685. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
686. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
687. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
688. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
689. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
690. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
691. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
692. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
693. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
694. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
695. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
696. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
697. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
698. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
699. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
700. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
701. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
702. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
703. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
704. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
705. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
706. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
707. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
708. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
709. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
710. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
711. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
712. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
713. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
714. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
715. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
716. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
717. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
718. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
719. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
720. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
721. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
722. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
723. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
724. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
725. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
726. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
727. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
728. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
729. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
730. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
731. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
732. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
733. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
734. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
735. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
736. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
737. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
738. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
739. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
740. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
741. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
742. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
743. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
744. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
745. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
746. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
747. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
748. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
749. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
750. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
751. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
752. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
753. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
754. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
755. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
756. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
757. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
758. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
759. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
760. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
761. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
762. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
763. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
764. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
765. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
766. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
767. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
768. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
769. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
770. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
771. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
772. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
773. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
774. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
775. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
776. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
777. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
778. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
779. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
780. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
781. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
782. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
783. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
784. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
785. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
786. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
787. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
788. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
789. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
790. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
791. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
792. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
793. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
794. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
795. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
796. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
797. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
798. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
799. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
800. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
801. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
802. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
803. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
804. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
805. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
806. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
807. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
808. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
809. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
810. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
811. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
812. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
813. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
814. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
815. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
816. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
817. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
818. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
819. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
820. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
821. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
822. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
823. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
824. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
825. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
826. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
827. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
828. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
829. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
830. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
831. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
832. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
833. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
834. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
835. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
836. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
837. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
838. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
839. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
840. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
841. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
842. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
843. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
844. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
845. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
846. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
847. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
848. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
849. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
850. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
851. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
852. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
853. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
854. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
855. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
856. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
857. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
858. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
859. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
860. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
861. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
862. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
863. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
864. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
865. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
866. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
867. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
868. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
869. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
870. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
871. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
872. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
873. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
874. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
875. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
876. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
877. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
878. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
879. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
880. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
881. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
882. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
883. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
884. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
885. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
886. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
887. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
888. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
889. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
890. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
891. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
892. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
893. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
894. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
895. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
896. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
897. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
898. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
899. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
900. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
901. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
902. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
903. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
904. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
905. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
906. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
907. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
908. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
909. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
910. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
911. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
912. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
913. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
914. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
915. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
916. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
917. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
918. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
919. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
920. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
921. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
922. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
923. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
924. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
925. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
926. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
927. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
928. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
929. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
930. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
931. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
932. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
933. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
934. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
935. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
936. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
937. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
938. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
939. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
940. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
941. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
942. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
943. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
944. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
945. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
946. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
947. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
948. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
949. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
950. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
951. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
952. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
953. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
954. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
955. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
956. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
957. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
958. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
959. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
960. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
961. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
962. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
963. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
964. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
965. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
966. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
967. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
968. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
969. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
970. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
971. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
972. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
973. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
974. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
975. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
976. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
977. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
978. gbest763.seq - EST (expressed sequence tag) sequence entries, part 763.
979. gbest764.seq - EST (expressed sequence tag) sequence entries, part 764.
980. gbest765.seq - EST (expressed sequence tag) sequence entries, part 765.
981. gbest766.seq - EST (expressed sequence tag) sequence entries, part 766.
982. gbest767.seq - EST (expressed sequence tag) sequence entries, part 767.
983. gbest768.seq - EST (expressed sequence tag) sequence entries, part 768.
984. gbest769.seq - EST (expressed sequence tag) sequence entries, part 769.
985. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
986. gbest770.seq - EST (expressed sequence tag) sequence entries, part 770.
987. gbest771.seq - EST (expressed sequence tag) sequence entries, part 771.
988. gbest772.seq - EST (expressed sequence tag) sequence entries, part 772.
989. gbest773.seq - EST (expressed sequence tag) sequence entries, part 773.
990. gbest774.seq - EST (expressed sequence tag) sequence entries, part 774.
991. gbest775.seq - EST (expressed sequence tag) sequence entries, part 775.
992. gbest776.seq - EST (expressed sequence tag) sequence entries, part 776.
993. gbest777.seq - EST (expressed sequence tag) sequence entries, part 777.
994. gbest778.seq - EST (expressed sequence tag) sequence entries, part 778.
995. gbest779.seq - EST (expressed sequence tag) sequence entries, part 779.
996. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
997. gbest780.seq - EST (expressed sequence tag) sequence entries, part 780.
998. gbest781.seq - EST (expressed sequence tag) sequence entries, part 781.
999. gbest782.seq - EST (expressed sequence tag) sequence entries, part 782.
1000. gbest783.seq - EST (expressed sequence tag) sequence entries, part 783.
1001. gbest784.seq - EST (expressed sequence tag) sequence entries, part 784.
1002. gbest785.seq - EST (expressed sequence tag) sequence entries, part 785.
1003. gbest786.seq - EST (expressed sequence tag) sequence entries, part 786.
1004. gbest787.seq - EST (expressed sequence tag) sequence entries, part 787.
1005. gbest788.seq - EST (expressed sequence tag) sequence entries, part 788.
1006. gbest789.seq - EST (expressed sequence tag) sequence entries, part 789.
1007. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1008. gbest790.seq - EST (expressed sequence tag) sequence entries, part 790.
1009. gbest791.seq - EST (expressed sequence tag) sequence entries, part 791.
1010. gbest792.seq - EST (expressed sequence tag) sequence entries, part 792.
1011. gbest793.seq - EST (expressed sequence tag) sequence entries, part 793.
1012. gbest794.seq - EST (expressed sequence tag) sequence entries, part 794.
1013. gbest795.seq - EST (expressed sequence tag) sequence entries, part 795.
1014. gbest796.seq - EST (expressed sequence tag) sequence entries, part 796.
1015. gbest797.seq - EST (expressed sequence tag) sequence entries, part 797.
1016. gbest798.seq - EST (expressed sequence tag) sequence entries, part 798.
1017. gbest799.seq - EST (expressed sequence tag) sequence entries, part 799.
1018. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1019. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1020. gbest800.seq - EST (expressed sequence tag) sequence entries, part 800.
1021. gbest801.seq - EST (expressed sequence tag) sequence entries, part 801.
1022. gbest802.seq - EST (expressed sequence tag) sequence entries, part 802.
1023. gbest803.seq - EST (expressed sequence tag) sequence entries, part 803.
1024. gbest804.seq - EST (expressed sequence tag) sequence entries, part 804.
1025. gbest805.seq - EST (expressed sequence tag) sequence entries, part 805.
1026. gbest806.seq - EST (expressed sequence tag) sequence entries, part 806.
1027. gbest807.seq - EST (expressed sequence tag) sequence entries, part 807.
1028. gbest808.seq - EST (expressed sequence tag) sequence entries, part 808.
1029. gbest809.seq - EST (expressed sequence tag) sequence entries, part 809.
1030. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1031. gbest810.seq - EST (expressed sequence tag) sequence entries, part 810.
1032. gbest811.seq - EST (expressed sequence tag) sequence entries, part 811.
1033. gbest812.seq - EST (expressed sequence tag) sequence entries, part 812.
1034. gbest813.seq - EST (expressed sequence tag) sequence entries, part 813.
1035. gbest814.seq - EST (expressed sequence tag) sequence entries, part 814.
1036. gbest815.seq - EST (expressed sequence tag) sequence entries, part 815.
1037. gbest816.seq - EST (expressed sequence tag) sequence entries, part 816.
1038. gbest817.seq - EST (expressed sequence tag) sequence entries, part 817.
1039. gbest818.seq - EST (expressed sequence tag) sequence entries, part 818.
1040. gbest819.seq - EST (expressed sequence tag) sequence entries, part 819.
1041. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1042. gbest820.seq - EST (expressed sequence tag) sequence entries, part 820.
1043. gbest821.seq - EST (expressed sequence tag) sequence entries, part 821.
1044. gbest822.seq - EST (expressed sequence tag) sequence entries, part 822.
1045. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1046. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1047. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1048. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1049. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1050. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1051. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1052. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1053. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1054. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1055. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1056. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1057. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1058. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1059. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1060. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1061. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1062. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1063. gbgen.idx - Index of the entries according to gene symbols.
1064. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1065. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1066. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1067. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1068. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1069. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1070. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1071. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1072. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1073. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1074. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1075. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1076. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1077. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1078. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1079. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1080. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1081. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1082. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1083. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1084. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1085. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1086. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1087. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1088. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1089. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1090. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1091. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1092. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1093. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1094. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1095. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1096. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1097. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1098. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1099. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1100. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1101. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1102. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1103. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1104. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1105. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1106. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1107. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1108. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1109. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1110. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1111. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1112. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1113. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1114. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1115. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1116. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1117. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1118. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1119. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1120. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1121. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1122. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1123. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1124. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1125. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1126. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1127. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1128. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1129. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1130. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1131. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1132. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1133. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1134. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1135. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1136. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1137. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1138. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1139. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1140. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1141. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1142. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1143. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1144. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1145. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1146. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1147. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1148. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1149. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1150. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1151. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1152. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1153. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1154. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1155. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1156. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1157. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1158. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1159. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1160. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1161. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1162. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1163. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1164. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1165. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1166. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1167. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1168. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1169. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1170. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1171. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1172. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1173. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1174. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1175. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1176. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1177. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1178. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1179. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1180. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1181. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1182. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1183. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1184. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1185. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1186. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1187. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1188. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1189. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1190. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1191. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1192. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1193. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1194. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1195. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1196. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1197. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1198. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1199. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1200. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1201. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1202. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1203. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1204. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1205. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1206. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1207. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1208. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1209. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1210. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1211. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1212. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1213. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1214. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1215. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1216. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1217. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1218. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1219. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1220. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1221. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1222. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1223. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1224. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1225. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1226. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1227. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1228. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1229. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1230. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1231. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1232. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1233. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1234. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1235. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1236. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1237. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1238. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1239. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1240. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1241. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1242. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1243. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1244. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1245. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1246. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1247. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1248. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1249. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1250. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1251. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1252. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1253. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1254. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1255. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1256. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1257. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1258. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1259. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1260. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1261. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1262. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1263. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1264. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1265. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1266. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1267. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1268. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1269. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1270. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1271. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1272. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1273. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1274. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1275. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1276. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1277. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1278. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1279. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1280. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1281. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1282. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1283. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1284. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1285. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1286. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1287. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1288. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1289. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1290. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1291. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1292. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1293. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1294. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1295. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1296. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1297. gbgss309.seq - GSS (genome survey sequence) sequence entries, part 309.
1298. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1299. gbgss310.seq - GSS (genome survey sequence) sequence entries, part 310.
1300. gbgss311.seq - GSS (genome survey sequence) sequence entries, part 311.
1301. gbgss312.seq - GSS (genome survey sequence) sequence entries, part 312.
1302. gbgss313.seq - GSS (genome survey sequence) sequence entries, part 313.
1303. gbgss314.seq - GSS (genome survey sequence) sequence entries, part 314.
1304. gbgss315.seq - GSS (genome survey sequence) sequence entries, part 315.
1305. gbgss316.seq - GSS (genome survey sequence) sequence entries, part 316.
1306. gbgss317.seq - GSS (genome survey sequence) sequence entries, part 317.
1307. gbgss318.seq - GSS (genome survey sequence) sequence entries, part 318.
1308. gbgss319.seq - GSS (genome survey sequence) sequence entries, part 319.
1309. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1310. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1311. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1312. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1313. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1314. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1315. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1316. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1317. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1318. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1319. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1320. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1321. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1322. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1323. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1324. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1325. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1326. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1327. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1328. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1329. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1330. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1331. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1332. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1333. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1334. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1335. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1336. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1337. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1338. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1339. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1340. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1341. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1342. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1343. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1344. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1345. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1346. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1347. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1348. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1349. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1350. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1351. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1352. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1353. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1354. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1355. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1356. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1357. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1358. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1359. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1360. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1361. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1362. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1363. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1364. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1365. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1366. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1367. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1368. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1369. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1370. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1371. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1372. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1373. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1374. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1375. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1376. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1377. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1378. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1379. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1380. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1381. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1382. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1383. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1384. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1385. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1386. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1387. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1388. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1389. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1390. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1391. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1392. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1393. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1394. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1395. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1396. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1397. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1398. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1399. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1400. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1401. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1402. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1403. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1404. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1405. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1406. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1407. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1408. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1409. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1410. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1411. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1412. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1413. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1414. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1415. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1416. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1417. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1418. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1419. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1420. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1421. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1422. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1423. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1424. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1425. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1426. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1427. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1428. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1429. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1430. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1431. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1432. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1433. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1434. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1435. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1436. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1437. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1438. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1439. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1440. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1441. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1442. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1443. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1444. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1445. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1446. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1447. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1448. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1449. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1450. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1451. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1452. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1453. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1454. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1455. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1456. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1457. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1458. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1459. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1460. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1461. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1462. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1463. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1464. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1465. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1466. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1467. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1468. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1469. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1470. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1471. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1472. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1473. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1474. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1475. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1476. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1477. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1478. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1479. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1480. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1481. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1482. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1483. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1484. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1485. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1486. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1487. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1488. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1489. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1490. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1491. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1492. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1493. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1494. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1495. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1496. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1497. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1498. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1499. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1500. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1501. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1502. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1503. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1504. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1505. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1506. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1507. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1508. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1509. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1510. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1511. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1512. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1513. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1514. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1515. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1516. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1517. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1518. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1519. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1520. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1521. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1522. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1523. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1524. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1525. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1526. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1527. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1528. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1529. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1530. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1531. gbinv1.seq - Invertebrate sequence entries, part 1.
1532. gbinv10.seq - Invertebrate sequence entries, part 10.
1533. gbinv11.seq - Invertebrate sequence entries, part 11.
1534. gbinv12.seq - Invertebrate sequence entries, part 12.
1535. gbinv13.seq - Invertebrate sequence entries, part 13.
1536. gbinv14.seq - Invertebrate sequence entries, part 14.
1537. gbinv2.seq - Invertebrate sequence entries, part 2.
1538. gbinv3.seq - Invertebrate sequence entries, part 3.
1539. gbinv4.seq - Invertebrate sequence entries, part 4.
1540. gbinv5.seq - Invertebrate sequence entries, part 5.
1541. gbinv6.seq - Invertebrate sequence entries, part 6.
1542. gbinv7.seq - Invertebrate sequence entries, part 7.
1543. gbinv8.seq - Invertebrate sequence entries, part 8.
1544. gbinv9.seq - Invertebrate sequence entries, part 9.
1545. gbjou1.idx - Index of the entries according to journal citation, part 1.
1546. gbjou2.idx - Index of the entries according to journal citation, part 2.
1547. gbjou3.idx - Index of the entries according to journal citation, part 3.
1548. gbjou4.idx - Index of the entries according to journal citation, part 4.
1549. gbjou5.idx - Index of the entries according to journal citation, part 5.
1550. gbjou6.idx - Index of the entries according to journal citation, part 6.
1551. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1552. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1553. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1554. gbmam1.seq - Other mammalian sequence entries, part 1.
1555. gbmam2.seq - Other mammalian sequence entries, part 2.
1556. gbmam3.seq - Other mammalian sequence entries, part 3.
1557. gbmam4.seq - Other mammalian sequence entries, part 4.
1558. gbnew.txt - Accession numbers of entries new since the previous release.
1559. gbpat1.seq - Patent sequence entries, part 1.
1560. gbpat10.seq - Patent sequence entries, part 10.
1561. gbpat11.seq - Patent sequence entries, part 11.
1562. gbpat12.seq - Patent sequence entries, part 12.
1563. gbpat13.seq - Patent sequence entries, part 13.
1564. gbpat14.seq - Patent sequence entries, part 14.
1565. gbpat15.seq - Patent sequence entries, part 15.
1566. gbpat16.seq - Patent sequence entries, part 16.
1567. gbpat17.seq - Patent sequence entries, part 17.
1568. gbpat18.seq - Patent sequence entries, part 18.
1569. gbpat19.seq - Patent sequence entries, part 19.
1570. gbpat2.seq - Patent sequence entries, part 2.
1571. gbpat20.seq - Patent sequence entries, part 20.
1572. gbpat21.seq - Patent sequence entries, part 21.
1573. gbpat22.seq - Patent sequence entries, part 22.
1574. gbpat23.seq - Patent sequence entries, part 23.
1575. gbpat24.seq - Patent sequence entries, part 24.
1576. gbpat25.seq - Patent sequence entries, part 25.
1577. gbpat26.seq - Patent sequence entries, part 26.
1578. gbpat27.seq - Patent sequence entries, part 27.
1579. gbpat28.seq - Patent sequence entries, part 28.
1580. gbpat29.seq - Patent sequence entries, part 29.
1581. gbpat3.seq - Patent sequence entries, part 3.
1582. gbpat30.seq - Patent sequence entries, part 30.
1583. gbpat31.seq - Patent sequence entries, part 31.
1584. gbpat32.seq - Patent sequence entries, part 32.
1585. gbpat33.seq - Patent sequence entries, part 33.
1586. gbpat34.seq - Patent sequence entries, part 34.
1587. gbpat35.seq - Patent sequence entries, part 35.
1588. gbpat36.seq - Patent sequence entries, part 36.
1589. gbpat37.seq - Patent sequence entries, part 37.
1590. gbpat38.seq - Patent sequence entries, part 38.
1591. gbpat39.seq - Patent sequence entries, part 39.
1592. gbpat4.seq - Patent sequence entries, part 4.
1593. gbpat40.seq - Patent sequence entries, part 40.
1594. gbpat41.seq - Patent sequence entries, part 41.
1595. gbpat42.seq - Patent sequence entries, part 42.
1596. gbpat43.seq - Patent sequence entries, part 43.
1597. gbpat44.seq - Patent sequence entries, part 44.
1598. gbpat45.seq - Patent sequence entries, part 45.
1599. gbpat46.seq - Patent sequence entries, part 46.
1600. gbpat47.seq - Patent sequence entries, part 47.
1601. gbpat48.seq - Patent sequence entries, part 48.
1602. gbpat49.seq - Patent sequence entries, part 49.
1603. gbpat5.seq - Patent sequence entries, part 5.
1604. gbpat50.seq - Patent sequence entries, part 50.
1605. gbpat51.seq - Patent sequence entries, part 51.
1606. gbpat52.seq - Patent sequence entries, part 52.
1607. gbpat53.seq - Patent sequence entries, part 53.
1608. gbpat54.seq - Patent sequence entries, part 54.
1609. gbpat55.seq - Patent sequence entries, part 55.
1610. gbpat6.seq - Patent sequence entries, part 6.
1611. gbpat7.seq - Patent sequence entries, part 7.
1612. gbpat8.seq - Patent sequence entries, part 8.
1613. gbpat9.seq - Patent sequence entries, part 9.
1614. gbphg1.seq - Phage sequence entries, part 1.
1615. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1616. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1617. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1618. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1619. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1620. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1621. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1622. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1623. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1624. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1625. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1626. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1627. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1628. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1629. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1630. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1631. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1632. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1633. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1634. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1635. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1636. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1637. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1638. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1639. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1640. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1641. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1642. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1643. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1644. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1645. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1646. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1647. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1648. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1649. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1650. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1651. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1652. gbpri1.seq - Primate sequence entries, part 1.
1653. gbpri10.seq - Primate sequence entries, part 10.
1654. gbpri11.seq - Primate sequence entries, part 11.
1655. gbpri12.seq - Primate sequence entries, part 12.
1656. gbpri13.seq - Primate sequence entries, part 13.
1657. gbpri14.seq - Primate sequence entries, part 14.
1658. gbpri15.seq - Primate sequence entries, part 15.
1659. gbpri16.seq - Primate sequence entries, part 16.
1660. gbpri17.seq - Primate sequence entries, part 17.
1661. gbpri18.seq - Primate sequence entries, part 18.
1662. gbpri19.seq - Primate sequence entries, part 19.
1663. gbpri2.seq - Primate sequence entries, part 2.
1664. gbpri20.seq - Primate sequence entries, part 20.
1665. gbpri21.seq - Primate sequence entries, part 21.
1666. gbpri22.seq - Primate sequence entries, part 22.
1667. gbpri23.seq - Primate sequence entries, part 23.
1668. gbpri24.seq - Primate sequence entries, part 24.
1669. gbpri25.seq - Primate sequence entries, part 25.
1670. gbpri26.seq - Primate sequence entries, part 26.
1671. gbpri27.seq - Primate sequence entries, part 27.
1672. gbpri28.seq - Primate sequence entries, part 28.
1673. gbpri29.seq - Primate sequence entries, part 29.
1674. gbpri3.seq - Primate sequence entries, part 3.
1675. gbpri30.seq - Primate sequence entries, part 30.
1676. gbpri31.seq - Primate sequence entries, part 31.
1677. gbpri32.seq - Primate sequence entries, part 32.
1678. gbpri33.seq - Primate sequence entries, part 33.
1679. gbpri34.seq - Primate sequence entries, part 34.
1680. gbpri35.seq - Primate sequence entries, part 35.
1681. gbpri36.seq - Primate sequence entries, part 36.
1682. gbpri37.seq - Primate sequence entries, part 37.
1683. gbpri38.seq - Primate sequence entries, part 38.
1684. gbpri39.seq - Primate sequence entries, part 39.
1685. gbpri4.seq - Primate sequence entries, part 4.
1686. gbpri5.seq - Primate sequence entries, part 5.
1687. gbpri6.seq - Primate sequence entries, part 6.
1688. gbpri7.seq - Primate sequence entries, part 7.
1689. gbpri8.seq - Primate sequence entries, part 8.
1690. gbpri9.seq - Primate sequence entries, part 9.
1691. gbrel.txt - Release notes (this document).
1692. gbrod1.seq - Rodent sequence entries, part 1.
1693. gbrod10.seq - Rodent sequence entries, part 10.
1694. gbrod11.seq - Rodent sequence entries, part 11.
1695. gbrod12.seq - Rodent sequence entries, part 12.
1696. gbrod13.seq - Rodent sequence entries, part 13.
1697. gbrod14.seq - Rodent sequence entries, part 14.
1698. gbrod15.seq - Rodent sequence entries, part 15.
1699. gbrod16.seq - Rodent sequence entries, part 16.
1700. gbrod17.seq - Rodent sequence entries, part 17.
1701. gbrod18.seq - Rodent sequence entries, part 18.
1702. gbrod19.seq - Rodent sequence entries, part 19.
1703. gbrod2.seq - Rodent sequence entries, part 2.
1704. gbrod20.seq - Rodent sequence entries, part 20.
1705. gbrod21.seq - Rodent sequence entries, part 21.
1706. gbrod22.seq - Rodent sequence entries, part 22.
1707. gbrod23.seq - Rodent sequence entries, part 23.
1708. gbrod24.seq - Rodent sequence entries, part 24.
1709. gbrod25.seq - Rodent sequence entries, part 25.
1710. gbrod26.seq - Rodent sequence entries, part 26.
1711. gbrod27.seq - Rodent sequence entries, part 27.
1712. gbrod28.seq - Rodent sequence entries, part 28.
1713. gbrod3.seq - Rodent sequence entries, part 3.
1714. gbrod4.seq - Rodent sequence entries, part 4.
1715. gbrod5.seq - Rodent sequence entries, part 5.
1716. gbrod6.seq - Rodent sequence entries, part 6.
1717. gbrod7.seq - Rodent sequence entries, part 7.
1718. gbrod8.seq - Rodent sequence entries, part 8.
1719. gbrod9.seq - Rodent sequence entries, part 9.
1720. gbsdr1.txt - Short directory of the data bank, part 1.
1721. gbsdr2.txt - Short directory of the data bank, part 2.
1722. gbsdr3.txt - Short directory of the data bank, part 3.
1723. gbsec.idx - Index of the entries according to secondary accession number.
1724. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1725. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1726. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1727. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1728. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1729. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1730. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1731. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1732. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1733. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1734. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1735. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1736. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1737. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1738. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1739. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1740. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1741. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1742. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1743. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1744. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1745. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1746. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1747. gbuna1.seq - Unannotated sequence entries, part 1.
1748. gbvrl1.seq - Viral sequence entries, part 1.
1749. gbvrl10.seq - Viral sequence entries, part 10.
1750. gbvrl11.seq - Viral sequence entries, part 11.
1751. gbvrl2.seq - Viral sequence entries, part 2.
1752. gbvrl3.seq - Viral sequence entries, part 3.
1753. gbvrl4.seq - Viral sequence entries, part 4.
1754. gbvrl5.seq - Viral sequence entries, part 5.
1755. gbvrl6.seq - Viral sequence entries, part 6.
1756. gbvrl7.seq - Viral sequence entries, part 7.
1757. gbvrl8.seq - Viral sequence entries, part 8.
1758. gbvrl9.seq - Viral sequence entries, part 9.
1759. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1760. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1761. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1762. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1763. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1764. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1765. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1766. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1767. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1768. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1769. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1770. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1771. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1772. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1773. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1774. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1775. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 169.0 flatfiles require roughly 381 GB (sequence
files only) or 407 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 887138951     gbacc1.idx
1946796333     gbacc2.idx
 634808829     gbacc3.idx
 185535046     gbaut1.idx
 250865014     gbaut10.idx
 228760182     gbaut11.idx
 183883412     gbaut12.idx
 237174233     gbaut13.idx
 246926300     gbaut14.idx
 184544274     gbaut15.idx
 186016018     gbaut16.idx
 184084636     gbaut17.idx
 186351182     gbaut18.idx
 194596538     gbaut19.idx
 251601785     gbaut2.idx
 184586504     gbaut20.idx
 184114711     gbaut21.idx
 183971331     gbaut22.idx
 187842012     gbaut23.idx
 191229756     gbaut24.idx
 193584530     gbaut25.idx
 185656649     gbaut26.idx
 183679724     gbaut27.idx
 184042202     gbaut28.idx
 200482636     gbaut29.idx
 235377489     gbaut3.idx
 222164084     gbaut30.idx
 186775017     gbaut31.idx
 254582924     gbaut32.idx
 184430061     gbaut33.idx
 185167578     gbaut34.idx
 184061343     gbaut35.idx
 183713370     gbaut36.idx
 241288070     gbaut37.idx
 184228642     gbaut38.idx
 184402168     gbaut39.idx
 183780065     gbaut4.idx
 199601816     gbaut40.idx
 251219266     gbaut41.idx
 183807813     gbaut42.idx
 186054442     gbaut43.idx
 187022924     gbaut44.idx
 188532072     gbaut45.idx
 183925127     gbaut46.idx
 186518862     gbaut47.idx
 197719152     gbaut48.idx
 229760822     gbaut49.idx
 184250332     gbaut5.idx
 247829598     gbaut50.idx
 185274739     gbaut51.idx
 184276343     gbaut52.idx
 251374170     gbaut53.idx
 183728021     gbaut54.idx
 183940692     gbaut55.idx
 184038263     gbaut56.idx
 208709584     gbaut57.idx
 245879391     gbaut58.idx
 206092440     gbaut59.idx
 184320147     gbaut6.idx
 184799352     gbaut60.idx
 206390721     gbaut61.idx
  15936477     gbaut62.idx
 248469071     gbaut7.idx
 209564254     gbaut8.idx
 185736751     gbaut9.idx
 247245421     gbbct1.seq
 188034860     gbbct10.seq
 241473891     gbbct11.seq
 243840735     gbbct12.seq
 244185740     gbbct13.seq
 248543019     gbbct14.seq
 243113972     gbbct15.seq
 240282722     gbbct16.seq
 245637737     gbbct17.seq
 248588869     gbbct18.seq
 191124843     gbbct19.seq
 246827477     gbbct2.seq
 242657586     gbbct20.seq
 239946432     gbbct21.seq
 249632532     gbbct22.seq
 242171267     gbbct23.seq
 244707690     gbbct24.seq
 247148339     gbbct25.seq
 249790069     gbbct26.seq
 244516249     gbbct27.seq
 246665311     gbbct28.seq
 246321804     gbbct29.seq
 246343176     gbbct3.seq
 233695728     gbbct30.seq
 249998838     gbbct31.seq
 194432922     gbbct32.seq
 241993647     gbbct33.seq
 249540073     gbbct34.seq
 249998237     gbbct4.seq
 103757737     gbbct5.seq
 249790524     gbbct6.seq
 238535120     gbbct7.seq
 247280520     gbbct8.seq
 241549783     gbbct9.seq
  72185597     gbchg.txt
 249980284     gbcon1.seq
 249991673     gbcon10.seq
 249994369     gbcon100.seq
 249994433     gbcon101.seq
 157277663     gbcon102.seq
 249994644     gbcon103.seq
 249998690     gbcon104.seq
 249973265     gbcon105.seq
 249996635     gbcon106.seq
 155028911     gbcon107.seq
 249999975     gbcon108.seq
 249999369     gbcon109.seq
 249985471     gbcon11.seq
 249999268     gbcon110.seq
 249999428     gbcon111.seq
 250000108     gbcon112.seq
 249997803     gbcon113.seq
 250000185     gbcon114.seq
 249999307     gbcon115.seq
 249998683     gbcon116.seq
  15726049     gbcon117.seq
 249999594     gbcon118.seq
 249999385     gbcon119.seq
 249999663     gbcon12.seq
 249998786     gbcon120.seq
 249998646     gbcon121.seq
 122840389     gbcon122.seq
 249999949     gbcon123.seq
 249999554     gbcon124.seq
 249999546     gbcon125.seq
 249998879     gbcon126.seq
 118438535     gbcon127.seq
  21415112     gbcon128.seq
 146820410     gbcon13.seq
 249998127     gbcon14.seq
 250000180     gbcon15.seq
  90359010     gbcon16.seq
 249994324     gbcon17.seq
 249969288     gbcon18.seq
 108377660     gbcon19.seq
 249775099     gbcon2.seq
 249998391     gbcon20.seq
  87602297     gbcon21.seq
 249998105     gbcon22.seq
 249808150     gbcon23.seq
 249999054     gbcon24.seq
 249998908     gbcon25.seq
 192001073     gbcon26.seq
 249999207     gbcon27.seq
 249997328     gbcon28.seq
 249999631     gbcon29.seq
 249960341     gbcon3.seq
 249999692     gbcon30.seq
 249817371     gbcon31.seq
 150908817     gbcon32.seq
 249996991     gbcon33.seq
 249998196     gbcon34.seq
 249995927     gbcon35.seq
 249997083     gbcon36.seq
 249994783     gbcon37.seq
 249995520     gbcon38.seq
  62365932     gbcon39.seq
 248147847     gbcon4.seq
 249995165     gbcon40.seq
 249995523     gbcon41.seq
 249995997     gbcon42.seq
 249998287     gbcon43.seq
 249997419     gbcon44.seq
  44061479     gbcon45.seq
 249994534     gbcon46.seq
 249999682     gbcon47.seq
 249999450     gbcon48.seq
 249996981     gbcon49.seq
 249993821     gbcon5.seq
 249999819     gbcon50.seq
  37366136     gbcon51.seq
 249994793     gbcon52.seq
 249997146     gbcon53.seq
 249999890     gbcon54.seq
 249997325     gbcon55.seq
 249995987     gbcon56.seq
 153729264     gbcon57.seq
 249996245     gbcon58.seq
 249998868     gbcon59.seq
 249998265     gbcon6.seq
 249998776     gbcon60.seq
 249995315     gbcon61.seq
 184751617     gbcon62.seq
 249999742     gbcon63.seq
 249996805     gbcon64.seq
 249996378     gbcon65.seq
 249997731     gbcon66.seq
 246704194     gbcon67.seq
 249996123     gbcon68.seq
 249996806     gbcon69.seq
 241354227     gbcon7.seq
 249994747     gbcon70.seq
 249998911     gbcon71.seq
 249998433     gbcon72.seq
  97827765     gbcon73.seq
 249996160     gbcon74.seq
 249996456     gbcon75.seq
 249999720     gbcon76.seq
 249998702     gbcon77.seq
 249999534     gbcon78.seq
  63726819     gbcon79.seq
 249996525     gbcon8.seq
 249997709     gbcon80.seq
 249996382     gbcon81.seq
 249999225     gbcon82.seq
 249997118     gbcon83.seq
 249998473     gbcon84.seq
  22747059     gbcon85.seq
 249996051     gbcon86.seq
 250000090     gbcon87.seq
 249999511     gbcon88.seq
 249999267     gbcon89.seq
 249992660     gbcon9.seq
 198915940     gbcon90.seq
 249996015     gbcon91.seq
 249994203     gbcon92.seq
 250000238     gbcon93.seq
 249998171     gbcon94.seq
 249993618     gbcon95.seq
 134239203     gbcon96.seq
 249998824     gbcon97.seq
 249999798     gbcon98.seq
 249997479     gbcon99.seq
      2045     gbdel.txt
 249998458     gbenv1.seq
 249999406     gbenv10.seq
  63566692     gbenv11.seq
 249999646     gbenv2.seq
 249917648     gbenv3.seq
 249997813     gbenv4.seq
 223555312     gbenv5.seq
 250000166     gbenv6.seq
 249997087     gbenv7.seq
 249998938     gbenv8.seq
 249997191     gbenv9.seq
 230688615     gbest1.seq
 230687850     gbest10.seq
 230687753     gbest100.seq
 230687942     gbest101.seq
 230689935     gbest102.seq
 230688787     gbest103.seq
 230689121     gbest104.seq
 230689392     gbest105.seq
 230690244     gbest106.seq
 230688591     gbest107.seq
 230688464     gbest108.seq
 230688770     gbest109.seq
 230688467     gbest11.seq
 230689235     gbest110.seq
 230687664     gbest111.seq
 230690212     gbest112.seq
 230687968     gbest113.seq
 230689336     gbest114.seq
 230689056     gbest115.seq
 230690200     gbest116.seq
 230689614     gbest117.seq
 230689608     gbest118.seq
 230618893     gbest119.seq
 230689872     gbest12.seq
 230687653     gbest120.seq
 230688540     gbest121.seq
 230687898     gbest122.seq
 230689329     gbest123.seq
 230688363     gbest124.seq
 230690773     gbest125.seq
 230690377     gbest126.seq
 230690334     gbest127.seq
 230687623     gbest128.seq
 230689384     gbest129.seq
 230689821     gbest13.seq
 230689306     gbest130.seq
 230687510     gbest131.seq
 230690533     gbest132.seq
 230688585     gbest133.seq
 230688605     gbest134.seq
 230689021     gbest135.seq
 230688816     gbest136.seq
 230690137     gbest137.seq
 230689688     gbest138.seq
 230689609     gbest139.seq
 230688942     gbest14.seq
 230689317     gbest140.seq
 230688683     gbest141.seq
 230689152     gbest142.seq
 230688651     gbest143.seq
 230687534     gbest144.seq
 230688504     gbest145.seq
 230687452     gbest146.seq
 230690505     gbest147.seq
 230687481     gbest148.seq
 230687660     gbest149.seq
 230687521     gbest15.seq
 230690659     gbest150.seq
 230687552     gbest151.seq
 230688736     gbest152.seq
 230688152     gbest153.seq
 230691204     gbest154.seq
 230687712     gbest155.seq
 230687905     gbest156.seq
 230688007     gbest157.seq
 230688159     gbest158.seq
 230688160     gbest159.seq
 230688589     gbest16.seq
 230690289     gbest160.seq
 230687782     gbest161.seq
 230688340     gbest162.seq
 230687580     gbest163.seq
 230688834     gbest164.seq
 230696179     gbest165.seq
 230689904     gbest166.seq
 230688716     gbest167.seq
 230689062     gbest168.seq
 230689078     gbest169.seq
 230689100     gbest17.seq
 230689978     gbest170.seq
 230689706     gbest171.seq
 230687861     gbest172.seq
 230688130     gbest173.seq
 230688220     gbest174.seq
 230687768     gbest175.seq
 230687712     gbest176.seq
 230688788     gbest177.seq
 230688942     gbest178.seq
 230689013     gbest179.seq
 230688140     gbest18.seq
 230689456     gbest180.seq
 230689360     gbest181.seq
 230687714     gbest182.seq
 230687828     gbest183.seq
 230689225     gbest184.seq
 230688933     gbest185.seq
 230688374     gbest186.seq
 230688483     gbest187.seq
 230689610     gbest188.seq
 228736700     gbest189.seq
 230689755     gbest19.seq
 230690025     gbest190.seq
 230689937     gbest191.seq
 230689362     gbest192.seq
 230687603     gbest193.seq
 230688968     gbest194.seq
 230688118     gbest195.seq
 230689381     gbest196.seq
 230689198     gbest197.seq
 230690285     gbest198.seq
 230689391     gbest199.seq
 230689833     gbest2.seq
 230687606     gbest20.seq
 230689491     gbest200.seq
 230690527     gbest201.seq
 230690817     gbest202.seq
 230689530     gbest203.seq
 230688423     gbest204.seq
 230690392     gbest205.seq
 230690505     gbest206.seq
 230688589     gbest207.seq
 230690626     gbest208.seq
 230688225     gbest209.seq
 230688773     gbest21.seq
 230687653     gbest210.seq
 230687831     gbest211.seq
 230689163     gbest212.seq
 230688261     gbest213.seq
 230688106     gbest214.seq
 230687525     gbest215.seq
 230689084     gbest216.seq
 230689560     gbest217.seq
 230688264     gbest218.seq
 230689824     gbest219.seq
 230690664     gbest22.seq
 230688338     gbest220.seq
 230687785     gbest221.seq
 230689058     gbest222.seq
 230688506     gbest223.seq
 230689913     gbest224.seq
 230690525     gbest225.seq
 230690052     gbest226.seq
 230689098     gbest227.seq
 230689532     gbest228.seq
 230690645     gbest229.seq
 230689459     gbest23.seq
 230690249     gbest230.seq
 203046969     gbest231.seq
 161786503     gbest232.seq
 161568329     gbest233.seq
 169186741     gbest234.seq
 168087824     gbest235.seq
 164196413     gbest236.seq
 164372755     gbest237.seq
 163707804     gbest238.seq
 162982651     gbest239.seq
 230689791     gbest24.seq
 163481749     gbest240.seq
 163034388     gbest241.seq
 163179974     gbest242.seq
 161997143     gbest243.seq
 166979562     gbest244.seq
 161901512     gbest245.seq
 161462644     gbest246.seq
 165558612     gbest247.seq
 167141999     gbest248.seq
 164834678     gbest249.seq
 230689917     gbest25.seq
 164628743     gbest250.seq
 164323365     gbest251.seq
 164078661     gbest252.seq
 163233843     gbest253.seq
 163092554     gbest254.seq
 163877339     gbest255.seq
 163725847     gbest256.seq
 178909050     gbest257.seq
 172025266     gbest258.seq
 180019839     gbest259.seq
 230688750     gbest26.seq
 230689238     gbest260.seq
 230692586     gbest261.seq
 230688756     gbest262.seq
 230689270     gbest263.seq
 230690590     gbest264.seq
 230689211     gbest265.seq
 230690587     gbest266.seq
 230690095     gbest267.seq
 230687889     gbest268.seq
 230690562     gbest269.seq
 230689775     gbest27.seq
 230690078     gbest270.seq
 230691753     gbest271.seq
 230687705     gbest272.seq
 230687484     gbest273.seq
 230687657     gbest274.seq
 230688246     gbest275.seq
 230688980     gbest276.seq
 230689746     gbest277.seq
 230689093     gbest278.seq
 230689253     gbest279.seq
 230688789     gbest28.seq
 230690005     gbest280.seq
 230688668     gbest281.seq
 230688307     gbest282.seq
 230689670     gbest283.seq
 230689245     gbest284.seq
 230689020     gbest285.seq
 230689167     gbest286.seq
 230687853     gbest287.seq
 230689951     gbest288.seq
 230687643     gbest289.seq
 230688434     gbest29.seq
 230690457     gbest290.seq
 220813339     gbest291.seq
 207475946     gbest292.seq
 230688292     gbest293.seq
 230690149     gbest294.seq
 230689241     gbest295.seq
 230688115     gbest296.seq
 230690006     gbest297.seq
 230690232     gbest298.seq
 230690520     gbest299.seq
 230690315     gbest3.seq
 230688305     gbest30.seq
 230688432     gbest300.seq
 230688059     gbest301.seq
 230688060     gbest302.seq
 230688151     gbest303.seq
 230688607     gbest304.seq
 230689020     gbest305.seq
 230687899     gbest306.seq
 230688985     gbest307.seq
 230689109     gbest308.seq
 230688341     gbest309.seq
 230689806     gbest31.seq
 230689957     gbest310.seq
 230693159     gbest311.seq
 230687826     gbest312.seq
 230690492     gbest313.seq
 230689903     gbest314.seq
 230689420     gbest315.seq
 230689692     gbest316.seq
 230690867     gbest317.seq
 230691115     gbest318.seq
 230689921     gbest319.seq
 230688985     gbest32.seq
 230691126     gbest320.seq
 230688584     gbest321.seq
 230690413     gbest322.seq
 230689084     gbest323.seq
 230690222     gbest324.seq
 230687957     gbest325.seq
 230688186     gbest326.seq
 230688346     gbest327.seq
 230687648     gbest328.seq
 230688766     gbest329.seq
 230689020     gbest33.seq
 230687926     gbest330.seq
 230689848     gbest331.seq
 230689509     gbest332.seq
 230689977     gbest333.seq
 230688565     gbest334.seq
 230689331     gbest335.seq
 230691106     gbest336.seq
 230688983     gbest337.seq
 230688284     gbest338.seq
 230689519     gbest339.seq
 230689585     gbest34.seq
 230687635     gbest340.seq
 230689518     gbest341.seq
 230689500     gbest342.seq
 206123073     gbest343.seq
 230688944     gbest344.seq
 230688005     gbest345.seq
 230687801     gbest346.seq
 230687486     gbest347.seq
 230690363     gbest348.seq
 230690194     gbest349.seq
 230689822     gbest35.seq
 155844739     gbest350.seq
 165688246     gbest351.seq
 230688405     gbest352.seq
 230689857     gbest353.seq
 230688098     gbest354.seq
 230689951     gbest355.seq
 230689606     gbest356.seq
 230687782     gbest357.seq
 230688506     gbest358.seq
 230691349     gbest359.seq
 230688064     gbest36.seq
 230688392     gbest360.seq
 230688664     gbest361.seq
 230687757     gbest362.seq
 230687965     gbest363.seq
 230687706     gbest364.seq
 230691618     gbest365.seq
 230688369     gbest366.seq
 230689960     gbest367.seq
 230687852     gbest368.seq
 230688653     gbest369.seq
 230689539     gbest37.seq
 230687548     gbest370.seq
 230688479     gbest371.seq
 230688431     gbest372.seq
 230690731     gbest373.seq
 230690375     gbest374.seq
 230688304     gbest375.seq
 230688512     gbest376.seq
 230690689     gbest377.seq
 230688282     gbest378.seq
 230690164     gbest379.seq
 230689695     gbest38.seq
 230688881     gbest380.seq
 230688332     gbest381.seq
 230688842     gbest382.seq
 230687590     gbest383.seq
 230694352     gbest384.seq
 230691181     gbest385.seq
 230688282     gbest386.seq
 230688015     gbest387.seq
 230689324     gbest388.seq
 230688470     gbest389.seq
 230690245     gbest39.seq
 230688493     gbest390.seq
 230689905     gbest391.seq
 230688730     gbest392.seq
 230687658     gbest393.seq
 230689437     gbest394.seq
 230687784     gbest395.seq
 221368906     gbest396.seq
 230689799     gbest397.seq
 219320400     gbest398.seq
 230693423     gbest399.seq
 230688895     gbest4.seq
 230690362     gbest40.seq
 230688726     gbest400.seq
 230691696     gbest401.seq
 230689570     gbest402.seq
 230687692     gbest403.seq
 227010331     gbest404.seq
 230689898     gbest405.seq
 230690038     gbest406.seq
 230691765     gbest407.seq
 230688948     gbest408.seq
 230689575     gbest409.seq
 230688741     gbest41.seq
 230688220     gbest410.seq
 217834420     gbest411.seq
 230689941     gbest412.seq
 230688175     gbest413.seq
 230689290     gbest414.seq
 230688173     gbest415.seq
 230689958     gbest416.seq
 230691332     gbest417.seq
 230689532     gbest418.seq
 230690958     gbest419.seq
 230688011     gbest42.seq
 230690008     gbest420.seq
 230690110     gbest421.seq
 230688082     gbest422.seq
 230687551     gbest423.seq
 230688118     gbest424.seq
 230689724     gbest425.seq
 230690548     gbest426.seq
 230687769     gbest427.seq
 230688808     gbest428.seq
 208791060     gbest429.seq
 230687599     gbest43.seq
 208318385     gbest430.seq
 208205101     gbest431.seq
 208406619     gbest432.seq
 208362922     gbest433.seq
 208529928     gbest434.seq
 209250905     gbest435.seq
 209653294     gbest436.seq
 209563938     gbest437.seq
 209947476     gbest438.seq
 211823720     gbest439.seq
 230690102     gbest44.seq
 209536608     gbest440.seq
 208836532     gbest441.seq
 208803872     gbest442.seq
 208664202     gbest443.seq
 208195098     gbest444.seq
 208292127     gbest445.seq
 208257944     gbest446.seq
 208166107     gbest447.seq
 224440782     gbest448.seq
 230689188     gbest449.seq
 230688500     gbest45.seq
 230688194     gbest450.seq
 230689117     gbest451.seq
 230690102     gbest452.seq
 230688319     gbest453.seq
 230688035     gbest454.seq
 230689920     gbest455.seq
 230687865     gbest456.seq
 230688323     gbest457.seq
 230689995     gbest458.seq
 230688586     gbest459.seq
 230689964     gbest46.seq
 230689886     gbest460.seq
 230687751     gbest461.seq
 230688887     gbest462.seq
 230689582     gbest463.seq
 230689435     gbest464.seq
 230689526     gbest465.seq
 230687831     gbest466.seq
 230688582     gbest467.seq
 230689611     gbest468.seq
 230689294     gbest469.seq
 189054924     gbest47.seq
 230688112     gbest470.seq
 230690883     gbest471.seq
 230688175     gbest472.seq
 230688542     gbest473.seq
 230689215     gbest474.seq
 230687784     gbest475.seq
 230688899     gbest476.seq
 230691446     gbest477.seq
 230690701     gbest478.seq
 230692037     gbest479.seq
 188236866     gbest48.seq
 230691067     gbest480.seq
 230690120     gbest481.seq
 230688836     gbest482.seq
 230688386     gbest483.seq
 230690291     gbest484.seq
 230690031     gbest485.seq
 230688506     gbest486.seq
 230687512     gbest487.seq
 230689967     gbest488.seq
 230688099     gbest489.seq
 205044616     gbest49.seq
 230688054     gbest490.seq
 230688844     gbest491.seq
 230687615     gbest492.seq
 230688612     gbest493.seq
 230690318     gbest494.seq
 230689505     gbest495.seq
 230689374     gbest496.seq
 230691131     gbest497.seq
 230687921     gbest498.seq
 230689095     gbest499.seq
 164142208     gbest5.seq
 215087618     gbest50.seq
 230688640     gbest500.seq
 230687510     gbest501.seq
 230688926     gbest502.seq
 230689708     gbest503.seq
 230688350     gbest504.seq
 230690721     gbest505.seq
 230688482     gbest506.seq
 230689040     gbest507.seq
 230689911     gbest508.seq
 230688644     gbest509.seq
 214790142     gbest51.seq
 230689246     gbest510.seq
 230690164     gbest511.seq
 230689362     gbest512.seq
 230687670     gbest513.seq
 230689304     gbest514.seq
 230688919     gbest515.seq
 230688899     gbest516.seq
 230689707     gbest517.seq
 230688177     gbest518.seq
 230687989     gbest519.seq
 215563481     gbest52.seq
 230688368     gbest520.seq
 230688290     gbest521.seq
 230689885     gbest522.seq
 230690154     gbest523.seq
 230688111     gbest524.seq
 230688036     gbest525.seq
 224963384     gbest526.seq
 230689086     gbest527.seq
 230690042     gbest528.seq
 230689831     gbest529.seq
 229547316     gbest53.seq
 230688418     gbest530.seq
 230688875     gbest531.seq
 230688434     gbest532.seq
 230689059     gbest533.seq
 230689408     gbest534.seq
 230687747     gbest535.seq
 230689549     gbest536.seq
 230689703     gbest537.seq
 230688940     gbest538.seq
 230689034     gbest539.seq
 230688036     gbest54.seq
 230688609     gbest540.seq
 205398372     gbest541.seq
 196098356     gbest542.seq
 230688791     gbest543.seq
 230687760     gbest544.seq
 230689491     gbest545.seq
 230689678     gbest546.seq
 230687445     gbest547.seq
 230688150     gbest548.seq
 230688647     gbest549.seq
 230688898     gbest55.seq
 230688105     gbest550.seq
 230687768     gbest551.seq
 230689872     gbest552.seq
 230688604     gbest553.seq
 230688039     gbest554.seq
 230689566     gbest555.seq
 222238207     gbest556.seq
 230688814     gbest557.seq
 230687651     gbest558.seq
 230689700     gbest559.seq
 230281664     gbest56.seq
 230689989     gbest560.seq
 230687741     gbest561.seq
 230688744     gbest562.seq
 230687592     gbest563.seq
 220186972     gbest564.seq
 226180399     gbest565.seq
 230688460     gbest566.seq
 230688312     gbest567.seq
 230688478     gbest568.seq
 230689486     gbest569.seq
 224657702     gbest57.seq
 230688181     gbest570.seq
 230689120     gbest571.seq
 230689169     gbest572.seq
 230690781     gbest573.seq
 230689076     gbest574.seq
 230690901     gbest575.seq
 230687584     gbest576.seq
 230687601     gbest577.seq
 230690548     gbest578.seq
 230689975     gbest579.seq
 230689023     gbest58.seq
 222074614     gbest580.seq
 230687572     gbest581.seq
 230689685     gbest582.seq
 230687526     gbest583.seq
 230688072     gbest584.seq
 230687929     gbest585.seq
 230690014     gbest586.seq
 230690342     gbest587.seq
 230689475     gbest588.seq
 230688436     gbest589.seq
 230689745     gbest59.seq
 230688784     gbest590.seq
 230688713     gbest591.seq
 230688536     gbest592.seq
 230689795     gbest593.seq
 230688788     gbest594.seq
 230689196     gbest595.seq
 230690189     gbest596.seq
 230688924     gbest597.seq
 230689360     gbest598.seq
 230688981     gbest599.seq
 177420861     gbest6.seq
 230690098     gbest60.seq
 230690502     gbest600.seq
 229480762     gbest601.seq
 230689249     gbest602.seq
 230689243     gbest603.seq
 230688628     gbest604.seq
 230689351     gbest605.seq
 230689969     gbest606.seq
 230688068     gbest607.seq
 230690276     gbest608.seq
 230689856     gbest609.seq
 230689011     gbest61.seq
 230690301     gbest610.seq
 230688194     gbest611.seq
 230688053     gbest612.seq
 230688225     gbest613.seq
 230688081     gbest614.seq
 230688592     gbest615.seq
 230690400     gbest616.seq
 230690224     gbest617.seq
 230688484     gbest618.seq
 230688233     gbest619.seq
 230688606     gbest62.seq
 230690729     gbest620.seq
 230687814     gbest621.seq
 230690404     gbest622.seq
 230691137     gbest623.seq
 230687919     gbest624.seq
 230688459     gbest625.seq
 230689535     gbest626.seq
 230688377     gbest627.seq
 230688927     gbest628.seq
 230688232     gbest629.seq
 230689820     gbest63.seq
 230688561     gbest630.seq
 230689929     gbest631.seq
 230690437     gbest632.seq
 230689707     gbest633.seq
 230688060     gbest634.seq
 230689454     gbest635.seq
 230687787     gbest636.seq
 230688501     gbest637.seq
 230688617     gbest638.seq
 230688130     gbest639.seq
 230687698     gbest64.seq
 213909103     gbest640.seq
 230688293     gbest641.seq
 230687899     gbest642.seq
 230689732     gbest643.seq
 217325036     gbest644.seq
 230687960     gbest645.seq
 230688548     gbest646.seq
 190890290     gbest647.seq
 190682333     gbest648.seq
 192290570     gbest649.seq
 230690039     gbest65.seq
 192746529     gbest650.seq
 191298146     gbest651.seq
 192198297     gbest652.seq
 192108990     gbest653.seq
 193108960     gbest654.seq
 190549536     gbest655.seq
 191750489     gbest656.seq
 225090486     gbest657.seq
 230688403     gbest658.seq
 230687727     gbest659.seq
 230690938     gbest66.seq
 230689653     gbest660.seq
 230689610     gbest661.seq
 230689858     gbest662.seq
 230687792     gbest663.seq
 206589285     gbest664.seq
 178799015     gbest665.seq
 230688166     gbest666.seq
 230687742     gbest667.seq
 230689728     gbest668.seq
 230689251     gbest669.seq
 230690129     gbest67.seq
 230689543     gbest670.seq
 230687814     gbest671.seq
 230690825     gbest672.seq
 230690619     gbest673.seq
 230689426     gbest674.seq
 230689104     gbest675.seq
 230689012     gbest676.seq
 230687909     gbest677.seq
 230690605     gbest678.seq
 230690236     gbest679.seq
 230688934     gbest68.seq
 230688529     gbest680.seq
 230689134     gbest681.seq
 230689042     gbest682.seq
 230688403     gbest683.seq
 230690613     gbest684.seq
 230690289     gbest685.seq
 230688755     gbest686.seq
 230688649     gbest687.seq
 230688631     gbest688.seq
 230690540     gbest689.seq
 230689759     gbest69.seq
 230687519     gbest690.seq
 230690265     gbest691.seq
 230689343     gbest692.seq
 230687648     gbest693.seq
 230690451     gbest694.seq
 230689017     gbest695.seq
 230690698     gbest696.seq
 230690007     gbest697.seq
 230689655     gbest698.seq
 230688170     gbest699.seq
 230687843     gbest7.seq
 230687578     gbest70.seq
 230690292     gbest700.seq
 230688903     gbest701.seq
 230688598     gbest702.seq
 230688250     gbest703.seq
 216405699     gbest704.seq
 218359672     gbest705.seq
 217244135     gbest706.seq
 215041952     gbest707.seq
 220312496     gbest708.seq
 230689284     gbest709.seq
 230155399     gbest71.seq
 230688583     gbest710.seq
 230691296     gbest711.seq
 230687966     gbest712.seq
 230689991     gbest713.seq
 230690791     gbest714.seq
 230689475     gbest715.seq
 230687571     gbest716.seq
 230688977     gbest717.seq
 230689190     gbest718.seq
 230688410     gbest719.seq
 230687560     gbest72.seq
 230688284     gbest720.seq
 230690554     gbest721.seq
 230690248     gbest722.seq
 230688521     gbest723.seq
 230687865     gbest724.seq
 230690535     gbest725.seq
 230690170     gbest726.seq
 230691963     gbest727.seq
 230688528     gbest728.seq
 230688787     gbest729.seq
 209320296     gbest73.seq
 230688088     gbest730.seq
 230688778     gbest731.seq
 230687765     gbest732.seq
 222572678     gbest733.seq
 203689655     gbest734.seq
 230688344     gbest735.seq
 230688456     gbest736.seq
 230688196     gbest737.seq
 230690339     gbest738.seq
 230687967     gbest739.seq
 208181718     gbest74.seq
 230688906     gbest740.seq
 230691383     gbest741.seq
 230691369     gbest742.seq
 230690761     gbest743.seq
 230690909     gbest744.seq
 230690074     gbest745.seq
 230689388     gbest746.seq
 230689646     gbest747.seq
 230689612     gbest748.seq
 230691062     gbest749.seq
 207452169     gbest75.seq
 206773243     gbest750.seq
 199728788     gbest751.seq
 230688415     gbest752.seq
 230689552     gbest753.seq
 230688664     gbest754.seq
 230693984     gbest755.seq
 230688645     gbest756.seq
 230689051     gbest757.seq
 230689245     gbest758.seq
 230689843     gbest759.seq
 207840246     gbest76.seq
 230688687     gbest760.seq
 230690738     gbest761.seq
 230690231     gbest762.seq
 230689237     gbest763.seq
 230688426     gbest764.seq
 230687772     gbest765.seq
 230687781     gbest766.seq
 230689723     gbest767.seq
 230690103     gbest768.seq
 230688102     gbest769.seq
 208464217     gbest77.seq
 230687749     gbest770.seq
 230688956     gbest771.seq
 230687530     gbest772.seq
 230689227     gbest773.seq
 230689295     gbest774.seq
 230687701     gbest775.seq
 230688661     gbest776.seq
 230688283     gbest777.seq
 230688921     gbest778.seq
 230688521     gbest779.seq
 209181057     gbest78.seq
 230688760     gbest780.seq
 230691087     gbest781.seq
 230687454     gbest782.seq
 230689113     gbest783.seq
 230691784     gbest784.seq
 230689553     gbest785.seq
 230688961     gbest786.seq
 230689425     gbest787.seq
 230688541     gbest788.seq
 230690118     gbest789.seq
 208507472     gbest79.seq
 230688985     gbest790.seq
 230689114     gbest791.seq
 230687469     gbest792.seq
 230688551     gbest793.seq
 230689064     gbest794.seq
 230689301     gbest795.seq
 230689050     gbest796.seq
 230689320     gbest797.seq
 230688475     gbest798.seq
 230689510     gbest799.seq
 230688355     gbest8.seq
 207062534     gbest80.seq
 230688913     gbest800.seq
 230690735     gbest801.seq
 230689293     gbest802.seq
 230687448     gbest803.seq
 230688726     gbest804.seq
 230687526     gbest805.seq
 230688301     gbest806.seq
 230690229     gbest807.seq
 230687591     gbest808.seq
 230687780     gbest809.seq
 209023953     gbest81.seq
 230690710     gbest810.seq
 230689222     gbest811.seq
 230690651     gbest812.seq
 230688531     gbest813.seq
 230690205     gbest814.seq
 230687819     gbest815.seq
 230688367     gbest816.seq
 230689043     gbest817.seq
 230688328     gbest818.seq
 226194582     gbest819.seq
 207051431     gbest82.seq
 230687930     gbest820.seq
 230689835     gbest821.seq
  45915661     gbest822.seq
 204135767     gbest83.seq
 207232389     gbest84.seq
 206991457     gbest85.seq
 210742946     gbest86.seq
 226847452     gbest87.seq
 230692184     gbest88.seq
 230691464     gbest89.seq
 230689534     gbest9.seq
 217145410     gbest90.seq
 213200465     gbest91.seq
 214687903     gbest92.seq
 230688039     gbest93.seq
 230690573     gbest94.seq
 230688717     gbest95.seq
 230690030     gbest96.seq
 230688994     gbest97.seq
 230688519     gbest98.seq
 230689348     gbest99.seq
  95229781     gbgen.idx
 230688559     gbgss1.seq
 230690079     gbgss10.seq
 230687985     gbgss100.seq
 227641348     gbgss101.seq
 228853960     gbgss102.seq
 228577797     gbgss103.seq
 228616146     gbgss104.seq
 227678395     gbgss105.seq
 230160460     gbgss106.seq
 230687600     gbgss107.seq
 230687841     gbgss108.seq
 230688889     gbgss109.seq
 230689764     gbgss11.seq
 230689869     gbgss110.seq
 230689355     gbgss111.seq
 230690249     gbgss112.seq
 230688184     gbgss113.seq
 230687967     gbgss114.seq
 230687862     gbgss115.seq
 230687621     gbgss116.seq
 230689054     gbgss117.seq
 230689483     gbgss118.seq
 230687486     gbgss119.seq
 230687679     gbgss12.seq
 230689336     gbgss120.seq
 230688021     gbgss121.seq
 230687870     gbgss122.seq
 230688758     gbgss123.seq
 230688880     gbgss124.seq
 230688977     gbgss125.seq
 230688685     gbgss126.seq
 230689349     gbgss127.seq
 230687906     gbgss128.seq
 230690119     gbgss129.seq
 230690347     gbgss13.seq
 230690398     gbgss130.seq
 230688922     gbgss131.seq
 230689134     gbgss132.seq
 230688439     gbgss133.seq
 230689347     gbgss134.seq
 230689748     gbgss135.seq
 230689964     gbgss136.seq
 230688112     gbgss137.seq
 230687742     gbgss138.seq
 230689718     gbgss139.seq
 230689893     gbgss14.seq
 230688478     gbgss140.seq
 230688707     gbgss141.seq
 230687637     gbgss142.seq
 230688128     gbgss143.seq
 230689634     gbgss144.seq
 224596261     gbgss145.seq
 230688928     gbgss146.seq
 230689242     gbgss147.seq
 199926342     gbgss148.seq
 230687975     gbgss149.seq
 230689648     gbgss15.seq
 230689173     gbgss150.seq
 230690086     gbgss151.seq
 230688702     gbgss152.seq
 230688526     gbgss153.seq
 230688862     gbgss154.seq
 230690645     gbgss155.seq
 230689917     gbgss156.seq
 230690080     gbgss157.seq
 230689704     gbgss158.seq
 230688846     gbgss159.seq
 230689778     gbgss16.seq
 230689436     gbgss160.seq
 230688896     gbgss161.seq
 230687994     gbgss162.seq
 230688883     gbgss163.seq
 230689554     gbgss164.seq
 230689807     gbgss165.seq
 230690344     gbgss166.seq
 230689712     gbgss167.seq
 230687456     gbgss168.seq
 230687884     gbgss169.seq
 230688655     gbgss17.seq
 230688579     gbgss170.seq
 230688194     gbgss171.seq
 230689609     gbgss172.seq
 230690192     gbgss173.seq
 214234168     gbgss174.seq
 207652601     gbgss175.seq
 210032882     gbgss176.seq
 210673479     gbgss177.seq
 209682737     gbgss178.seq
 209419935     gbgss179.seq
 230688580     gbgss18.seq
 207488497     gbgss180.seq
 207258661     gbgss181.seq
 207746756     gbgss182.seq
 209295008     gbgss183.seq
 209292810     gbgss184.seq
 208633189     gbgss185.seq
 205849089     gbgss186.seq
 205574453     gbgss187.seq
 205287402     gbgss188.seq
 205471077     gbgss189.seq
 230688247     gbgss19.seq
 205274267     gbgss190.seq
 206071536     gbgss191.seq
 207492338     gbgss192.seq
 208615158     gbgss193.seq
 207878465     gbgss194.seq
 207952517     gbgss195.seq
 208773079     gbgss196.seq
 208858605     gbgss197.seq
 208919436     gbgss198.seq
 205753134     gbgss199.seq
 230688628     gbgss2.seq
 230689216     gbgss20.seq
 206170741     gbgss200.seq
 206444403     gbgss201.seq
 205509371     gbgss202.seq
 206015118     gbgss203.seq
 207311751     gbgss204.seq
 207132626     gbgss205.seq
 207106159     gbgss206.seq
 207240480     gbgss207.seq
 207062724     gbgss208.seq
 207144456     gbgss209.seq
 230687808     gbgss21.seq
 206857452     gbgss210.seq
 206971198     gbgss211.seq
 206675381     gbgss212.seq
 207873592     gbgss213.seq
 207897566     gbgss214.seq
 209406681     gbgss215.seq
 210075460     gbgss216.seq
 209272247     gbgss217.seq
 210246552     gbgss218.seq
 218145551     gbgss219.seq
 230691288     gbgss22.seq
 218861294     gbgss220.seq
 230687457     gbgss221.seq
 230688281     gbgss222.seq
 230687821     gbgss223.seq
 230688349     gbgss224.seq
 230688627     gbgss225.seq
 230689911     gbgss226.seq
 217912709     gbgss227.seq
 217931097     gbgss228.seq
 230688238     gbgss229.seq
 230690275     gbgss23.seq
 230688491     gbgss230.seq
 230689278     gbgss231.seq
 230688951     gbgss232.seq
 230687740     gbgss233.seq
 230689203     gbgss234.seq
 230688714     gbgss235.seq
 230687742     gbgss236.seq
 230689747     gbgss237.seq
 230689836     gbgss238.seq
 230688189     gbgss239.seq
 230687584     gbgss24.seq
 230687671     gbgss240.seq
 230689100     gbgss241.seq
 230688500     gbgss242.seq
 230688265     gbgss243.seq
 230688105     gbgss244.seq
 230687554     gbgss245.seq
 230687712     gbgss246.seq
 230689469     gbgss247.seq
 230687625     gbgss248.seq
 230688220     gbgss249.seq
 230688860     gbgss25.seq
 119303689     gbgss250.seq
 249997480     gbgss251.seq
 250000166     gbgss252.seq
 249998086     gbgss253.seq
 249997032     gbgss254.seq
  27044721     gbgss255.seq
 249999305     gbgss256.seq
 249998059     gbgss257.seq
 249997528     gbgss258.seq
 249998601     gbgss259.seq
 230689933     gbgss26.seq
 223609630     gbgss260.seq
 249998415     gbgss261.seq
 249998761     gbgss262.seq
 249998880     gbgss263.seq
 249998478     gbgss264.seq
 172395526     gbgss265.seq
 249996883     gbgss266.seq
 249998407     gbgss267.seq
 249998682     gbgss268.seq
 249999133     gbgss269.seq
 230687500     gbgss27.seq
 249997900     gbgss270.seq
  77373170     gbgss271.seq
 249999629     gbgss272.seq
   2536160     gbgss273.seq
  79503481     gbgss274.seq
 249999793     gbgss275.seq
 249999574     gbgss276.seq
  80246184     gbgss277.seq
 249998484     gbgss278.seq
 249999450     gbgss279.seq
 230691150     gbgss28.seq
 249999932     gbgss280.seq
 106015837     gbgss281.seq
 249999531     gbgss282.seq
 249999540     gbgss283.seq
 249999193     gbgss284.seq
 245561962     gbgss285.seq
 249997836     gbgss286.seq
 249999279     gbgss287.seq
 249999994     gbgss288.seq
 237545866     gbgss289.seq
 230689347     gbgss29.seq
 249999336     gbgss290.seq
 249999456     gbgss291.seq
 249998293     gbgss292.seq
 249999491     gbgss293.seq
 114414437     gbgss294.seq
 249998009     gbgss295.seq
 250000031     gbgss296.seq
 249998209     gbgss297.seq
 249999909     gbgss298.seq
  94193676     gbgss299.seq
 230689286     gbgss3.seq
 230689385     gbgss30.seq
 249998892     gbgss300.seq
 249999850     gbgss301.seq
 250000016     gbgss302.seq
 203677706     gbgss303.seq
 249999236     gbgss304.seq
 249997993     gbgss305.seq
 249998006     gbgss306.seq
 249999353     gbgss307.seq
  95926739     gbgss308.seq
 249999461     gbgss309.seq
 230690225     gbgss31.seq
 249999350     gbgss310.seq
 249998406     gbgss311.seq
 249998619     gbgss312.seq
 104014105     gbgss313.seq
 249999853     gbgss314.seq
 249998411     gbgss315.seq
 249998272     gbgss316.seq
  42310440     gbgss317.seq
  52138985     gbgss318.seq
  85042894     gbgss319.seq
 230688976     gbgss32.seq
 230688128     gbgss33.seq
 230690193     gbgss34.seq
 230688810     gbgss35.seq
 230689089     gbgss36.seq
 230689278     gbgss37.seq
 230688359     gbgss38.seq
 230689487     gbgss39.seq
 230688064     gbgss4.seq
 230688189     gbgss40.seq
 230687914     gbgss41.seq
 230689468     gbgss42.seq
 230689860     gbgss43.seq
 230688625     gbgss44.seq
 230688829     gbgss45.seq
 230690346     gbgss46.seq
 230688963     gbgss47.seq
 230687625     gbgss48.seq
 230688321     gbgss49.seq
 230688342     gbgss5.seq
 230688467     gbgss50.seq
 230688749     gbgss51.seq
 230689377     gbgss52.seq
 230689505     gbgss53.seq
 230690049     gbgss54.seq
 230688759     gbgss55.seq
 230687592     gbgss56.seq
 230688956     gbgss57.seq
 230690150     gbgss58.seq
 230688240     gbgss59.seq
 230689182     gbgss6.seq
 230689458     gbgss60.seq
 228978887     gbgss61.seq
 230688786     gbgss62.seq
 230688562     gbgss63.seq
 230688493     gbgss64.seq
 230688511     gbgss65.seq
 230688084     gbgss66.seq
 230688090     gbgss67.seq
 230687948     gbgss68.seq
 230687896     gbgss69.seq
 230687458     gbgss7.seq
 230689872     gbgss70.seq
 230689371     gbgss71.seq
 230689612     gbgss72.seq
 230689793     gbgss73.seq
 230688465     gbgss74.seq
 230687944     gbgss75.seq
 230688682     gbgss76.seq
 230688590     gbgss77.seq
 230688102     gbgss78.seq
 230688694     gbgss79.seq
 230690430     gbgss8.seq
 230688922     gbgss80.seq
 225707360     gbgss81.seq
 194162099     gbgss82.seq
 194321118     gbgss83.seq
 230691378     gbgss84.seq
 230689444     gbgss85.seq
 230688634     gbgss86.seq
 230689771     gbgss87.seq
 230688430     gbgss88.seq
 230689328     gbgss89.seq
 230689298     gbgss9.seq
 230689609     gbgss90.seq
 230689497     gbgss91.seq
 230687463     gbgss92.seq
 230688240     gbgss93.seq
 230689328     gbgss94.seq
 230690844     gbgss95.seq
 230688483     gbgss96.seq
 230689657     gbgss97.seq
 230688630     gbgss98.seq
 230689972     gbgss99.seq
 249998256     gbhtc1.seq
 250000248     gbhtc10.seq
 186743521     gbhtc11.seq
 249998738     gbhtc12.seq
 249999223     gbhtc13.seq
  38121098     gbhtc14.seq
 249993961     gbhtc2.seq
 249987935     gbhtc3.seq
 249988571     gbhtc4.seq
 249999714     gbhtc5.seq
 249988093     gbhtc6.seq
 249999558     gbhtc7.seq
  71734126     gbhtc8.seq
 249995727     gbhtc9.seq
 249927410     gbhtg1.seq
 249805795     gbhtg10.seq
 249975235     gbhtg100.seq
 249999934     gbhtg101.seq
 249974558     gbhtg102.seq
 249673124     gbhtg103.seq
 197948537     gbhtg104.seq
 249860310     gbhtg105.seq
 249957961     gbhtg106.seq
 249946058     gbhtg107.seq
 249778385     gbhtg108.seq
 249791420     gbhtg109.seq
   1643239     gbhtg11.seq
  19927072     gbhtg110.seq
 249909312     gbhtg111.seq
 249985108     gbhtg112.seq
 249968855     gbhtg113.seq
 249828377     gbhtg114.seq
 249885278     gbhtg115.seq
 120027757     gbhtg116.seq
 249627266     gbhtg117.seq
 249820018     gbhtg118.seq
 249818470     gbhtg119.seq
 249672637     gbhtg12.seq
 249909630     gbhtg120.seq
 249939215     gbhtg121.seq
 119533813     gbhtg122.seq
 249859177     gbhtg123.seq
 249852624     gbhtg124.seq
 249745100     gbhtg125.seq
 249828132     gbhtg126.seq
 249800281     gbhtg127.seq
 209121808     gbhtg128.seq
 249853612     gbhtg129.seq
 249796886     gbhtg13.seq
 249906332     gbhtg130.seq
 249953231     gbhtg131.seq
 249996683     gbhtg132.seq
 249983518     gbhtg133.seq
 237609709     gbhtg134.seq
 249852455     gbhtg14.seq
 249713866     gbhtg15.seq
 249908296     gbhtg16.seq
 249726057     gbhtg17.seq
 249966459     gbhtg18.seq
 249970703     gbhtg19.seq
 249995175     gbhtg2.seq
 249860520     gbhtg20.seq
 249652221     gbhtg21.seq
   3348908     gbhtg22.seq
 249684160     gbhtg23.seq
 249709648     gbhtg24.seq
 249730078     gbhtg25.seq
 249979217     gbhtg26.seq
 249961691     gbhtg27.seq
 249885413     gbhtg28.seq
 249953949     gbhtg29.seq
 249928345     gbhtg3.seq
 249647179     gbhtg30.seq
 249785501     gbhtg31.seq
 249890258     gbhtg32.seq
   3326431     gbhtg33.seq
 249694729     gbhtg34.seq
 249850785     gbhtg35.seq
 249883008     gbhtg36.seq
 249757537     gbhtg37.seq
 249992469     gbhtg38.seq
 249890470     gbhtg39.seq
 249925673     gbhtg4.seq
 249826065     gbhtg40.seq
 249828923     gbhtg41.seq
 249782309     gbhtg42.seq
 249841317     gbhtg43.seq
   1878062     gbhtg44.seq
 249971937     gbhtg45.seq
 249772816     gbhtg46.seq
 249825136     gbhtg47.seq
 249889579     gbhtg48.seq
 249821799     gbhtg49.seq
 249980040     gbhtg5.seq
 249801675     gbhtg50.seq
 249944901     gbhtg51.seq
 249956388     gbhtg52.seq
 249774469     gbhtg53.seq
 249747465     gbhtg54.seq
    476392     gbhtg55.seq
 249884740     gbhtg56.seq
 249973120     gbhtg57.seq
 249950141     gbhtg58.seq
 249761669     gbhtg59.seq
 249974518     gbhtg6.seq
 249989784     gbhtg60.seq
  21324925     gbhtg61.seq
 249812692     gbhtg62.seq
 249739402     gbhtg63.seq
 249846287     gbhtg64.seq
 249867399     gbhtg65.seq
 229373446     gbhtg66.seq
 249806515     gbhtg67.seq
 249755309     gbhtg68.seq
 249740650     gbhtg69.seq
 249851850     gbhtg7.seq
 249970992     gbhtg70.seq
 249987615     gbhtg71.seq
  19859935     gbhtg72.seq
 249955271     gbhtg73.seq
 249973586     gbhtg74.seq
 249953795     gbhtg75.seq
 249861943     gbhtg76.seq
 229535846     gbhtg77.seq
 249664812     gbhtg78.seq
 249967758     gbhtg79.seq
 249791419     gbhtg8.seq
 249927176     gbhtg80.seq
 249879745     gbhtg81.seq
 249970853     gbhtg82.seq
   6040638     gbhtg83.seq
 249838731     gbhtg84.seq
 249949459     gbhtg85.seq
 249857196     gbhtg86.seq
 249850808     gbhtg87.seq
 228625164     gbhtg88.seq
 249909892     gbhtg89.seq
 249971606     gbhtg9.seq
 249945206     gbhtg90.seq
 249975497     gbhtg91.seq
 249929758     gbhtg92.seq
 242204300     gbhtg93.seq
 249995487     gbhtg94.seq
 249936444     gbhtg95.seq
 249810601     gbhtg96.seq
 249994920     gbhtg97.seq
 249966213     gbhtg98.seq
   3838802     gbhtg99.seq
 249900491     gbinv1.seq
 249998919     gbinv10.seq
 113653548     gbinv11.seq
 249998879     gbinv12.seq
 249936414     gbinv13.seq
 184893333     gbinv14.seq
 249884239     gbinv2.seq
 232067366     gbinv3.seq
 250000022     gbinv4.seq
 249999264     gbinv5.seq
 247954050     gbinv6.seq
 196145513     gbinv7.seq
 250000228     gbinv8.seq
 249998076     gbinv9.seq
 142567575     gbjou1.idx
 148796036     gbjou2.idx
 206912431     gbjou3.idx
 295630137     gbjou4.idx
 283638081     gbjou5.idx
  41291563     gbjou6.idx
 185018194     gbkey1.idx
 289154337     gbkey2.idx
  64171863     gbkey3.idx
 249925159     gbmam1.seq
 249998732     gbmam2.seq
 249999589     gbmam3.seq
 216225800     gbmam4.seq
  60914552     gbnew.txt
 249999968     gbpat1.seq
 249999425     gbpat10.seq
 178569723     gbpat11.seq
 249999637     gbpat12.seq
 249999879     gbpat13.seq
 249999048     gbpat14.seq
 249998797     gbpat15.seq
 249999816     gbpat16.seq
  66708391     gbpat17.seq
 250000049     gbpat18.seq
 250000127     gbpat19.seq
 249999480     gbpat2.seq
 249999084     gbpat20.seq
 249993011     gbpat21.seq
 183857147     gbpat22.seq
 249999856     gbpat23.seq
 249901163     gbpat24.seq
 249999395     gbpat25.seq
 250000179     gbpat26.seq
  70897332     gbpat27.seq
 250000183     gbpat28.seq
 249997829     gbpat29.seq
 249999446     gbpat3.seq
 249997594     gbpat30.seq
 249999020     gbpat31.seq
 249998802     gbpat32.seq
 179933900     gbpat33.seq
 249997548     gbpat34.seq
 249999765     gbpat35.seq
 249996681     gbpat36.seq
 250000184     gbpat37.seq
 249999284     gbpat38.seq
 249998280     gbpat39.seq
 249999110     gbpat4.seq
 249999600     gbpat40.seq
 249999794     gbpat41.seq
  72312095     gbpat42.seq
 249998738     gbpat43.seq
 249999246     gbpat44.seq
 249999730     gbpat45.seq
 249999601     gbpat46.seq
 222932013     gbpat47.seq
 249999057     gbpat48.seq
 249999815     gbpat49.seq
  71756414     gbpat5.seq
 249999501     gbpat50.seq
 249999789     gbpat51.seq
 249999725     gbpat52.seq
 249999879     gbpat53.seq
 250000056     gbpat54.seq
 162603761     gbpat55.seq
 249999527     gbpat6.seq
 250000131     gbpat7.seq
 249994213     gbpat8.seq
 250000235     gbpat9.seq
  80682901     gbphg1.seq
 249999806     gbpln1.seq
 249955296     gbpln10.seq
 249976885     gbpln11.seq
  75388895     gbpln12.seq
 249993089     gbpln13.seq
 249982135     gbpln14.seq
 249998087     gbpln15.seq
 248456529     gbpln16.seq
 249935495     gbpln17.seq
 249917910     gbpln18.seq
 206769104     gbpln19.seq
 249875736     gbpln2.seq
 249163495     gbpln20.seq
 249938236     gbpln21.seq
 107925139     gbpln22.seq
 249999082     gbpln23.seq
  93772842     gbpln24.seq
 249999527     gbpln25.seq
 249601700     gbpln26.seq
 249996992     gbpln27.seq
 249998865     gbpln28.seq
 249999859     gbpln29.seq
 249930977     gbpln3.seq
 249999957     gbpln30.seq
 105707553     gbpln31.seq
 249999676     gbpln32.seq
 249998682     gbpln33.seq
 249999020     gbpln34.seq
 249999121     gbpln35.seq
 249998207     gbpln36.seq
  53217965     gbpln37.seq
 249964611     gbpln4.seq
 249998980     gbpln5.seq
 249996539     gbpln6.seq
  17584403     gbpln7.seq
 249997283     gbpln8.seq
 249995084     gbpln9.seq
 148888621     gbpri1.seq
 249873756     gbpri10.seq
 111091253     gbpri11.seq
 249966221     gbpri12.seq
 249900325     gbpri13.seq
 249891160     gbpri14.seq
 249940560     gbpri15.seq
 249905101     gbpri16.seq
 249997194     gbpri17.seq
 249995017     gbpri18.seq
 249826114     gbpri19.seq
 249989611     gbpri2.seq
 249868865     gbpri20.seq
 153553233     gbpri21.seq
 179997338     gbpri22.seq
 249998472     gbpri23.seq
 192540777     gbpri24.seq
 249846407     gbpri25.seq
 249925342     gbpri26.seq
 249785204     gbpri27.seq
 249942175     gbpri28.seq
 249797391     gbpri29.seq
 249800421     gbpri3.seq
 249851368     gbpri30.seq
 249860130     gbpri31.seq
 250000013     gbpri32.seq
  60658566     gbpri33.seq
 249995319     gbpri34.seq
 249976921     gbpri35.seq
 249944392     gbpri36.seq
 249998506     gbpri37.seq
 250000099     gbpri38.seq
 157047401     gbpri39.seq
 249936780     gbpri4.seq
 249875665     gbpri5.seq
 249965316     gbpri6.seq
 249942196     gbpri7.seq
 249933382     gbpri8.seq
 249936040     gbpri9.seq
         0     gbrel.txt
 249903863     gbrod1.seq
 249752303     gbrod10.seq
   4959596     gbrod11.seq
 249940888     gbrod12.seq
 249993965     gbrod13.seq
 249852228     gbrod14.seq
 249820063     gbrod15.seq
 249873002     gbrod16.seq
 249762749     gbrod17.seq
 249999503     gbrod18.seq
  35211845     gbrod19.seq
 249865460     gbrod2.seq
 249826653     gbrod20.seq
 249825756     gbrod21.seq
 222602425     gbrod22.seq
 249996283     gbrod23.seq
 249997524     gbrod24.seq
 249963220     gbrod25.seq
 249933395     gbrod26.seq
 249999941     gbrod27.seq
 176763512     gbrod28.seq
 249952252     gbrod3.seq
 249788367     gbrod4.seq
 249880951     gbrod5.seq
 249882838     gbrod6.seq
 249913943     gbrod7.seq
 249917722     gbrod8.seq
 249966432     gbrod9.seq
1725726429     gbsdr1.txt
4729597867     gbsdr2.txt
1972922209     gbsdr3.txt
 149909260     gbsec.idx
 249997891     gbsts1.seq
 249997362     gbsts10.seq
 212226966     gbsts11.seq
 249996524     gbsts12.seq
 249999267     gbsts13.seq
 249998123     gbsts14.seq
 249998620     gbsts15.seq
   9710933     gbsts16.seq
 249999730     gbsts17.seq
 249999742     gbsts18.seq
 250000256     gbsts19.seq
 249999218     gbsts2.seq
  86947132     gbsts20.seq
 249998732     gbsts3.seq
 249998299     gbsts4.seq
  28203837     gbsts5.seq
 249997222     gbsts6.seq
 249997899     gbsts7.seq
 249998458     gbsts8.seq
 249996448     gbsts9.seq
 249997947     gbsyn1.seq
 147248648     gbsyn2.seq
  10973061     gbtsa1.seq
    430852     gbuna1.seq
 249999988     gbvrl1.seq
 249990912     gbvrl10.seq
  21452698     gbvrl11.seq
 249994056     gbvrl2.seq
 249999982     gbvrl3.seq
 249993016     gbvrl4.seq
  95569681     gbvrl5.seq
 249998093     gbvrl6.seq
 249995938     gbvrl7.seq
 249998313     gbvrl8.seq
 249998023     gbvrl9.seq
 249780345     gbvrt1.seq
 249994741     gbvrt10.seq
 124292148     gbvrt11.seq
 249945418     gbvrt12.seq
 249922671     gbvrt13.seq
 249966335     gbvrt14.seq
 249996566     gbvrt15.seq
 249998515     gbvrt16.seq
 230047186     gbvrt17.seq
 249999666     gbvrt2.seq
 249958522     gbvrt3.seq
 210295945     gbvrt4.seq
 249996643     gbvrt5.seq
 249999418     gbvrt6.seq
 249902989     gbvrt7.seq
 249857979     gbvrt8.seq
 249707074     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         38399      97732217
BCT10        16123      80555205
BCT11        53633      85142430
BCT12        98         108531102
BCT13        151        93984019
BCT14        61         112455059
BCT15        51         108348224
BCT16        44         110061272
BCT17        57         113989395
BCT18        67         112830215
BCT19        33         84321683
BCT2         3250       107237197
BCT20        40         106881287
BCT21        58         105533856
BCT22        65         110783247
BCT23        58         107450077
BCT24        60         105492102
BCT25        58         109666487
BCT26        47         109689548
BCT27        80         107842667
BCT28        67         108744698
BCT29        62         108948940
BCT3         52         109691243
BCT30        245        96732818
BCT31        42515      91707302
BCT32        56898      62853585
BCT33        74686      78297293
BCT34        35100      95326890
BCT4         14520      106332585
BCT5         23937      37978600
BCT6         39028      87437940
BCT7         6940       90996770
BCT8         13938      93230307
BCT9         4178       106953398
ENV1         91430      71752745
ENV10        84950      89180806
ENV11        24942      19045362
ENV2         94835      69230292
ENV3         84330      80991178
ENV4         89048      87108090
ENV5         93216      56343217
ENV6         131949     31466569
ENV7         87089      71324789
ENV8         91884      76888673
ENV9         85110      88258245
EST1         68125      26289403
EST10        76524      29834002
EST100       76044      34952255
EST101       74554      43227172
EST102       71518      36589930
EST103       74095      37502131
EST104       73201      39486451
EST105       74449      40400226
EST106       70233      40084783
EST107       68824      36375038
EST108       73127      36412428
EST109       72293      45599774
EST11        75175      28789926
EST110       72714      45394655
EST111       69467      42722091
EST112       72629      33220991
EST113       69685      29557514
EST114       67315      38145052
EST115       68235      36144227
EST116       68335      42162637
EST117       72651      36081301
EST118       75075      34646729
EST119       74543      27227193
EST12        77544      30745583
EST120       73627      35310612
EST121       74220      35053899
EST122       64664      37397166
EST123       80548      44576247
EST124       77816      43657482
EST125       68438      47327188
EST126       67697      40311573
EST127       74431      50782970
EST128       69151      41735960
EST129       74804      44689418
EST13        76983      29267115
EST130       73558      45694124
EST131       71715      49643526
EST132       72438      47571351
EST133       78967      43763100
EST134       75346      31153913
EST135       78149      34447109
EST136       79304      45716496
EST137       74618      43483159
EST138       64604      34213226
EST139       70278      36440403
EST14        78808      31965249
EST140       68148      37673260
EST141       65720      36633561
EST142       71583      43136446
EST143       72644      46028501
EST144       67888      39272640
EST145       69033      39252616
EST146       73653      45102171
EST147       67463      39517573
EST148       63531      36335843
EST149       99569      54183966
EST15        74538      31501732
EST150       78466      44760171
EST151       85446      44542169
EST152       104014     55221395
EST153       104684     56852825
EST154       98377      56274686
EST155       74862      44788571
EST156       93859      55946950
EST157       98445      58991704
EST158       92671      54666338
EST159       79004      45573944
EST16        75869      33347307
EST160       68938      37548666
EST161       65879      29947152
EST162       60182      27751852
EST163       56238      27383234
EST164       64753      31441222
EST165       54144      27195910
EST166       79871      53581401
EST167       67942      36854656
EST168       72170      52490576
EST169       72250      41152763
EST17        82082      33820800
EST170       60388      30347382
EST171       63828      37618288
EST172       65788      33030873
EST173       63229      45738008
EST174       63525      36565289
EST175       106845     47427217
EST176       87307      51852290
EST177       103580     59961921
EST178       108042     59278717
EST179       96607      52123434
EST18        80691      32364991
EST180       82154      38177370
EST181       96418      44936414
EST182       97667      47905176
EST183       93005      37493533
EST184       89889      43095710
EST185       64072      44378854
EST186       70596      37648861
EST187       57704      34264926
EST188       71305      43102187
EST189       72331      26518285
EST19        78660      31714971
EST190       75623      45620401
EST191       73334      36990744
EST192       68318      34644567
EST193       68213      40217665
EST194       69600      51870787
EST195       69027      39461025
EST196       67465      33595929
EST197       69098      53218558
EST198       68141      45900260
EST199       72208      37059394
EST2         74644      28643983
EST20        74626      30757121
EST200       68153      46082800
EST201       70100      58308525
EST202       63794      47384017
EST203       63489      46619507
EST204       63757      46076534
EST205       64756      45850689
EST206       66972      50432969
EST207       61553      40227362
EST208       61775      35469482
EST209       66468      37665455
EST21        74039      34350318
EST210       68921      38946439
EST211       91230      51377139
EST212       71055      50466381
EST213       88831      52258989
EST214       113279     69991681
EST215       115174     68281314
EST216       103550     62496414
EST217       98482      64055205
EST218       119124     55807945
EST219       86444      45629866
EST22        74912      30008939
EST220       85803      52404157
EST221       92675      41788168
EST222       89202      45163929
EST223       73110      48207417
EST224       66738      41406835
EST225       68757      57890979
EST226       68730      59168516
EST227       78223      42229318
EST228       81258      44203827
EST229       73407      52842535
EST23        77381      32706122
EST230       70643      50801424
EST231       49969      28831049
EST232       27985      10643194
EST233       27985      10369265
EST234       26685      9909811
EST235       26928      9169580
EST236       27595      9580690
EST237       27360      10252564
EST238       27384      9830842
EST239       27520      10255442
EST24        74758      32788912
EST240       27332      12119702
EST241       27421      11350841
EST242       27496      10309417
EST243       27806      9419527
EST244       27071      9236629
EST245       27997      11297478
EST246       28019      10864600
EST247       27322      11413762
EST248       26796      12019541
EST249       27271      11457369
EST25        74100      31977000
EST250       27258      10973151
EST251       27226      11596851
EST252       27344      11637224
EST253       27474      11236022
EST254       27474      10912054
EST255       27391      10624113
EST256       27413      10897068
EST257       24734      17528723
EST258       25854      17230159
EST259       42294      19426236
EST26        75168      31024139
EST260       87950      40476404
EST261       75929      43914463
EST262       60013      30966046
EST263       100529     41323084
EST264       70711      42432572
EST265       68806      44601269
EST266       69426      44286056
EST267       69848      43766313
EST268       69032      40718923
EST269       69345      39995469
EST27        74427      32413665
EST270       64808      49403459
EST271       63583      30961552
EST272       86502      42550692
EST273       98187      46026239
EST274       71530      40772181
EST275       64281      32430833
EST276       70077      33756969
EST277       69690      42780153
EST278       74645      34595621
EST279       70797      36980253
EST28        107890     51048594
EST280       72063      46308677
EST281       64080      35671080
EST282       68005      35484334
EST283       84597      45221464
EST284       71983      39895297
EST285       81976      55460575
EST286       83252      52774106
EST287       109507     49116106
EST288       77860      42787839
EST289       73537      45232811
EST29        97107      45876086
EST290       72968      40433698
EST291       69900      34164490
EST292       70147      27266328
EST293       67591      41082213
EST294       62370      35192085
EST295       64762      41529068
EST296       70333      40500500
EST297       64759      44514625
EST298       63217      32290530
EST299       80526      42757851
EST3         73730      29915710
EST30        98633      53896345
EST300       83364      44279949
EST301       81707      50278350
EST302       109138     53985259
EST303       116491     48270596
EST304       72729      35305783
EST305       67348      36556610
EST306       70950      46488900
EST307       81622      40325959
EST308       69709      41687048
EST309       71297      41468720
EST31        86682      50561991
EST310       60032      34193349
EST311       52853      31886330
EST312       67546      42798174
EST313       69535      45145400
EST314       66454      41507846
EST315       69280      40063605
EST316       74189      37585706
EST317       60286      31597260
EST318       55681      28503291
EST319       54598      29111137
EST32        65470      41011402
EST320       54900      29323887
EST321       53721      28872779
EST322       57011      25909782
EST323       58049      25548976
EST324       56875      23534873
EST325       56966      23143515
EST326       57428      21948224
EST327       57967      23633997
EST328       57525      22477561
EST329       57888      21704861
EST33        71130      57736361
EST330       59034      22272915
EST331       74994      43734026
EST332       77189      34846067
EST333       79019      32054573
EST334       76149      32650306
EST335       85999      49837306
EST336       66663      50289825
EST337       70811      47262781
EST338       95879      59496750
EST339       96786      58465890
EST34        84889      48600072
EST340       101824     57226605
EST341       99897      54736656
EST342       76279      41076384
EST343       70136      39325376
EST344       76722      43249097
EST345       62409      55332044
EST346       64007      46041292
EST347       63614      40750660
EST348       61810      34918302
EST349       72196      51138327
EST35        85765      42945449
EST350       50375      27578060
EST351       52755      26217693
EST352       71219      38469016
EST353       60144      32668685
EST354       62491      31520598
EST355       64449      41466531
EST356       84982      43232109
EST357       70155      41854449
EST358       68147      43947240
EST359       67213      37162248
EST36        90290      48706594
EST360       63594      41794796
EST361       86835      50161123
EST362       84356      50008132
EST363       78530      42684963
EST364       63588      37308578
EST365       65749      33905956
EST366       73822      40570216
EST367       46809      24257669
EST368       67634      38135863
EST369       69193      42515194
EST37        86907      61545526
EST370       98870      45769311
EST371       74837      45167053
EST372       71400      47158223
EST373       71370      45909679
EST374       62762      35701537
EST375       75169      36575805
EST376       82182      37890601
EST377       57965      41077015
EST378       54047      38131357
EST379       64119      37309975
EST38        76873      50436743
EST380       85858      51832872
EST381       88050      47976661
EST382       67979      42361100
EST383       77978      41351182
EST384       54925      35774799
EST385       43673      22301225
EST386       63036      39642677
EST387       82094      43113561
EST388       77632      46379945
EST389       72779      45038868
EST39        95491      56096320
EST390       79099      47008188
EST391       76759      49208879
EST392       88874      62845145
EST393       77479      71730706
EST394       86122      50223715
EST395       89289      48909689
EST396       78949      38493935
EST397       72209      49561314
EST398       71393      56938297
EST399       71189      40269852
EST4         74560      28391201
EST40        63820      49149838
EST400       59764      38927632
EST401       74827      39994600
EST402       52651      32834084
EST403       77553      30721235
EST404       80579      28345514
EST405       70047      44344933
EST406       64420      36896299
EST407       68051      35295362
EST408       71999      42683085
EST409       69233      46497994
EST41        78033      55075092
EST410       66223      44539727
EST411       75757      44319391
EST412       58781      32811437
EST413       60787      37532002
EST414       81222      51883528
EST415       83234      48362705
EST416       77446      43884507
EST417       58759      40845312
EST418       56136      40608842
EST419       56771      39972509
EST42        101456     48420795
EST420       60295      38441882
EST421       78533      49004758
EST422       48710      30162936
EST423       65414      40048987
EST424       59100      39964966
EST425       60248      41528175
EST426       56269      41239307
EST427       47294      33352121
EST428       89337      42908215
EST429       70217      39044592
EST43        75859      46413250
EST430       70545      38846032
EST431       70680      38775765
EST432       70465      39144459
EST433       70464      38997520
EST434       70369      39242347
EST435       69852      38775378
EST436       69849      38713842
EST437       69849      39768865
EST438       69301      38299360
EST439       68283      38854309
EST44        104555     44579452
EST440       70163      39592722
EST441       70179      38655789
EST442       70286      38963373
EST443       70352      38487535
EST444       70721      38616789
EST445       70540      38847360
EST446       70611      38768522
EST447       70817      37790726
EST448       85551      49031882
EST449       86390      44498290
EST45        92879      51501643
EST450       84813      40843091
EST451       101697     57450729
EST452       82118      44699899
EST453       76354      49768350
EST454       82067      47103700
EST455       79181      42118478
EST456       94623      59705874
EST457       95784      57482109
EST458       79871      45483846
EST459       87753      48425797
EST46        103229     45334096
EST460       85437      55454026
EST461       83674      54650876
EST462       75636      51971935
EST463       75376      44665108
EST464       81500      56244723
EST465       97453      65197052
EST466       97248      66928075
EST467       111019     47546659
EST468       101626     45609866
EST469       51622      40167295
EST47        70162      18975387
EST470       51223      40306627
EST471       76836      45042841
EST472       57082      34485669
EST473       80918      47185642
EST474       116716     58962624
EST475       73264      45302235
EST476       81505      58208249
EST477       43509      24329031
EST478       48452      50265581
EST479       46464      58732661
EST48        70449      18763480
EST480       77119      55119462
EST481       63797      36091476
EST482       72356      41915936
EST483       70132      42231967
EST484       70866      43525796
EST485       61521      51902081
EST486       81676      44105599
EST487       109118     47980599
EST488       82546      53299597
EST489       61810      40037651
EST49        72493      21619903
EST490       56877      40921173
EST491       56923      38286650
EST492       66055      49211838
EST493       65029      45085517
EST494       61140      44535951
EST495       51918      37766273
EST496       52576      37857457
EST497       59186      42301864
EST498       64501      36553537
EST499       69259      44521256
EST5         48193      15292118
EST50        44089      12134910
EST500       57209      37948381
EST501       57327      40481706
EST502       62408      46493304
EST503       63069      47552827
EST504       66673      43897442
EST505       49891      39813691
EST506       57858      38694470
EST507       53100      35241295
EST508       58387      39551133
EST509       60738      37672478
EST51        44037      12254462
EST510       71275      44839712
EST511       70768      59629956
EST512       70243      49806121
EST513       70239      51843305
EST514       46511      57669321
EST515       57762      50102552
EST516       66788      44683915
EST517       65085      40566267
EST518       77403      46413177
EST519       82515      53600958
EST52        43821      11842714
EST520       82315      51645955
EST521       67027      40660957
EST522       65015      39572467
EST523       72331      50643369
EST524       81115      49092126
EST525       76966      62196102
EST526       69019      47797489
EST527       70027      47225999
EST528       68664      49225141
EST529       59998      47385451
EST53        65319      24845265
EST530       62812      45441005
EST531       83987      45993929
EST532       75395      40580594
EST533       113821     45952455
EST534       108462     50435192
EST535       72092      49707863
EST536       50478      49618875
EST537       66078      45141968
EST538       99772      10936431
EST539       99756      10963458
EST54        96397      39190466
EST540       97825      27391578
EST541       87900      35380632
EST542       86884      31661595
EST543       77533      45028936
EST544       67266      59665304
EST545       91159      55646249
EST546       80400      44044540
EST547       67267      44336317
EST548       71243      46675400
EST549       75326      50189056
EST55        97014      42800207
EST550       85201      50881387
EST551       73534      53622487
EST552       67109      46819588
EST553       72754      55181242
EST554       86188      50359637
EST555       83447      45953426
EST556       82521      45352934
EST557       83958      40548630
EST558       84196      46016794
EST559       75389      51671238
EST56        97468      47084139
EST560       72560      55379471
EST561       75013      52003930
EST562       82879      44257795
EST563       103022     46967182
EST564       111024     49060108
EST565       121549     50726365
EST566       131888     59086632
EST567       89058      53651956
EST568       80382      51802486
EST569       81211      22588775
EST57        92566      46121812
EST570       84289      8746236
EST571       105244     44844604
EST572       115796     56075293
EST573       100508     51535869
EST574       66095      43833542
EST575       70820      41731907
EST576       73794      51675835
EST577       72853      43441711
EST578       77802      46992347
EST579       67691      47454553
EST58        104150     51701067
EST580       73046      51521998
EST581       98249      53915421
EST582       89294      43940692
EST583       65017      41176213
EST584       62256      46865672
EST585       94435      57114582
EST586       91704      53846350
EST587       75277      43102979
EST588       83686      30528838
EST589       96798      10417924
EST59        105854     54228497
EST590       96880      10271597
EST591       94829      22342086
EST592       69482      44730581
EST593       93950      45616225
EST594       73115      49840055
EST595       78157      54323985
EST596       84694      52349377
EST597       78456      51145366
EST598       77613      51898047
EST599       80078      45525003
EST6         54905      17436848
EST60        75879      33103849
EST600       84328      49993280
EST601       74155      46560230
EST602       66813      46460917
EST603       57614      36813192
EST604       108949     31688083
EST605       58384      39194617
EST606       51217      32161144
EST607       51160      33909601
EST608       57823      39843375
EST609       73505      47374303
EST61        66698      28818578
EST610       65004      47819518
EST611       104451     23518932
EST612       120199     13002612
EST613       120615     12660625
EST614       122476     11299660
EST615       112630     17778094
EST616       65585      47233118
EST617       63870      49596999
EST618       75537      49037812
EST619       77341      49173934
EST62        72804      32336776
EST620       67800      49148266
EST621       77114      44848162
EST622       62519      41870733
EST623       68861      39931708
EST624       112388     24327267
EST625       127223     11797027
EST626       89271      29786369
EST627       77780      51520595
EST628       72917      51535271
EST629       84520      44865777
EST63        70522      30034249
EST630       89010      51230140
EST631       72610      45422478
EST632       63330      32470621
EST633       75577      54308826
EST634       68393      48064932
EST635       104612     49762803
EST636       96182      54980151
EST637       61836      46899753
EST638       61100      48213147
EST639       73068      53810671
EST64        79867      32556951
EST640       74232      33731467
EST641       88209      55166932
EST642       84062      50504978
EST643       83787      39876298
EST644       71416      47101244
EST645       69315      52164858
EST646       88727      45658049
EST647       77103      27184296
EST648       77516      24560334
EST649       76238      28405262
EST65        76504      30019757
EST650       75956      27814305
EST651       76688      27426951
EST652       75839      30593062
EST653       76274      28041148
EST654       75646      28398756
EST655       77096      27999969
EST656       76008      30619025
EST657       83535      40536565
EST658       80618      50650401
EST659       81928      59885437
EST66        70730      28492096
EST660       83061      58196203
EST661       71782      39731028
EST662       61495      36944503
EST663       78005      47444631
EST664       61352      30060012
EST665       40163      35268978
EST666       59162      43079903
EST667       58854      46013151
EST668       64563      44620454
EST669       77512      42862457
EST67        64957      29711233
EST670       66367      37854311
EST671       85508      52102017
EST672       80823      43569933
EST673       65608      41592283
EST674       72184      47963286
EST675       79861      46505030
EST676       66718      35441628
EST677       70344      48441696
EST678       76784      50798811
EST679       58079      40113849
EST68        72755      32616894
EST680       70011      50460317
EST681       73442      49745510
EST682       71854      45830592
EST683       70336      47374851
EST684       67896      48672646
EST685       81035      69291540
EST686       82163      69219428
EST687       82616      69033988
EST688       75084      39022255
EST689       77276      34987340
EST69        79433      35474537
EST690       54350      30800089
EST691       65839      46148993
EST692       62743      41843133
EST693       65037      44997537
EST694       70964      48755825
EST695       58518      39753615
EST696       58556      39463226
EST697       59342      39825118
EST698       68774      43623167
EST699       64434      44994245
EST7         74531      29353676
EST70        73542      29398940
EST700       65935      45626312
EST701       65910      45566285
EST702       69255      45258552
EST703       73684      41404234
EST704       68306      37801787
EST705       66695      39827068
EST706       67705      37337229
EST707       68946      39725684
EST708       66648      42386129
EST709       70455      56397267
EST71        73971      24859288
EST710       65308      42005706
EST711       70160      42561488
EST712       64741      42200405
EST713       59337      40701185
EST714       67643      38786169
EST715       61978      37862435
EST716       66699      42302318
EST717       84848      51598271
EST718       101396     50835154
EST719       79925      43796195
EST72        86815      42378664
EST720       59874      32027973
EST721       53242      29285600
EST722       51064      31878577
EST723       57616      38118328
EST724       61042      40166858
EST725       56743      37976473
EST726       65010      39824577
EST727       59678      39024003
EST728       56174      34863478
EST729       52982      31420079
EST73        43437      12364261
EST730       74842      43737432
EST731       109130     34928277
EST732       99188      45001394
EST733       77810      34405539
EST734       75055      27411783
EST735       70577      47553915
EST736       68392      42986285
EST737       85309      50474205
EST738       78705      50165347
EST739       70754      42017124
EST74        40877      11254133
EST740       68839      40353473
EST741       57451      38527919
EST742       57606      38129417
EST743       61878      41590604
EST744       59757      39273799
EST745       60982      38505993
EST746       70494      48258280
EST747       84601      56631536
EST748       81031      47735038
EST749       79526      45731018
EST75        40845      12527458
EST750       64691      29659202
EST751       58709      32203619
EST752       87073      53493616
EST753       78784      59334921
EST754       77488      58974333
EST755       38756      24418437
EST756       32436      19716081
EST757       32563      19614650
EST758       32690      18992826
EST759       59850      34225515
EST76        41234      12723883
EST760       58858      34899623
EST761       58656      35423065
EST762       58809      35039391
EST763       63330      32490229
EST764       70991      14745715
EST765       71057      14548477
EST766       71057      14531697
EST767       71225      14142101
EST768       70900      14901443
EST769       66747      26535014
EST77        41287      12379581
EST770       90488      53086972
EST771       90857      54755324
EST772       113080     52898843
EST773       113770     52096456
EST774       113845     52036885
EST775       113519     52409556
EST776       86586      48099475
EST777       67130      42633236
EST778       61014      40737308
EST779       59926      40030587
EST78        41235      13283307
EST780       61594      38062910
EST781       63090      37890793
EST782       61228      37717498
EST783       78496      45667730
EST784       72878      45338709
EST785       80751      53083012
EST786       76669      34232725
EST787       76919      51637487
EST788       76787      9037132
EST789       75661      5864144
EST79        40970      13085638
EST790       75774      5846599
EST791       69367      6139586
EST792       69084      6154205
EST793       70847      12073809
EST794       70844      15033247
EST795       71193      14217875
EST796       71151      14315463
EST797       70921      14851329
EST798       71330      13893936
EST799       70614      16286067
EST8         75810      30584188
EST80        41056      12200687
EST800       66335      45878540
EST801       64971      40367597
EST802       79563      40813231
EST803       87154      58529380
EST804       72933      50604049
EST805       75250      51601091
EST806       76719      46005426
EST807       73957      43753115
EST808       76181      56762336
EST809       65073      41100700
EST81        40616      12145230
EST810       63533      44604842
EST811       62954      44078574
EST812       64771      45231068
EST813       62970      44873804
EST814       64567      37147195
EST815       73327      37865188
EST816       71674      25907268
EST817       73217      26801841
EST818       72756      26324957
EST819       78285      26361666
EST82        41382      12898230
EST820       72529      28118907
EST821       68493      28259297
EST822       19500      5807846
EST83        41899      11985601
EST84        41488      13227762
EST85        41343      13090257
EST86        43027      13028439
EST87        46734      17650566
EST88        43317      27182796
EST89        43085      19388789
EST9         77564      29870697
EST90        49565      20446244
EST91        51579      22126971
EST92        50914      22038815
EST93        84503      50131616
EST94        79377      38453211
EST95        73134      27943957
EST96        74267      29185167
EST97        74803      41170567
EST98        77283      40672328
EST99        76370      43671834
GSS1         90430      38662943
GSS10        74787      43607320
GSS100       80735      53971664
GSS101       74738      42240517
GSS102       73329      45795023
GSS103       73648      44992357
GSS104       73318      45586185
GSS105       73322      44678178
GSS106       74426      45470373
GSS107       81407      54214366
GSS108       83607      55584656
GSS109       80497      53099504
GSS11        70802      35983221
GSS110       83236      50414169
GSS111       84022      55210073
GSS112       79938      61714412
GSS113       90046      45964896
GSS114       90349      54605890
GSS115       75631      49835317
GSS116       87925      63549447
GSS117       82334      60106582
GSS118       75605      39949531
GSS119       81448      52672069
GSS12        73150      38495437
GSS120       95653      53247821
GSS121       84443      55332718
GSS122       85011      54678646
GSS123       82368      54883067
GSS124       76259      69411509
GSS125       76066      67163569
GSS126       79639      56039680
GSS127       72433      50238646
GSS128       72549      50010064
GSS129       73030      49226869
GSS13        76795      38906116
GSS130       72287      50500475
GSS131       73656      49939229
GSS132       83999      59977943
GSS133       81197      58380156
GSS134       70044      56408758
GSS135       70519      55044741
GSS136       75952      67607108
GSS137       75457      63186502
GSS138       77457      52326030
GSS139       85499      53662696
GSS14        71379      32114760
GSS140       94711      58049538
GSS141       93303      59893634
GSS142       81958      53929946
GSS143       89769      50595823
GSS144       72103      59089999
GSS145       114930     59511141
GSS146       111067     58394437
GSS147       86226      63647366
GSS148       55179      31343953
GSS149       67100      47296040
GSS15        70493      35055254
GSS150       72995      55896458
GSS151       72982      55920461
GSS152       73000      55888554
GSS153       73012      55866465
GSS154       72970      55939832
GSS155       72981      55922768
GSS156       75707      57785758
GSS157       83528      39195724
GSS158       88049      60128335
GSS159       86772      64919430
GSS16        78213      46093569
GSS160       88031      59820864
GSS161       92551      57472512
GSS162       82885      57226584
GSS163       76243      49678298
GSS164       75771      48590238
GSS165       92705      58637901
GSS166       88992      59730684
GSS167       85988      61453690
GSS168       102783     26256270
GSS169       103093     29418413
GSS17        70895      33315071
GSS170       78937      46758671
GSS171       80953      52896574
GSS172       54394      39355505
GSS173       52628      40814397
GSS174       61916      51490322
GSS175       59033      45446997
GSS176       57769      48362134
GSS177       57489      48794219
GSS178       58190      46600140
GSS179       58380      46034384
GSS18        58792      27918452
GSS180       58913      47989933
GSS181       58948      48421703
GSS182       58611      49465418
GSS183       58246      48435350
GSS184       58637      46079755
GSS185       58719      49348887
GSS186       60103      50320808
GSS187       60304      49771194
GSS188       60508      49164404
GSS189       60377      49554787
GSS19        56814      29015258
GSS190       60516      49138897
GSS191       60060      46962253
GSS192       59200      45202582
GSS193       58414      47678025
GSS194       58931      46062884
GSS195       58876      46232205
GSS196       58306      48020144
GSS197       58245      48209968
GSS198       58202      48388065
GSS199       60128      50007490
GSS2         89000      39334171
GSS20        57683      26671178
GSS200       59839      50876247
GSS201       59838      49497316
GSS202       60655      45813853
GSS203       60308      46893737
GSS204       59407      49677849
GSS205       59530      49301014
GSS206       59551      49238653
GSS207       59455      49530518
GSS208       59579      49153705
GSS209       59522      49326394
GSS21        61491      29519987
GSS210       59724      48713770
GSS211       59642      48960474
GSS212       59849      48330910
GSS213       58886      46171533
GSS214       58868      45994018
GSS215       58413      47567226
GSS216       58238      48171747
GSS217       58744      46253030
GSS218       57876      48031968
GSS219       64297      54162239
GSS22        64602      37591837
GSS220       64817      54769903
GSS221       89899      58795443
GSS222       84300      44773629
GSS223       78132      60370271
GSS224       83482      53268139
GSS225       91297      49817917
GSS226       75288      51937210
GSS227       71267      47114128
GSS228       71251      47155448
GSS229       95860      51402015
GSS23        57530      27078431
GSS230       99937      64619616
GSS231       86960      56293139
GSS232       96187      62491501
GSS233       95177      63747532
GSS234       96245      62424151
GSS235       95245      63547922
GSS236       95362      63297185
GSS237       92354      67042014
GSS238       94161      64797524
GSS239       94730      64083462
GSS24        66204      42045465
GSS240       92708      66603106
GSS241       93223      65960182
GSS242       93514      65605110
GSS243       92264      67436388
GSS244       94722      64620318
GSS245       90095      69967002
GSS246       88197      68096608
GSS247       73442      52096647
GSS248       58380      34889498
GSS249       58483      38085997
GSS25        68012      28208036
GSS250       36496      22425317
GSS251       87209      64341123
GSS252       83563      62780890
GSS253       103512     48467445
GSS254       68547      58487558
GSS255       7225       6693959
GSS256       68689      57997997
GSS257       69318      56731875
GSS258       69558      56262131
GSS259       71310      56073507
GSS26        58165      25385995
GSS260       68163      51560938
GSS261       75915      58209304
GSS262       87237      74898207
GSS263       81830      44609896
GSS264       92577      44779809
GSS265       56441      44219573
GSS266       77450      61364360
GSS267       69674      58716476
GSS268       67726      62729803
GSS269       62115      53378890
GSS27        65496      32012382
GSS270       95374      42846906
GSS271       21124      4925389
GSS272       112777     70738610
GSS273       983        698223
GSS274       23226      28867035
GSS275       106545     69076642
GSS276       84506      34579222
GSS277       38340      23887677
GSS278       120690     73137800
GSS279       118608     75280747
GSS28        65277      32524263
GSS280       107827     64313380
GSS281       44875      22452831
GSS282       83122      54662699
GSS283       95854      61476351
GSS284       107385     78564022
GSS285       106112     76516066
GSS286       106101     79982459
GSS287       104023     80029991
GSS288       76699      51240599
GSS289       104177     63042260
GSS29        77560      39751724
GSS290       109868     66415305
GSS291       106304     59376521
GSS292       68468      37495987
GSS293       70288      39120208
GSS294       36242      16959499
GSS295       85481      46023427
GSS296       97119      55907586
GSS297       94941      49578268
GSS298       96269      55917369
GSS299       42190      23639634
GSS3         87422      41844005
GSS30        82722      39709532
GSS300       114638     43642267
GSS301       117085     39368203
GSS302       103278     77900651
GSS303       81613      53566266
GSS304       95891      36542252
GSS305       95417      37268709
GSS306       96671      35161518
GSS307       94285      39167432
GSS308       37736      17626556
GSS309       103939     66277823
GSS31        74196      40403296
GSS310       94551      61190929
GSS311       95128      60357048
GSS312       94773      60868501
GSS313       33134      33073975
GSS314       83875      28283031
GSS315       84362      27389237
GSS316       85085      25924821
GSS317       14410      4314220
GSS318       16547      7508221
GSS319       30203      14154252
GSS32        70296      48150506
GSS33        79819      37806757
GSS34        75886      40326853
GSS35        74137      39965937
GSS36        87407      56321961
GSS37        87597      58175336
GSS38        85527      44938754
GSS39        86748      50382457
GSS4         79227      41150659
GSS40        86338      39890925
GSS41        83128      32053103
GSS42        81246      56934526
GSS43        80119      58036205
GSS44        72015      47522099
GSS45        72042      47418737
GSS46        77593      45700878
GSS47        77817      38710219
GSS48        83136      57946480
GSS49        86562      64736594
GSS5         78819      40567994
GSS50        81619      54415202
GSS51        93859      59286241
GSS52        88468      58760461
GSS53        76598      42227197
GSS54        72837      40526305
GSS55        86497      47027164
GSS56        88038      58467263
GSS57        76195      63888101
GSS58        70809      77994698
GSS59        85505      69015835
GSS6         78088      38842501
GSS60        89580      60228581
GSS61        63450      44798512
GSS62        66010      45382089
GSS63        89643      67177279
GSS64        84960      58429020
GSS65        86085      52989465
GSS66        85463      55672245
GSS67        93346      57853897
GSS68        97857      52536797
GSS69        97528      52972908
GSS7         77657      39174963
GSS70        98228      52048388
GSS71        99183      50781820
GSS72        99205      50753178
GSS73        99077      50923874
GSS74        99695      50102347
GSS75        97770      52652118
GSS76        91867      64654021
GSS77        89865      70740033
GSS78        88925      70111547
GSS79        87858      69635748
GSS8         75881      38134490
GSS80        87908      63986891
GSS81        88312      44882444
GSS82        78277      23271484
GSS83        78145      23584254
GSS84        84149      48917342
GSS85        77098      45548204
GSS86        88958      56028697
GSS87        84342      58665578
GSS88        75464      75654161
GSS89        78488      73099327
GSS9         72240      37167492
GSS90        83987      46687847
GSS91        85043      49406143
GSS92        73869      40395541
GSS93        80113      56218088
GSS94        76471      56905463
GSS95        82996      52877042
GSS96        82955      59174299
GSS97        85633      57672356
GSS98        86989      52201941
GSS99        82545      66443743
HTC1         25181      27238735
HTC10        77726      71533057
HTC11        48239      67020709
HTC12        66997      61008541
HTC13        68496      69600603
HTC14        14147      9054486
HTC2         16162      36527196
HTC3         16149      36808896
HTC4         16389      35873366
HTC5         16090      40456968
HTC6         16183      37872493
HTC7         55450      33944681
HTC8         28838      15503974
HTC9         65502      65512606
HTG1         1317       188816214
HTG10        1297       186286287
HTG100       1075       191119924
HTG101       1179       191244728
HTG102       1060       189547128
HTG103       1076       189402958
HTG104       803        150303768
HTG105       1023       189791146
HTG106       992        189493559
HTG107       998        189461130
HTG108       986        189298618
HTG109       1222       190532185
HTG11        9          1245953
HTG110       107        15228729
HTG111       1168       189985586
HTG112       1076       189793603
HTG113       1423       191733006
HTG114       1286       189663584
HTG115       1069       187661069
HTG116       562        90458565
HTG117       1620       188255526
HTG118       968        193182838
HTG119       744        168761581
HTG12        1451       183812880
HTG120       1093       193782917
HTG121       1102       193062593
HTG122       497        92572899
HTG123       1037       189382427
HTG124       1074       191978101
HTG125       1120       191766388
HTG126       1160       192370905
HTG127       1110       192625029
HTG128       953        161176456
HTG129       1171       192379534
HTG13        874        191660453
HTG130       1141       191902610
HTG131       1168       191641695
HTG132       1261       191463329
HTG133       1274       191111735
HTG134       1296       181842114
HTG14        749        192119092
HTG15        743        191912522
HTG16        781        192058116
HTG17        802        191740276
HTG18        767        192122403
HTG19        2060       171005924
HTG2         2450       186032194
HTG20        1066       187750579
HTG21        971        189001584
HTG22        10         2576485
HTG23        783        191603739
HTG24        922        190054738
HTG25        901        190325895
HTG26        809        191385146
HTG27        777        191955594
HTG28        865        191172912
HTG29        882        190698357
HTG3         2521       185182868
HTG30        952        189589120
HTG31        895        190867299
HTG32        929        190231949
HTG33        10         2551973
HTG34        869        191033582
HTG35        964        189451245
HTG36        883        190994771
HTG37        861        191194957
HTG38        822        191809458
HTG39        946        189933403
HTG4         2561       188413286
HTG40        929        190575711
HTG41        936        190221999
HTG42        1039       189062487
HTG43        1207       186705135
HTG44        6          1440836
HTG45        1260       188090390
HTG46        1173       187776255
HTG47        1151       187762861
HTG48        1118       191315832
HTG49        1271       190542083
HTG5         1284       185519279
HTG50        1175       190964995
HTG51        1132       191312261
HTG52        1038       191365443
HTG53        1018       189641828
HTG54        1124       189871810
HTG55        1          356290
HTG56        970        190170079
HTG57        1108       190207800
HTG58        1046       190300011
HTG59        1014       189664607
HTG6         1274       185170203
HTG60        968        189200544
HTG61        92         16208344
HTG62        1010       189318336
HTG63        1030       189824223
HTG64        1067       187350605
HTG65        1128       188132641
HTG66        1011       174017282
HTG67        1086       189542144
HTG68        1067       189359832
HTG69        1170       188690627
HTG7         1275       185326125
HTG70        1173       187621233
HTG71        1287       184462593
HTG72        108        14625200
HTG73        1221       185311372
HTG74        1239       184674446
HTG75        1244       184625496
HTG76        1183       187621779
HTG77        1040       173550055
HTG78        1118       188186640
HTG79        1101       190885879
HTG8         1459       184483094
HTG80        1137       190921555
HTG81        1187       190869757
HTG82        1121       190429755
HTG83        26         4635039
HTG84        1173       190261148
HTG85        1116       190096668
HTG86        1213       189967044
HTG87        1123       189767404
HTG88        1015       173845199
HTG89        1225       188570929
HTG9         1200       186953640
HTG90        1273       187736405
HTG91        1147       190220854
HTG92        1158       189907425
HTG93        1074       184272715
HTG94        1193       190090541
HTG95        1136       190358125
HTG96        1153       190261076
HTG97        1107       190775977
HTG98        1161       191016622
HTG99        19         2961888
INV1         87174      61291697
INV10        83147      66155619
INV11        39064      29291514
INV12        86533      64312350
INV13        76915      72553910
INV14        20336      84093256
INV2         1594       184911688
INV3         837        145737262
INV4         34701      109806973
INV5         79490      70310402
INV6         27622      122046449
INV7         40401      73529046
INV8         80864      72010593
INV9         60949      87565658
MAM1         12621      165735748
MAM2         57374      103593783
MAM3         33945      124272149
MAM4         70080      65058658
PAT1         222592     70119231
PAT10        124662     102623629
PAT11        98038      63865682
PAT12        141721     62598360
PAT13        105778     59940133
PAT14        103495     50220603
PAT15        121403     53121635
PAT16        112890     61312711
PAT17        39713      16493824
PAT18        147080     52719692
PAT19        154046     77955924
PAT2         194509     84662483
PAT20        104975     118360610
PAT21        133104     95934759
PAT22        84414      77984688
PAT23        123593     103416980
PAT24        119386     105821309
PAT25        145827     86560758
PAT26        175047     64237480
PAT27        71147      1778675
PAT28        102205     77408400
PAT29        93953      87654524
PAT3         171989     95891307
PAT30        119938     61664315
PAT31        96671      78978369
PAT32        128430     55051342
PAT33        92094      51065481
PAT34        111309     78153687
PAT35        138110     29117720
PAT36        158494     24101055
PAT37        114726     49001210
PAT38        88808      90768098
PAT39        107101     72497480
PAT4         153748     106057898
PAT40        100251     75398789
PAT41        160038     12232851
PAT42        34860      14799849
PAT43        135194     108002157
PAT44        167081     97033001
PAT45        116398     127555097
PAT46        196344     76721733
PAT47        80299      127990882
PAT48        27631      180872621
PAT49        185408     93066629
PAT5         57162      23941642
PAT50        274454     6861350
PAT51        204271     44986697
PAT52        199178     69018356
PAT53        342935     8573375
PAT54        164648     101090342
PAT55        141888     49658673
PAT6         170642     91909261
PAT7         154872     88278449
PAT8         131154     97088564
PAT9         129741     101115498
PHG1         4115       32656810
PLN1         60082      93237222
PLN10        35602      75742656
PLN11        13902      135955303
PLN12        7324       32342473
PLN13        17560      144723042
PLN14        17617      146198585
PLN15        17555      146290364
PLN16        22532      130686413
PLN17        3305       155959031
PLN18        1218       171377451
PLN19        414        127683665
PLN2         3236       162536219
PLN20        5          161804357
PLN21        417        169286391
PLN22        20217      47268586
PLN23        67586      69953268
PLN24        28168      30508700
PLN25        77116      76845538
PLN26        54872      91702478
PLN27        12761      134993916
PLN28        25176      133727571
PLN29        78131      75178672
PLN3         1547       182714150
PLN30        99694      58364331
PLN31        30456      31657561
PLN32        80354      72899807
PLN33        78985      75630269
PLN34        85860      70632220
PLN35        104823     58265089
PLN36        73685      79484829
PLN37        9334       20755208
PLN4         1987       190979615
PLN5         18149      149743526
PLN6         75845      79209778
PLN7         5450       5097529
PLN8         73567      76146336
PLN9         37010      49221382
PRI1         23000      59621544
PRI10        1295       179722091
PRI11        668        80557260
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191718955
PRI17        1138       193767758
PRI18        1099       194325738
PRI19        1183       193471568
PRI2         13669      156227120
PRI20        1933       191458289
PRI21        20806      81900105
PRI22        32471      85298122
PRI23        61498      78361061
PRI24        28503      64719723
PRI25        5235       171179726
PRI26        2193       182099570
PRI27        1545       182671572
PRI28        2054       182728377
PRI29        2037       181856757
PRI3         1434       175953829
PRI30        12995      155650879
PRI31        1298       183102036
PRI32        51136      94304654
PRI33        13941      20739185
PRI34        32270      63837414
PRI35        18942      124537058
PRI36        20763      144473515
PRI37        67106      84838719
PRI38        63230      86513190
PRI39        36258      64483656
PRI4         1294       186736077
PRI5         1302       182716315
PRI6         1191       181008521
PRI7         1240       180854611
PRI8         1233       177722022
PRI9         1344       174760766
ROD1         29439      144963687
ROD10        974        181161700
ROD11        21         3667193
ROD12        1036       185708772
ROD13        942        182941776
ROD14        1037       189219090
ROD15        950        180240633
ROD16        966        181922926
ROD17        994        185916783
ROD18        9341       176406549
ROD19        7747       14255466
ROD2         912        174937174
ROD20        20165      149739747
ROD21        1145       183609456
ROD22        1049       163592512
ROD23        14066      163320993
ROD24        38388      69821660
ROD25        19584      114102480
ROD26        1507       190056750
ROD27        151287     18206406
ROD28        49409      57071597
ROD3         912        173456352
ROD4         901        173880971
ROD5         929        174042414
ROD6         981        179155375
ROD7         956        179721423
ROD8         994        182023919
ROD9         998        182087122
STS1         84834      36486301
STS10        57907      44419978
STS11        49213      37736560
STS12        57924      43637361
STS13        64551      42980742
STS14        96057      34661440
STS15        107342     27440184
STS16        4142       1105755
STS17        106233     28257593
STS18        86058      34188117
STS19        102882     33846511
STS2         84925      49969163
STS20        35235      11810061
STS3         70540      26667289
STS4         73628      37206645
STS5         6078       3576403
STS6         54177      31603126
STS7         54081      31788805
STS8         54235      31906296
STS9         55657      37682948
SYN1         48025      72256925
SYN2         29008      40027238
TSA1         3512       2884284
UNA1         214        116246
VRL1         72140      66577137
VRL10        67109      73162970
VRL11        6606       5253329
VRL2         70757      64880771
VRL3         73236      63241165
VRL4         69188      69918266
VRL5         21852      26846869
VRL6         57996      73467202
VRL7         62043      72851969
VRL8         68668      67359382
VRL9         55293      74508301
VRT1         24841      152302287
VRT10        8905       178255718
VRT11        3044       91574466
VRT12        13328      171079472
VRT13        5287       184104269
VRT14        4064       187572266
VRT15        64650      91979353
VRT16        79834      68745242
VRT17        74379      60801382
VRT2         40598      133488682
VRT3         33143      136193031
VRT4         37504      100111952
VRT5         72885      66795658
VRT6         31745      63557811
VRT7         19321      136610615
VRT8         1229       190515429
VRT9         1283       189841675

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 168.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

11725758 13255901864   Homo sapiens
7272337   8375177717   Mus musculus
1759359   6061264442   Rattus norvegicus
2087158   5243823410   Bos taurus
3771697   4902700435   Zea mays
2492407   3701037666   Sus scrofa
1592287   2997379279   Danio rerio
1207764   1535228811   Oryza sativa Japonica Group
228092    1352741094   Strongylocentrotus purpuratus
1422988   1146635741   Xenopus (Silurana) tropicalis
1674950   1143387586   Nicotiana tabacum
213019     996699045   Pan troglodytes
1432736    926659932   Canis lupus familiaris
783363     915969702   Drosophila melanogaster
2212733    914030499   Arabidopsis thaliana
650388     905817474   Vitis vinifera
804573     871708350   Gallus gallus
77498      804487478   Macaca mulatta
1216100    748117035   Ciona intestinalis
1771894    709407636   Glycine max

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          December 15 2008

                NCBI-GenBank Flat File Release 169.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 169.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev

User Support
	Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian, David Wheeler

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center