Release Notes For GenBank Release 170

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2009

               NCBI-GenBank Flat File Release 170.0

                    Distribution Release Notes

 101815678 loci, 101467270308 bases, from 101815678 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 170.0
1.2 Cutoff Date
1.3 Important Changes in Release 170.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 170.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 170.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 170.0, incorporates data available to the collaborating
databases as of February 13, 2009 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 170.0

1.3.1 Organizational changes

The total number of sequence data files increased by 34 with this release:

  - the BCT division is now composed of  38 files (+4)
  - the ENV division is now composed of  12 files (+1)
  - the EST division is now composed of 838 files (+16)
  - the GSS division is now composed of 322 files (+3)
  - the HTG division is now composed of 133 files (-1)
  - the PAT division is now composed of  65 files (+10)
  - the VRT division is now composed of  18 files (+1)

  Note that the HTG division has one less file than previously. Occasional
decreases like this are now possible, given a new method of flatfile
processing that was adopted in December 2008. Essentially, records within
a particular sequence file (eg, gbhtg134.seq) can become absorbed in a
different file, depending on the overall distribution of the number of
records in the files that make up a division. Such decreases are reviewed,
to ensure that they do not indicate a loss of release content.

In addition, the total number of index files increased by 3 with this release:

  - the AUT index is now composed of 65 files (+3)

1.3.2 New DBLINK linetype legal as of February 2009.

  The PROJECT linetype allows a sequence record to be linked to information
about the sequencing project that generated the data which ultimately
resulted in the record's submission to the International Nucleotide Sequence
Database ( INSD; see http://www.insdc.org ) .

  This complete bacterial GenBank record illustrates the use of the PROJECT
line:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471

  When viewed on the web in NCBI's Entrez:Nucleotide, the record's project
identifier (28471) links to an entry in the Genome Project Database (GPDB) :

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/sites/entrez?db=genomeprj&cmd=Retrieve&dopt=Overview&uid=28471

where information about the sequencing center, the bacterium, and other
GenBank records (eg, plasmids) associated with the sequencing project
can be found.

  Since the introduction of PROJECT, the scope of the "Genome Project"
Database has expanded, to include projects that are not necessarily targetted
to the sequencing of a complete genome.

  In addition, there can be other resources which underlie an INSD sequence
record, such as the Trace Assembly Archive at the NCBI:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/assembly/assmbrowser.cgi?cmd=show&f=tree&m=main&s=tree

  Because of the expanded scope of the GPDB, and because we anticipate a need
to link to more resources than just the GPDB, the PROJECT linetype is going to
be replaced by a new linetype:

   DBLINK

  With this release, the new DBLINK linetype is now legal for GenBank sequence
records, and it will begin to appear in GenBank Update files, soon after
GenBank 170.0 is made available.

  The Genome Project ID and the Trace Assembly Archive ID will be presented
via DBLINK, and the existing PROJECT line will continue to be displayed, as
illustrated in the below mock-up of CP000964 :

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

Note: Use of the Trace Assembly Archive is still in its early stages, so only
a few records are expected to have that type of DBLINK in the short term.

  For those who process sequence data in NCBI's ASN.1 format: The
underlying representation for (Genome) Project IDs will remain unchanged.
There will be no changes to the ASN.1 User-object that is used to store them:

    user {
      type
        str "GenomeProjectsDB" ,
      data {
        {
          label
            str "ProjectID" ,
          data
            int 28471 } ,
        {
          label
            str "ParentID" ,
          data
            int 0 } } } ,

  However, to support linkages to other resources, such as the Trace
Assembly Archive, a new "DBLink" User-object will be introduced:

    user {
      type
        str "DBLink" ,
      data {
        {
          label
            str "Trace Assembly Archive" ,
          data
            ints { 123456 } } } }

  As new types of linkages are established, they will be added to
the DBLink User-object, and displayed via the DBLINK linetype in
the GenBank flatfile format. 

  There is a possibility that the GenomeProjectsDB User-object
might someday be incorporated into the new DBLink User-object.
But at the moment, there are no firm plans to do so.

1.3.3 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
sixty-nine of the GSS flatfiles in Release 170.0. Consider gbgss254.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2009

                NCBI-GenBank Flat File Release 170.0

                           GSS Sequences (Part 1)

   87215 loci,    64322450 bases, from    87215 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "254" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 PROJECT linetype to be replaced by DBLINK (April 2009)

  The new DBLINK linetype has been introduced as of the February 2009
GenBank Release 170.0.

  Genome Project IDs and Trace Assembly Archive IDs can now be presented
via DBLINK, in conjunction with the legacy PROJECT linetype:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

PROJECT and DBLINK will co-exist for one GenBank release, until Release 171.0
(April 15, 2009), at which point the PROJECT line will be removed from the
flatfile format. In its final state, the above mock-up for CP000964 becomes:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

  In summary: The PROJECT linetype will be replaced by DBLINK as of GenBank
Release 171.0 in April 2009.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1812 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut7.idx - Index of the entries according to author name, part 7.
67. gbaut8.idx - Index of the entries according to author name, part 8.
68. gbaut9.idx - Index of the entries according to author name, part 9.
69. gbbct1.seq - Bacterial sequence entries, part 1.
70. gbbct10.seq - Bacterial sequence entries, part 10.
71. gbbct11.seq - Bacterial sequence entries, part 11.
72. gbbct12.seq - Bacterial sequence entries, part 12.
73. gbbct13.seq - Bacterial sequence entries, part 13.
74. gbbct14.seq - Bacterial sequence entries, part 14.
75. gbbct15.seq - Bacterial sequence entries, part 15.
76. gbbct16.seq - Bacterial sequence entries, part 16.
77. gbbct17.seq - Bacterial sequence entries, part 17.
78. gbbct18.seq - Bacterial sequence entries, part 18.
79. gbbct19.seq - Bacterial sequence entries, part 19.
80. gbbct2.seq - Bacterial sequence entries, part 2.
81. gbbct20.seq - Bacterial sequence entries, part 20.
82. gbbct21.seq - Bacterial sequence entries, part 21.
83. gbbct22.seq - Bacterial sequence entries, part 22.
84. gbbct23.seq - Bacterial sequence entries, part 23.
85. gbbct24.seq - Bacterial sequence entries, part 24.
86. gbbct25.seq - Bacterial sequence entries, part 25.
87. gbbct26.seq - Bacterial sequence entries, part 26.
88. gbbct27.seq - Bacterial sequence entries, part 27.
89. gbbct28.seq - Bacterial sequence entries, part 28.
90. gbbct29.seq - Bacterial sequence entries, part 29.
91. gbbct3.seq - Bacterial sequence entries, part 3.
92. gbbct30.seq - Bacterial sequence entries, part 30.
93. gbbct31.seq - Bacterial sequence entries, part 31.
94. gbbct32.seq - Bacterial sequence entries, part 32.
95. gbbct33.seq - Bacterial sequence entries, part 33.
96. gbbct34.seq - Bacterial sequence entries, part 34.
97. gbbct35.seq - Bacterial sequence entries, part 35.
98. gbbct36.seq - Bacterial sequence entries, part 36.
99. gbbct37.seq - Bacterial sequence entries, part 37.
100. gbbct38.seq - Bacterial sequence entries, part 38.
101. gbbct4.seq - Bacterial sequence entries, part 4.
102. gbbct5.seq - Bacterial sequence entries, part 5.
103. gbbct6.seq - Bacterial sequence entries, part 6.
104. gbbct7.seq - Bacterial sequence entries, part 7.
105. gbbct8.seq - Bacterial sequence entries, part 8.
106. gbbct9.seq - Bacterial sequence entries, part 9.
107. gbchg.txt - Accession numbers of entries updated since the previous release.
108. gbcon1.seq - Constructed sequence entries, part 1.
109. gbcon10.seq - Constructed sequence entries, part 10.
110. gbcon100.seq - Constructed sequence entries, part 100.
111. gbcon101.seq - Constructed sequence entries, part 101.
112. gbcon102.seq - Constructed sequence entries, part 102.
113. gbcon103.seq - Constructed sequence entries, part 103.
114. gbcon104.seq - Constructed sequence entries, part 104.
115. gbcon105.seq - Constructed sequence entries, part 105.
116. gbcon106.seq - Constructed sequence entries, part 106.
117. gbcon107.seq - Constructed sequence entries, part 107.
118. gbcon108.seq - Constructed sequence entries, part 108.
119. gbcon109.seq - Constructed sequence entries, part 109.
120. gbcon11.seq - Constructed sequence entries, part 11.
121. gbcon110.seq - Constructed sequence entries, part 110.
122. gbcon111.seq - Constructed sequence entries, part 111.
123. gbcon112.seq - Constructed sequence entries, part 112.
124. gbcon113.seq - Constructed sequence entries, part 113.
125. gbcon114.seq - Constructed sequence entries, part 114.
126. gbcon115.seq - Constructed sequence entries, part 115.
127. gbcon116.seq - Constructed sequence entries, part 116.
128. gbcon117.seq - Constructed sequence entries, part 117.
129. gbcon118.seq - Constructed sequence entries, part 118.
130. gbcon119.seq - Constructed sequence entries, part 119.
131. gbcon12.seq - Constructed sequence entries, part 12.
132. gbcon120.seq - Constructed sequence entries, part 120.
133. gbcon121.seq - Constructed sequence entries, part 121.
134. gbcon122.seq - Constructed sequence entries, part 122.
135. gbcon123.seq - Constructed sequence entries, part 123.
136. gbcon124.seq - Constructed sequence entries, part 124.
137. gbcon125.seq - Constructed sequence entries, part 125.
138. gbcon126.seq - Constructed sequence entries, part 126.
139. gbcon127.seq - Constructed sequence entries, part 127.
140. gbcon128.seq - Constructed sequence entries, part 128.
141. gbcon13.seq - Constructed sequence entries, part 13.
142. gbcon14.seq - Constructed sequence entries, part 14.
143. gbcon15.seq - Constructed sequence entries, part 15.
144. gbcon16.seq - Constructed sequence entries, part 16.
145. gbcon17.seq - Constructed sequence entries, part 17.
146. gbcon18.seq - Constructed sequence entries, part 18.
147. gbcon19.seq - Constructed sequence entries, part 19.
148. gbcon2.seq - Constructed sequence entries, part 2.
149. gbcon20.seq - Constructed sequence entries, part 20.
150. gbcon21.seq - Constructed sequence entries, part 21.
151. gbcon22.seq - Constructed sequence entries, part 22.
152. gbcon23.seq - Constructed sequence entries, part 23.
153. gbcon24.seq - Constructed sequence entries, part 24.
154. gbcon25.seq - Constructed sequence entries, part 25.
155. gbcon26.seq - Constructed sequence entries, part 26.
156. gbcon27.seq - Constructed sequence entries, part 27.
157. gbcon28.seq - Constructed sequence entries, part 28.
158. gbcon29.seq - Constructed sequence entries, part 29.
159. gbcon3.seq - Constructed sequence entries, part 3.
160. gbcon30.seq - Constructed sequence entries, part 30.
161. gbcon31.seq - Constructed sequence entries, part 31.
162. gbcon32.seq - Constructed sequence entries, part 32.
163. gbcon33.seq - Constructed sequence entries, part 33.
164. gbcon34.seq - Constructed sequence entries, part 34.
165. gbcon35.seq - Constructed sequence entries, part 35.
166. gbcon36.seq - Constructed sequence entries, part 36.
167. gbcon37.seq - Constructed sequence entries, part 37.
168. gbcon38.seq - Constructed sequence entries, part 38.
169. gbcon39.seq - Constructed sequence entries, part 39.
170. gbcon4.seq - Constructed sequence entries, part 4.
171. gbcon40.seq - Constructed sequence entries, part 40.
172. gbcon41.seq - Constructed sequence entries, part 41.
173. gbcon42.seq - Constructed sequence entries, part 42.
174. gbcon43.seq - Constructed sequence entries, part 43.
175. gbcon44.seq - Constructed sequence entries, part 44.
176. gbcon45.seq - Constructed sequence entries, part 45.
177. gbcon46.seq - Constructed sequence entries, part 46.
178. gbcon47.seq - Constructed sequence entries, part 47.
179. gbcon48.seq - Constructed sequence entries, part 48.
180. gbcon49.seq - Constructed sequence entries, part 49.
181. gbcon5.seq - Constructed sequence entries, part 5.
182. gbcon50.seq - Constructed sequence entries, part 50.
183. gbcon51.seq - Constructed sequence entries, part 51.
184. gbcon52.seq - Constructed sequence entries, part 52.
185. gbcon53.seq - Constructed sequence entries, part 53.
186. gbcon54.seq - Constructed sequence entries, part 54.
187. gbcon55.seq - Constructed sequence entries, part 55.
188. gbcon56.seq - Constructed sequence entries, part 56.
189. gbcon57.seq - Constructed sequence entries, part 57.
190. gbcon58.seq - Constructed sequence entries, part 58.
191. gbcon59.seq - Constructed sequence entries, part 59.
192. gbcon6.seq - Constructed sequence entries, part 6.
193. gbcon60.seq - Constructed sequence entries, part 60.
194. gbcon61.seq - Constructed sequence entries, part 61.
195. gbcon62.seq - Constructed sequence entries, part 62.
196. gbcon63.seq - Constructed sequence entries, part 63.
197. gbcon64.seq - Constructed sequence entries, part 64.
198. gbcon65.seq - Constructed sequence entries, part 65.
199. gbcon66.seq - Constructed sequence entries, part 66.
200. gbcon67.seq - Constructed sequence entries, part 67.
201. gbcon68.seq - Constructed sequence entries, part 68.
202. gbcon69.seq - Constructed sequence entries, part 69.
203. gbcon7.seq - Constructed sequence entries, part 7.
204. gbcon70.seq - Constructed sequence entries, part 70.
205. gbcon71.seq - Constructed sequence entries, part 71.
206. gbcon72.seq - Constructed sequence entries, part 72.
207. gbcon73.seq - Constructed sequence entries, part 73.
208. gbcon74.seq - Constructed sequence entries, part 74.
209. gbcon75.seq - Constructed sequence entries, part 75.
210. gbcon76.seq - Constructed sequence entries, part 76.
211. gbcon77.seq - Constructed sequence entries, part 77.
212. gbcon78.seq - Constructed sequence entries, part 78.
213. gbcon79.seq - Constructed sequence entries, part 79.
214. gbcon8.seq - Constructed sequence entries, part 8.
215. gbcon80.seq - Constructed sequence entries, part 80.
216. gbcon81.seq - Constructed sequence entries, part 81.
217. gbcon82.seq - Constructed sequence entries, part 82.
218. gbcon83.seq - Constructed sequence entries, part 83.
219. gbcon84.seq - Constructed sequence entries, part 84.
220. gbcon85.seq - Constructed sequence entries, part 85.
221. gbcon86.seq - Constructed sequence entries, part 86.
222. gbcon87.seq - Constructed sequence entries, part 87.
223. gbcon88.seq - Constructed sequence entries, part 88.
224. gbcon89.seq - Constructed sequence entries, part 89.
225. gbcon9.seq - Constructed sequence entries, part 9.
226. gbcon90.seq - Constructed sequence entries, part 90.
227. gbcon91.seq - Constructed sequence entries, part 91.
228. gbcon92.seq - Constructed sequence entries, part 92.
229. gbcon93.seq - Constructed sequence entries, part 93.
230. gbcon94.seq - Constructed sequence entries, part 94.
231. gbcon95.seq - Constructed sequence entries, part 95.
232. gbcon96.seq - Constructed sequence entries, part 96.
233. gbcon97.seq - Constructed sequence entries, part 97.
234. gbcon98.seq - Constructed sequence entries, part 98.
235. gbcon99.seq - Constructed sequence entries, part 99.
236. gbdel.txt - Accession numbers of entries deleted since the previous release.
237. gbenv1.seq - Environmental sampling sequence entries, part 1.
238. gbenv10.seq - Environmental sampling sequence entries, part 10.
239. gbenv11.seq - Environmental sampling sequence entries, part 11.
240. gbenv12.seq - Environmental sampling sequence entries, part 12.
241. gbenv2.seq - Environmental sampling sequence entries, part 2.
242. gbenv3.seq - Environmental sampling sequence entries, part 3.
243. gbenv4.seq - Environmental sampling sequence entries, part 4.
244. gbenv5.seq - Environmental sampling sequence entries, part 5.
245. gbenv6.seq - Environmental sampling sequence entries, part 6.
246. gbenv7.seq - Environmental sampling sequence entries, part 7.
247. gbenv8.seq - Environmental sampling sequence entries, part 8.
248. gbenv9.seq - Environmental sampling sequence entries, part 9.
249. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
250. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
251. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
252. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
253. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
254. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
255. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
256. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
257. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
258. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
259. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
260. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
261. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
262. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
263. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
264. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
265. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
266. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
267. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
268. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
269. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
270. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
271. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
272. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
273. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
274. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
275. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
276. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
277. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
278. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
279. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
280. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
281. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
282. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
283. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
284. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
285. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
286. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
287. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
288. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
289. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
290. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
291. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
292. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
293. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
294. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
295. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
296. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
297. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
298. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
299. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
300. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
301. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
302. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
303. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
304. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
305. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
306. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
307. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
308. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
309. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
310. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
311. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
312. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
313. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
314. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
315. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
316. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
317. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
318. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
319. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
320. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
321. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
322. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
323. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
324. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
325. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
326. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
327. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
328. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
329. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
330. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
331. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
332. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
333. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
334. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
335. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
336. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
337. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
338. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
339. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
340. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
341. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
342. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
343. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
344. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
345. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
346. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
347. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
348. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
349. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
350. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
351. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
352. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
353. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
354. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
355. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
356. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
357. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
358. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
359. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
360. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
361. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
362. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
363. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
364. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
365. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
366. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
367. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
368. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
369. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
370. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
371. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
372. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
373. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
374. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
375. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
376. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
377. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
378. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
379. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
380. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
381. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
382. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
383. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
384. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
385. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
386. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
387. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
388. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
389. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
390. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
391. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
392. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
393. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
394. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
395. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
396. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
397. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
398. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
399. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
400. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
401. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
402. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
403. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
404. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
405. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
406. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
407. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
408. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
409. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
410. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
411. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
412. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
413. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
414. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
415. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
416. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
417. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
418. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
419. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
420. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
421. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
422. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
423. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
424. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
425. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
426. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
427. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
428. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
429. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
430. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
431. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
432. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
433. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
434. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
435. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
436. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
437. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
438. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
439. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
440. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
441. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
442. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
443. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
444. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
445. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
446. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
447. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
448. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
449. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
450. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
451. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
452. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
453. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
454. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
455. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
456. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
457. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
458. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
459. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
460. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
461. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
462. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
463. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
464. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
465. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
466. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
467. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
468. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
469. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
470. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
471. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
472. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
473. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
474. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
475. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
476. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
477. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
478. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
479. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
480. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
481. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
482. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
483. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
484. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
485. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
486. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
487. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
488. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
489. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
490. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
491. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
492. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
493. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
494. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
495. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
496. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
497. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
498. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
499. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
500. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
501. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
502. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
503. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
504. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
505. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
506. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
507. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
508. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
509. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
510. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
511. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
512. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
513. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
514. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
515. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
516. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
517. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
518. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
519. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
520. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
521. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
522. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
523. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
524. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
525. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
526. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
527. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
528. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
529. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
530. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
531. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
532. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
533. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
534. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
535. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
536. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
537. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
538. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
539. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
540. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
541. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
542. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
543. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
544. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
545. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
546. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
547. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
548. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
549. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
550. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
551. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
552. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
553. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
554. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
555. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
556. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
557. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
558. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
559. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
560. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
561. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
562. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
563. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
564. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
565. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
566. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
567. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
568. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
569. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
570. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
571. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
572. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
573. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
574. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
575. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
576. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
577. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
578. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
579. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
580. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
581. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
582. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
583. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
584. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
585. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
586. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
587. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
588. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
589. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
590. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
591. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
592. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
593. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
594. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
595. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
596. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
597. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
598. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
599. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
600. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
601. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
602. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
603. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
604. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
605. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
606. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
607. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
608. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
609. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
610. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
611. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
612. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
613. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
614. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
615. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
616. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
617. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
618. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
619. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
620. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
621. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
622. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
623. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
624. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
625. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
626. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
627. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
628. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
629. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
630. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
631. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
632. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
633. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
634. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
635. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
636. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
637. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
638. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
639. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
640. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
641. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
642. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
643. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
644. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
645. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
646. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
647. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
648. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
649. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
650. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
651. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
652. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
653. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
654. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
655. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
656. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
657. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
658. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
659. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
660. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
661. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
662. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
663. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
664. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
665. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
666. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
667. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
668. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
669. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
670. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
671. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
672. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
673. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
674. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
675. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
676. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
677. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
678. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
679. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
680. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
681. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
682. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
683. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
684. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
685. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
686. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
687. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
688. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
689. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
690. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
691. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
692. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
693. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
694. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
695. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
696. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
697. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
698. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
699. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
700. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
701. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
702. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
703. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
704. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
705. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
706. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
707. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
708. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
709. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
710. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
711. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
712. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
713. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
714. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
715. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
716. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
717. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
718. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
719. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
720. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
721. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
722. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
723. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
724. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
725. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
726. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
727. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
728. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
729. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
730. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
731. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
732. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
733. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
734. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
735. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
736. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
737. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
738. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
739. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
740. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
741. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
742. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
743. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
744. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
745. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
746. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
747. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
748. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
749. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
750. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
751. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
752. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
753. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
754. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
755. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
756. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
757. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
758. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
759. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
760. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
761. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
762. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
763. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
764. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
765. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
766. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
767. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
768. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
769. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
770. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
771. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
772. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
773. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
774. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
775. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
776. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
777. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
778. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
779. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
780. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
781. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
782. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
783. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
784. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
785. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
786. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
787. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
788. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
789. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
790. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
791. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
792. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
793. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
794. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
795. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
796. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
797. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
798. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
799. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
800. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
801. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
802. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
803. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
804. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
805. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
806. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
807. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
808. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
809. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
810. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
811. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
812. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
813. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
814. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
815. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
816. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
817. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
818. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
819. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
820. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
821. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
822. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
823. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
824. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
825. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
826. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
827. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
828. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
829. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
830. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
831. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
832. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
833. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
834. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
835. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
836. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
837. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
838. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
839. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
840. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
841. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
842. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
843. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
844. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
845. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
846. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
847. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
848. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
849. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
850. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
851. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
852. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
853. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
854. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
855. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
856. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
857. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
858. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
859. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
860. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
861. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
862. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
863. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
864. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
865. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
866. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
867. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
868. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
869. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
870. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
871. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
872. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
873. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
874. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
875. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
876. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
877. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
878. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
879. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
880. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
881. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
882. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
883. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
884. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
885. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
886. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
887. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
888. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
889. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
890. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
891. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
892. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
893. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
894. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
895. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
896. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
897. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
898. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
899. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
900. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
901. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
902. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
903. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
904. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
905. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
906. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
907. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
908. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
909. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
910. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
911. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
912. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
913. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
914. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
915. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
916. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
917. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
918. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
919. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
920. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
921. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
922. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
923. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
924. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
925. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
926. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
927. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
928. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
929. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
930. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
931. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
932. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
933. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
934. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
935. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
936. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
937. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
938. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
939. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
940. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
941. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
942. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
943. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
944. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
945. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
946. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
947. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
948. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
949. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
950. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
951. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
952. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
953. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
954. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
955. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
956. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
957. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
958. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
959. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
960. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
961. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
962. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
963. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
964. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
965. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
966. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
967. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
968. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
969. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
970. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
971. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
972. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
973. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
974. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
975. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
976. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
977. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
978. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
979. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
980. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
981. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
982. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
983. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
984. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
985. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
986. gbest763.seq - EST (expressed sequence tag) sequence entries, part 763.
987. gbest764.seq - EST (expressed sequence tag) sequence entries, part 764.
988. gbest765.seq - EST (expressed sequence tag) sequence entries, part 765.
989. gbest766.seq - EST (expressed sequence tag) sequence entries, part 766.
990. gbest767.seq - EST (expressed sequence tag) sequence entries, part 767.
991. gbest768.seq - EST (expressed sequence tag) sequence entries, part 768.
992. gbest769.seq - EST (expressed sequence tag) sequence entries, part 769.
993. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
994. gbest770.seq - EST (expressed sequence tag) sequence entries, part 770.
995. gbest771.seq - EST (expressed sequence tag) sequence entries, part 771.
996. gbest772.seq - EST (expressed sequence tag) sequence entries, part 772.
997. gbest773.seq - EST (expressed sequence tag) sequence entries, part 773.
998. gbest774.seq - EST (expressed sequence tag) sequence entries, part 774.
999. gbest775.seq - EST (expressed sequence tag) sequence entries, part 775.
1000. gbest776.seq - EST (expressed sequence tag) sequence entries, part 776.
1001. gbest777.seq - EST (expressed sequence tag) sequence entries, part 777.
1002. gbest778.seq - EST (expressed sequence tag) sequence entries, part 778.
1003. gbest779.seq - EST (expressed sequence tag) sequence entries, part 779.
1004. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1005. gbest780.seq - EST (expressed sequence tag) sequence entries, part 780.
1006. gbest781.seq - EST (expressed sequence tag) sequence entries, part 781.
1007. gbest782.seq - EST (expressed sequence tag) sequence entries, part 782.
1008. gbest783.seq - EST (expressed sequence tag) sequence entries, part 783.
1009. gbest784.seq - EST (expressed sequence tag) sequence entries, part 784.
1010. gbest785.seq - EST (expressed sequence tag) sequence entries, part 785.
1011. gbest786.seq - EST (expressed sequence tag) sequence entries, part 786.
1012. gbest787.seq - EST (expressed sequence tag) sequence entries, part 787.
1013. gbest788.seq - EST (expressed sequence tag) sequence entries, part 788.
1014. gbest789.seq - EST (expressed sequence tag) sequence entries, part 789.
1015. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1016. gbest790.seq - EST (expressed sequence tag) sequence entries, part 790.
1017. gbest791.seq - EST (expressed sequence tag) sequence entries, part 791.
1018. gbest792.seq - EST (expressed sequence tag) sequence entries, part 792.
1019. gbest793.seq - EST (expressed sequence tag) sequence entries, part 793.
1020. gbest794.seq - EST (expressed sequence tag) sequence entries, part 794.
1021. gbest795.seq - EST (expressed sequence tag) sequence entries, part 795.
1022. gbest796.seq - EST (expressed sequence tag) sequence entries, part 796.
1023. gbest797.seq - EST (expressed sequence tag) sequence entries, part 797.
1024. gbest798.seq - EST (expressed sequence tag) sequence entries, part 798.
1025. gbest799.seq - EST (expressed sequence tag) sequence entries, part 799.
1026. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1027. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1028. gbest800.seq - EST (expressed sequence tag) sequence entries, part 800.
1029. gbest801.seq - EST (expressed sequence tag) sequence entries, part 801.
1030. gbest802.seq - EST (expressed sequence tag) sequence entries, part 802.
1031. gbest803.seq - EST (expressed sequence tag) sequence entries, part 803.
1032. gbest804.seq - EST (expressed sequence tag) sequence entries, part 804.
1033. gbest805.seq - EST (expressed sequence tag) sequence entries, part 805.
1034. gbest806.seq - EST (expressed sequence tag) sequence entries, part 806.
1035. gbest807.seq - EST (expressed sequence tag) sequence entries, part 807.
1036. gbest808.seq - EST (expressed sequence tag) sequence entries, part 808.
1037. gbest809.seq - EST (expressed sequence tag) sequence entries, part 809.
1038. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1039. gbest810.seq - EST (expressed sequence tag) sequence entries, part 810.
1040. gbest811.seq - EST (expressed sequence tag) sequence entries, part 811.
1041. gbest812.seq - EST (expressed sequence tag) sequence entries, part 812.
1042. gbest813.seq - EST (expressed sequence tag) sequence entries, part 813.
1043. gbest814.seq - EST (expressed sequence tag) sequence entries, part 814.
1044. gbest815.seq - EST (expressed sequence tag) sequence entries, part 815.
1045. gbest816.seq - EST (expressed sequence tag) sequence entries, part 816.
1046. gbest817.seq - EST (expressed sequence tag) sequence entries, part 817.
1047. gbest818.seq - EST (expressed sequence tag) sequence entries, part 818.
1048. gbest819.seq - EST (expressed sequence tag) sequence entries, part 819.
1049. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1050. gbest820.seq - EST (expressed sequence tag) sequence entries, part 820.
1051. gbest821.seq - EST (expressed sequence tag) sequence entries, part 821.
1052. gbest822.seq - EST (expressed sequence tag) sequence entries, part 822.
1053. gbest823.seq - EST (expressed sequence tag) sequence entries, part 823.
1054. gbest824.seq - EST (expressed sequence tag) sequence entries, part 824.
1055. gbest825.seq - EST (expressed sequence tag) sequence entries, part 825.
1056. gbest826.seq - EST (expressed sequence tag) sequence entries, part 826.
1057. gbest827.seq - EST (expressed sequence tag) sequence entries, part 827.
1058. gbest828.seq - EST (expressed sequence tag) sequence entries, part 828.
1059. gbest829.seq - EST (expressed sequence tag) sequence entries, part 829.
1060. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1061. gbest830.seq - EST (expressed sequence tag) sequence entries, part 830.
1062. gbest831.seq - EST (expressed sequence tag) sequence entries, part 831.
1063. gbest832.seq - EST (expressed sequence tag) sequence entries, part 832.
1064. gbest833.seq - EST (expressed sequence tag) sequence entries, part 833.
1065. gbest834.seq - EST (expressed sequence tag) sequence entries, part 834.
1066. gbest835.seq - EST (expressed sequence tag) sequence entries, part 835.
1067. gbest836.seq - EST (expressed sequence tag) sequence entries, part 836.
1068. gbest837.seq - EST (expressed sequence tag) sequence entries, part 837.
1069. gbest838.seq - EST (expressed sequence tag) sequence entries, part 838.
1070. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1071. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1072. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1073. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1074. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1075. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1076. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1077. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1078. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1079. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1080. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1081. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1082. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1083. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1084. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1085. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1086. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1087. gbgen.idx - Index of the entries according to gene symbols.
1088. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1089. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1090. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1091. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1092. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1093. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1094. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1095. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1096. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1097. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1098. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1099. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1100. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1101. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1102. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1103. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1104. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1105. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1106. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1107. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1108. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1109. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1110. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1111. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1112. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1113. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1114. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1115. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1116. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1117. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1118. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1119. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1120. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1121. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1122. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1123. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1124. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1125. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1126. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1127. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1128. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1129. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1130. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1131. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1132. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1133. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1134. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1135. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1136. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1137. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1138. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1139. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1140. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1141. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1142. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1143. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1144. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1145. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1146. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1147. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1148. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1149. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1150. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1151. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1152. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1153. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1154. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1155. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1156. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1157. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1158. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1159. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1160. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1161. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1162. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1163. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1164. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1165. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1166. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1167. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1168. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1169. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1170. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1171. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1172. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1173. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1174. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1175. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1176. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1177. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1178. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1179. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1180. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1181. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1182. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1183. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1184. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1185. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1186. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1187. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1188. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1189. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1190. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1191. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1192. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1193. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1194. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1195. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1196. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1197. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1198. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1199. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1200. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1201. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1202. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1203. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1204. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1205. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1206. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1207. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1208. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1209. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1210. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1211. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1212. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1213. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1214. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1215. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1216. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1217. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1218. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1219. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1220. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1221. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1222. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1223. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1224. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1225. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1226. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1227. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1228. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1229. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1230. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1231. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1232. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1233. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1234. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1235. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1236. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1237. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1238. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1239. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1240. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1241. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1242. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1243. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1244. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1245. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1246. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1247. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1248. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1249. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1250. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1251. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1252. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1253. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1254. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1255. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1256. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1257. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1258. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1259. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1260. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1261. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1262. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1263. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1264. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1265. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1266. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1267. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1268. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1269. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1270. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1271. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1272. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1273. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1274. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1275. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1276. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1277. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1278. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1279. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1280. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1281. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1282. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1283. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1284. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1285. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1286. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1287. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1288. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1289. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1290. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1291. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1292. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1293. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1294. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1295. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1296. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1297. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1298. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1299. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1300. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1301. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1302. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1303. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1304. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1305. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1306. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1307. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1308. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1309. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1310. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1311. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1312. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1313. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1314. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1315. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1316. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1317. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1318. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1319. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1320. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1321. gbgss309.seq - GSS (genome survey sequence) sequence entries, part 309.
1322. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1323. gbgss310.seq - GSS (genome survey sequence) sequence entries, part 310.
1324. gbgss311.seq - GSS (genome survey sequence) sequence entries, part 311.
1325. gbgss312.seq - GSS (genome survey sequence) sequence entries, part 312.
1326. gbgss313.seq - GSS (genome survey sequence) sequence entries, part 313.
1327. gbgss314.seq - GSS (genome survey sequence) sequence entries, part 314.
1328. gbgss315.seq - GSS (genome survey sequence) sequence entries, part 315.
1329. gbgss316.seq - GSS (genome survey sequence) sequence entries, part 316.
1330. gbgss317.seq - GSS (genome survey sequence) sequence entries, part 317.
1331. gbgss318.seq - GSS (genome survey sequence) sequence entries, part 318.
1332. gbgss319.seq - GSS (genome survey sequence) sequence entries, part 319.
1333. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1334. gbgss320.seq - GSS (genome survey sequence) sequence entries, part 320.
1335. gbgss321.seq - GSS (genome survey sequence) sequence entries, part 321.
1336. gbgss322.seq - GSS (genome survey sequence) sequence entries, part 322.
1337. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1338. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1339. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1340. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1341. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1342. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1343. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1344. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1345. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1346. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1347. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1348. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1349. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1350. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1351. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1352. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1353. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1354. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1355. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1356. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1357. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1358. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1359. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1360. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1361. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1362. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1363. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1364. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1365. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1366. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1367. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1368. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1369. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1370. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1371. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1372. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1373. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1374. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1375. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1376. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1377. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1378. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1379. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1380. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1381. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1382. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1383. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1384. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1385. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1386. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1387. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1388. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1389. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1390. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1391. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1392. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1393. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1394. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1395. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1396. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1397. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1398. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1399. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1400. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1401. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1402. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1403. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1404. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1405. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1406. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1407. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1408. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1409. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1410. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1411. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1412. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1413. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1414. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1415. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1416. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1417. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1418. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1419. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1420. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1421. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1422. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1423. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1424. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1425. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1426. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1427. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1428. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1429. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1430. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1431. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1432. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1433. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1434. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1435. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1436. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1437. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1438. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1439. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1440. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1441. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1442. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1443. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1444. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1445. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1446. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1447. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1448. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1449. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1450. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1451. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1452. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1453. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1454. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1455. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1456. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1457. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1458. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1459. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1460. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1461. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1462. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1463. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1464. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1465. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1466. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1467. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1468. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1469. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1470. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1471. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1472. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1473. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1474. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1475. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1476. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1477. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1478. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1479. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1480. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1481. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1482. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1483. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1484. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1485. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1486. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1487. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1488. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1489. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1490. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1491. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1492. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1493. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1494. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1495. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1496. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1497. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1498. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1499. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1500. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1501. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1502. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1503. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1504. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1505. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1506. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1507. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1508. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1509. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1510. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1511. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1512. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1513. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1514. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1515. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1516. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1517. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1518. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1519. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1520. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1521. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1522. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1523. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1524. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1525. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1526. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1527. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1528. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1529. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1530. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1531. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1532. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1533. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1534. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1535. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1536. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1537. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1538. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1539. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1540. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1541. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1542. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1543. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1544. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1545. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1546. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1547. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1548. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1549. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1550. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1551. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1552. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1553. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1554. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1555. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1556. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1557. gbinv1.seq - Invertebrate sequence entries, part 1.
1558. gbinv10.seq - Invertebrate sequence entries, part 10.
1559. gbinv11.seq - Invertebrate sequence entries, part 11.
1560. gbinv12.seq - Invertebrate sequence entries, part 12.
1561. gbinv13.seq - Invertebrate sequence entries, part 13.
1562. gbinv14.seq - Invertebrate sequence entries, part 14.
1563. gbinv2.seq - Invertebrate sequence entries, part 2.
1564. gbinv3.seq - Invertebrate sequence entries, part 3.
1565. gbinv4.seq - Invertebrate sequence entries, part 4.
1566. gbinv5.seq - Invertebrate sequence entries, part 5.
1567. gbinv6.seq - Invertebrate sequence entries, part 6.
1568. gbinv7.seq - Invertebrate sequence entries, part 7.
1569. gbinv8.seq - Invertebrate sequence entries, part 8.
1570. gbinv9.seq - Invertebrate sequence entries, part 9.
1571. gbjou1.idx - Index of the entries according to journal citation, part 1.
1572. gbjou2.idx - Index of the entries according to journal citation, part 2.
1573. gbjou3.idx - Index of the entries according to journal citation, part 3.
1574. gbjou4.idx - Index of the entries according to journal citation, part 4.
1575. gbjou5.idx - Index of the entries according to journal citation, part 5.
1576. gbjou6.idx - Index of the entries according to journal citation, part 6.
1577. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1578. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1579. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1580. gbmam1.seq - Other mammalian sequence entries, part 1.
1581. gbmam2.seq - Other mammalian sequence entries, part 2.
1582. gbmam3.seq - Other mammalian sequence entries, part 3.
1583. gbmam4.seq - Other mammalian sequence entries, part 4.
1584. gbnew.txt - Accession numbers of entries new since the previous release.
1585. gbpat1.seq - Patent sequence entries, part 1.
1586. gbpat10.seq - Patent sequence entries, part 10.
1587. gbpat11.seq - Patent sequence entries, part 11.
1588. gbpat12.seq - Patent sequence entries, part 12.
1589. gbpat13.seq - Patent sequence entries, part 13.
1590. gbpat14.seq - Patent sequence entries, part 14.
1591. gbpat15.seq - Patent sequence entries, part 15.
1592. gbpat16.seq - Patent sequence entries, part 16.
1593. gbpat17.seq - Patent sequence entries, part 17.
1594. gbpat18.seq - Patent sequence entries, part 18.
1595. gbpat19.seq - Patent sequence entries, part 19.
1596. gbpat2.seq - Patent sequence entries, part 2.
1597. gbpat20.seq - Patent sequence entries, part 20.
1598. gbpat21.seq - Patent sequence entries, part 21.
1599. gbpat22.seq - Patent sequence entries, part 22.
1600. gbpat23.seq - Patent sequence entries, part 23.
1601. gbpat24.seq - Patent sequence entries, part 24.
1602. gbpat25.seq - Patent sequence entries, part 25.
1603. gbpat26.seq - Patent sequence entries, part 26.
1604. gbpat27.seq - Patent sequence entries, part 27.
1605. gbpat28.seq - Patent sequence entries, part 28.
1606. gbpat29.seq - Patent sequence entries, part 29.
1607. gbpat3.seq - Patent sequence entries, part 3.
1608. gbpat30.seq - Patent sequence entries, part 30.
1609. gbpat31.seq - Patent sequence entries, part 31.
1610. gbpat32.seq - Patent sequence entries, part 32.
1611. gbpat33.seq - Patent sequence entries, part 33.
1612. gbpat34.seq - Patent sequence entries, part 34.
1613. gbpat35.seq - Patent sequence entries, part 35.
1614. gbpat36.seq - Patent sequence entries, part 36.
1615. gbpat37.seq - Patent sequence entries, part 37.
1616. gbpat38.seq - Patent sequence entries, part 38.
1617. gbpat39.seq - Patent sequence entries, part 39.
1618. gbpat4.seq - Patent sequence entries, part 4.
1619. gbpat40.seq - Patent sequence entries, part 40.
1620. gbpat41.seq - Patent sequence entries, part 41.
1621. gbpat42.seq - Patent sequence entries, part 42.
1622. gbpat43.seq - Patent sequence entries, part 43.
1623. gbpat44.seq - Patent sequence entries, part 44.
1624. gbpat45.seq - Patent sequence entries, part 45.
1625. gbpat46.seq - Patent sequence entries, part 46.
1626. gbpat47.seq - Patent sequence entries, part 47.
1627. gbpat48.seq - Patent sequence entries, part 48.
1628. gbpat49.seq - Patent sequence entries, part 49.
1629. gbpat5.seq - Patent sequence entries, part 5.
1630. gbpat50.seq - Patent sequence entries, part 50.
1631. gbpat51.seq - Patent sequence entries, part 51.
1632. gbpat52.seq - Patent sequence entries, part 52.
1633. gbpat53.seq - Patent sequence entries, part 53.
1634. gbpat54.seq - Patent sequence entries, part 54.
1635. gbpat55.seq - Patent sequence entries, part 55.
1636. gbpat56.seq - Patent sequence entries, part 56.
1637. gbpat57.seq - Patent sequence entries, part 57.
1638. gbpat58.seq - Patent sequence entries, part 58.
1639. gbpat59.seq - Patent sequence entries, part 59.
1640. gbpat6.seq - Patent sequence entries, part 6.
1641. gbpat60.seq - Patent sequence entries, part 60.
1642. gbpat61.seq - Patent sequence entries, part 61.
1643. gbpat62.seq - Patent sequence entries, part 62.
1644. gbpat63.seq - Patent sequence entries, part 63.
1645. gbpat64.seq - Patent sequence entries, part 64.
1646. gbpat65.seq - Patent sequence entries, part 65.
1647. gbpat7.seq - Patent sequence entries, part 7.
1648. gbpat8.seq - Patent sequence entries, part 8.
1649. gbpat9.seq - Patent sequence entries, part 9.
1650. gbphg1.seq - Phage sequence entries, part 1.
1651. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1652. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1653. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1654. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1655. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1656. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1657. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1658. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1659. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1660. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1661. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1662. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1663. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1664. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1665. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1666. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1667. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1668. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1669. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1670. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1671. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1672. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1673. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1674. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1675. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1676. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1677. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1678. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1679. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1680. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1681. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1682. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1683. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1684. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1685. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1686. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1687. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1688. gbpri1.seq - Primate sequence entries, part 1.
1689. gbpri10.seq - Primate sequence entries, part 10.
1690. gbpri11.seq - Primate sequence entries, part 11.
1691. gbpri12.seq - Primate sequence entries, part 12.
1692. gbpri13.seq - Primate sequence entries, part 13.
1693. gbpri14.seq - Primate sequence entries, part 14.
1694. gbpri15.seq - Primate sequence entries, part 15.
1695. gbpri16.seq - Primate sequence entries, part 16.
1696. gbpri17.seq - Primate sequence entries, part 17.
1697. gbpri18.seq - Primate sequence entries, part 18.
1698. gbpri19.seq - Primate sequence entries, part 19.
1699. gbpri2.seq - Primate sequence entries, part 2.
1700. gbpri20.seq - Primate sequence entries, part 20.
1701. gbpri21.seq - Primate sequence entries, part 21.
1702. gbpri22.seq - Primate sequence entries, part 22.
1703. gbpri23.seq - Primate sequence entries, part 23.
1704. gbpri24.seq - Primate sequence entries, part 24.
1705. gbpri25.seq - Primate sequence entries, part 25.
1706. gbpri26.seq - Primate sequence entries, part 26.
1707. gbpri27.seq - Primate sequence entries, part 27.
1708. gbpri28.seq - Primate sequence entries, part 28.
1709. gbpri29.seq - Primate sequence entries, part 29.
1710. gbpri3.seq - Primate sequence entries, part 3.
1711. gbpri30.seq - Primate sequence entries, part 30.
1712. gbpri31.seq - Primate sequence entries, part 31.
1713. gbpri32.seq - Primate sequence entries, part 32.
1714. gbpri33.seq - Primate sequence entries, part 33.
1715. gbpri34.seq - Primate sequence entries, part 34.
1716. gbpri35.seq - Primate sequence entries, part 35.
1717. gbpri36.seq - Primate sequence entries, part 36.
1718. gbpri37.seq - Primate sequence entries, part 37.
1719. gbpri38.seq - Primate sequence entries, part 38.
1720. gbpri39.seq - Primate sequence entries, part 39.
1721. gbpri4.seq - Primate sequence entries, part 4.
1722. gbpri5.seq - Primate sequence entries, part 5.
1723. gbpri6.seq - Primate sequence entries, part 6.
1724. gbpri7.seq - Primate sequence entries, part 7.
1725. gbpri8.seq - Primate sequence entries, part 8.
1726. gbpri9.seq - Primate sequence entries, part 9.
1727. gbrel.txt - Release notes (this document).
1728. gbrod1.seq - Rodent sequence entries, part 1.
1729. gbrod10.seq - Rodent sequence entries, part 10.
1730. gbrod11.seq - Rodent sequence entries, part 11.
1731. gbrod12.seq - Rodent sequence entries, part 12.
1732. gbrod13.seq - Rodent sequence entries, part 13.
1733. gbrod14.seq - Rodent sequence entries, part 14.
1734. gbrod15.seq - Rodent sequence entries, part 15.
1735. gbrod16.seq - Rodent sequence entries, part 16.
1736. gbrod17.seq - Rodent sequence entries, part 17.
1737. gbrod18.seq - Rodent sequence entries, part 18.
1738. gbrod19.seq - Rodent sequence entries, part 19.
1739. gbrod2.seq - Rodent sequence entries, part 2.
1740. gbrod20.seq - Rodent sequence entries, part 20.
1741. gbrod21.seq - Rodent sequence entries, part 21.
1742. gbrod22.seq - Rodent sequence entries, part 22.
1743. gbrod23.seq - Rodent sequence entries, part 23.
1744. gbrod24.seq - Rodent sequence entries, part 24.
1745. gbrod25.seq - Rodent sequence entries, part 25.
1746. gbrod26.seq - Rodent sequence entries, part 26.
1747. gbrod27.seq - Rodent sequence entries, part 27.
1748. gbrod28.seq - Rodent sequence entries, part 28.
1749. gbrod3.seq - Rodent sequence entries, part 3.
1750. gbrod4.seq - Rodent sequence entries, part 4.
1751. gbrod5.seq - Rodent sequence entries, part 5.
1752. gbrod6.seq - Rodent sequence entries, part 6.
1753. gbrod7.seq - Rodent sequence entries, part 7.
1754. gbrod8.seq - Rodent sequence entries, part 8.
1755. gbrod9.seq - Rodent sequence entries, part 9.
1756. gbsdr1.txt - Short directory of the data bank, part 1.
1757. gbsdr2.txt - Short directory of the data bank, part 2.
1758. gbsdr3.txt - Short directory of the data bank, part 3.
1759. gbsec.idx - Index of the entries according to secondary accession number.
1760. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1761. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1762. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1763. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1764. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1765. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1766. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1767. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1768. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1769. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1770. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1771. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1772. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1773. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1774. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1775. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1776. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1777. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1778. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1779. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1780. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1781. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1782. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1783. gbuna1.seq - Unannotated sequence entries, part 1.
1784. gbvrl1.seq - Viral sequence entries, part 1.
1785. gbvrl10.seq - Viral sequence entries, part 10.
1786. gbvrl11.seq - Viral sequence entries, part 11.
1787. gbvrl2.seq - Viral sequence entries, part 2.
1788. gbvrl3.seq - Viral sequence entries, part 3.
1789. gbvrl4.seq - Viral sequence entries, part 4.
1790. gbvrl5.seq - Viral sequence entries, part 5.
1791. gbvrl6.seq - Viral sequence entries, part 6.
1792. gbvrl7.seq - Viral sequence entries, part 7.
1793. gbvrl8.seq - Viral sequence entries, part 8.
1794. gbvrl9.seq - Viral sequence entries, part 9.
1795. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1796. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1797. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1798. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1799. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1800. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1801. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1802. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1803. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1804. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1805. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1806. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1807. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1808. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1809. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1810. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1811. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1812. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 170.0 flatfiles require roughly 390 GB (sequence
files only) or 417 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 941698825     gbacc1.idx
1984149099     gbacc2.idx
 641398698     gbacc3.idx
 184417836     gbaut1.idx
 184033012     gbaut10.idx
 185240739     gbaut11.idx
 191893062     gbaut12.idx
 201444781     gbaut13.idx
 214439857     gbaut14.idx
 186270129     gbaut15.idx
 187901211     gbaut16.idx
 185421139     gbaut17.idx
 184479744     gbaut18.idx
 185360492     gbaut19.idx
 190872745     gbaut2.idx
 183975289     gbaut20.idx
 183884745     gbaut21.idx
 210509435     gbaut22.idx
 185600360     gbaut23.idx
 185255390     gbaut24.idx
 190284348     gbaut25.idx
 192431938     gbaut26.idx
 200356673     gbaut27.idx
 186041334     gbaut28.idx
 186286366     gbaut29.idx
 184031400     gbaut3.idx
 187872580     gbaut30.idx
 212373590     gbaut31.idx
 223186992     gbaut32.idx
 193778816     gbaut33.idx
 184385536     gbaut34.idx
 228218989     gbaut35.idx
 184807005     gbaut36.idx
 190909364     gbaut37.idx
 191722518     gbaut38.idx
 190528538     gbaut39.idx
 186578242     gbaut4.idx
 186153073     gbaut40.idx
 183650168     gbaut41.idx
 183656698     gbaut42.idx
 184987961     gbaut43.idx
 188346167     gbaut44.idx
 184894314     gbaut45.idx
 183826013     gbaut46.idx
 192797869     gbaut47.idx
 184064973     gbaut48.idx
 184767994     gbaut49.idx
 186537885     gbaut5.idx
 184047231     gbaut50.idx
 216464283     gbaut51.idx
 231408338     gbaut52.idx
 254024543     gbaut53.idx
 183839860     gbaut54.idx
 183964962     gbaut55.idx
 184229957     gbaut56.idx
 225217510     gbaut57.idx
 199316131     gbaut58.idx
 183679553     gbaut59.idx
 187890993     gbaut6.idx
 240030965     gbaut60.idx
 253678875     gbaut61.idx
 208238385     gbaut62.idx
 183867601     gbaut63.idx
 215481465     gbaut64.idx
  16310775     gbaut65.idx
 185993196     gbaut7.idx
 225642090     gbaut8.idx
 211023658     gbaut9.idx
 249759750     gbbct1.seq
 212608769     gbbct10.seq
 241463337     gbbct11.seq
 244308326     gbbct12.seq
 244185740     gbbct13.seq
 248585632     gbbct14.seq
 242982902     gbbct15.seq
 242184272     gbbct16.seq
 237744191     gbbct17.seq
 239640300     gbbct18.seq
 217727648     gbbct19.seq
 249271814     gbbct2.seq
 242657586     gbbct20.seq
 239948148     gbbct21.seq
 248569286     gbbct22.seq
 247733377     gbbct23.seq
 249347128     gbbct24.seq
 245887416     gbbct25.seq
 246402491     gbbct26.seq
 249850794     gbbct27.seq
 246300589     gbbct28.seq
 249436500     gbbct29.seq
 246344480     gbbct3.seq
 243271235     gbbct30.seq
 244548575     gbbct31.seq
 246289648     gbbct32.seq
 165735637     gbbct33.seq
  86117376     gbbct34.seq
 168609042     gbbct35.seq
 249998475     gbbct36.seq
 250000221     gbbct37.seq
  77065038     gbbct38.seq
 249999104     gbbct4.seq
 103766579     gbbct5.seq
 249570729     gbbct6.seq
 238149239     gbbct7.seq
 244352542     gbbct8.seq
 245683759     gbbct9.seq
  20565282     gbchg.txt
 249980488     gbcon1.seq
 249991673     gbcon10.seq
 249994369     gbcon100.seq
 249994433     gbcon101.seq
 157277663     gbcon102.seq
 249994644     gbcon103.seq
 249998690     gbcon104.seq
 249973265     gbcon105.seq
 249998706     gbcon106.seq
 172119252     gbcon107.seq
 249999975     gbcon108.seq
 249999369     gbcon109.seq
 248844619     gbcon11.seq
 249999268     gbcon110.seq
 249999428     gbcon111.seq
 108281033     gbcon112.seq
 249999162     gbcon113.seq
 249998964     gbcon114.seq
 249998009     gbcon115.seq
 247878001     gbcon116.seq
 249998642     gbcon117.seq
 108430983     gbcon118.seq
 249999594     gbcon119.seq
 249801494     gbcon12.seq
 249999385     gbcon120.seq
 249998786     gbcon121.seq
 249998646     gbcon122.seq
 122840389     gbcon123.seq
 249999949     gbcon124.seq
 249999554     gbcon125.seq
 249999546     gbcon126.seq
 249998879     gbcon127.seq
 118438535     gbcon128.seq
 228205810     gbcon13.seq
 250000199     gbcon14.seq
 249999542     gbcon15.seq
 106822282     gbcon16.seq
 249994324     gbcon17.seq
 249969288     gbcon18.seq
 108377660     gbcon19.seq
 249775099     gbcon2.seq
 249998391     gbcon20.seq
  87602297     gbcon21.seq
 249998105     gbcon22.seq
 249713516     gbcon23.seq
 249999534     gbcon24.seq
 249999066     gbcon25.seq
 192293216     gbcon26.seq
 249999207     gbcon27.seq
 249997328     gbcon28.seq
 249999631     gbcon29.seq
 249960341     gbcon3.seq
 249999692     gbcon30.seq
 249817371     gbcon31.seq
 176767802     gbcon32.seq
 249996991     gbcon33.seq
 249998196     gbcon34.seq
 249995927     gbcon35.seq
 249997083     gbcon36.seq
 249994783     gbcon37.seq
 249995520     gbcon38.seq
  62365932     gbcon39.seq
 248147847     gbcon4.seq
 249995165     gbcon40.seq
 249995523     gbcon41.seq
 249995997     gbcon42.seq
 249998287     gbcon43.seq
 249997419     gbcon44.seq
  44061479     gbcon45.seq
 249994534     gbcon46.seq
 249999682     gbcon47.seq
 249999450     gbcon48.seq
 249996981     gbcon49.seq
 249993821     gbcon5.seq
 249999819     gbcon50.seq
  37366136     gbcon51.seq
 249994793     gbcon52.seq
 249997146     gbcon53.seq
 249999890     gbcon54.seq
 249997325     gbcon55.seq
 249995987     gbcon56.seq
 153729264     gbcon57.seq
 249996245     gbcon58.seq
 249998868     gbcon59.seq
 249998265     gbcon6.seq
 249998776     gbcon60.seq
 249995315     gbcon61.seq
 184751617     gbcon62.seq
 249999742     gbcon63.seq
 249996805     gbcon64.seq
 249996378     gbcon65.seq
 249997731     gbcon66.seq
 246704194     gbcon67.seq
 249996123     gbcon68.seq
 249996806     gbcon69.seq
 241344788     gbcon7.seq
 249994747     gbcon70.seq
 249998911     gbcon71.seq
 249998433     gbcon72.seq
  97827765     gbcon73.seq
 249996160     gbcon74.seq
 249996456     gbcon75.seq
 249999720     gbcon76.seq
 249998702     gbcon77.seq
 249999534     gbcon78.seq
  63726819     gbcon79.seq
 249996525     gbcon8.seq
 249997709     gbcon80.seq
 249996382     gbcon81.seq
 249999225     gbcon82.seq
 249997118     gbcon83.seq
 249998473     gbcon84.seq
  22747059     gbcon85.seq
 249996051     gbcon86.seq
 250000090     gbcon87.seq
 249999511     gbcon88.seq
 249999267     gbcon89.seq
 249992660     gbcon9.seq
 198915940     gbcon90.seq
 249996015     gbcon91.seq
 249994203     gbcon92.seq
 250000238     gbcon93.seq
 249998171     gbcon94.seq
 249993618     gbcon95.seq
 134239203     gbcon96.seq
 249998824     gbcon97.seq
 249999798     gbcon98.seq
 249997479     gbcon99.seq
     49996     gbdel.txt
 245147178     gbenv1.seq
 249997921     gbenv10.seq
 249999157     gbenv11.seq
 224288050     gbenv12.seq
 249998661     gbenv2.seq
 250000148     gbenv3.seq
 249999800     gbenv4.seq
 249999725     gbenv5.seq
   1271869     gbenv6.seq
 249999092     gbenv7.seq
 249999172     gbenv8.seq
 249998556     gbenv9.seq
 230688615     gbest1.seq
 230687850     gbest10.seq
 230689635     gbest100.seq
 230691027     gbest101.seq
 230688036     gbest102.seq
 230690442     gbest103.seq
 230687784     gbest104.seq
 230687802     gbest105.seq
 230688326     gbest106.seq
 230690758     gbest107.seq
 230689270     gbest108.seq
 230689992     gbest109.seq
 230688467     gbest11.seq
 230690399     gbest110.seq
 230688573     gbest111.seq
 230688843     gbest112.seq
 230690687     gbest113.seq
 230689115     gbest114.seq
 230688457     gbest115.seq
 230689092     gbest116.seq
 230687558     gbest117.seq
 230688980     gbest118.seq
 230626227     gbest119.seq
 230689872     gbest12.seq
 230687484     gbest120.seq
 230688402     gbest121.seq
 230687460     gbest122.seq
 230687780     gbest123.seq
 230690742     gbest124.seq
 230689259     gbest125.seq
 230688677     gbest126.seq
 230688260     gbest127.seq
 230687759     gbest128.seq
 230687656     gbest129.seq
 230689821     gbest13.seq
 230687539     gbest130.seq
 230689497     gbest131.seq
 230690034     gbest132.seq
 230687866     gbest133.seq
 230690230     gbest134.seq
 230687453     gbest135.seq
 230690157     gbest136.seq
 230689769     gbest137.seq
 230688311     gbest138.seq
 230687509     gbest139.seq
 230688392     gbest14.seq
 230687840     gbest140.seq
 230687892     gbest141.seq
 230689396     gbest142.seq
 230690478     gbest143.seq
 230687899     gbest144.seq
 230687783     gbest145.seq
 230690944     gbest146.seq
 230690807     gbest147.seq
 230688735     gbest148.seq
 230688800     gbest149.seq
 230689730     gbest15.seq
 230690500     gbest150.seq
 230687951     gbest151.seq
 230689010     gbest152.seq
 230689828     gbest153.seq
 230689010     gbest154.seq
 230688961     gbest155.seq
 230688061     gbest156.seq
 230689073     gbest157.seq
 230689142     gbest158.seq
 230689412     gbest159.seq
 230689990     gbest16.seq
 230689007     gbest160.seq
 230690800     gbest161.seq
 230688147     gbest162.seq
 230690182     gbest163.seq
 230689945     gbest164.seq
 230696472     gbest165.seq
 230688478     gbest166.seq
 230690057     gbest167.seq
 230688672     gbest168.seq
 230691637     gbest169.seq
 230688061     gbest17.seq
 230688764     gbest170.seq
 230688106     gbest171.seq
 230688364     gbest172.seq
 230688273     gbest173.seq
 230690750     gbest174.seq
 230687780     gbest175.seq
 230689535     gbest176.seq
 230688867     gbest177.seq
 230687791     gbest178.seq
 230689531     gbest179.seq
 230688248     gbest18.seq
 230687656     gbest180.seq
 230688585     gbest181.seq
 230689320     gbest182.seq
 230689699     gbest183.seq
 230688081     gbest184.seq
 230687984     gbest185.seq
 230688386     gbest186.seq
 230690629     gbest187.seq
 230687811     gbest188.seq
 229864122     gbest189.seq
 230689667     gbest19.seq
 230689106     gbest190.seq
 230687930     gbest191.seq
 230688556     gbest192.seq
 230688396     gbest193.seq
 230691029     gbest194.seq
 230690215     gbest195.seq
 230689947     gbest196.seq
 230687522     gbest197.seq
 230689906     gbest198.seq
 230687643     gbest199.seq
 230689833     gbest2.seq
 230687942     gbest20.seq
 230688808     gbest200.seq
 230688651     gbest201.seq
 230691323     gbest202.seq
 230688439     gbest203.seq
 230690670     gbest204.seq
 230687753     gbest205.seq
 230690803     gbest206.seq
 230689299     gbest207.seq
 230688035     gbest208.seq
 230689857     gbest209.seq
 230689774     gbest21.seq
 230688027     gbest210.seq
 230688177     gbest211.seq
 230689699     gbest212.seq
 230689066     gbest213.seq
 230687543     gbest214.seq
 230689213     gbest215.seq
 230689055     gbest216.seq
 230688168     gbest217.seq
 230689083     gbest218.seq
 230688807     gbest219.seq
 230689646     gbest22.seq
 230689924     gbest220.seq
 230688331     gbest221.seq
 230687823     gbest222.seq
 230688579     gbest223.seq
 230690370     gbest224.seq
 230687999     gbest225.seq
 230688539     gbest226.seq
 230688428     gbest227.seq
 230689412     gbest228.seq
 230689302     gbest229.seq
 230687780     gbest23.seq
 230689738     gbest230.seq
 205494104     gbest231.seq
 161817001     gbest232.seq
 161495625     gbest233.seq
 169043696     gbest234.seq
 167986617     gbest235.seq
 164126545     gbest236.seq
 164672303     gbest237.seq
 163692195     gbest238.seq
 163032422     gbest239.seq
 230687545     gbest24.seq
 163454724     gbest240.seq
 163037080     gbest241.seq
 163195806     gbest242.seq
 162012669     gbest243.seq
 166873651     gbest244.seq
 162032171     gbest245.seq
 161397945     gbest246.seq
 165446792     gbest247.seq
 167205778     gbest248.seq
 164855998     gbest249.seq
 230688013     gbest25.seq
 164614542     gbest250.seq
 164363522     gbest251.seq
 164087202     gbest252.seq
 163238738     gbest253.seq
 163091950     gbest254.seq
 163856641     gbest255.seq
 163754402     gbest256.seq
 178561266     gbest257.seq
 172210985     gbest258.seq
 179619926     gbest259.seq
 230689379     gbest26.seq
 230690119     gbest260.seq
 230691453     gbest261.seq
 230687657     gbest262.seq
 230689494     gbest263.seq
 230688879     gbest264.seq
 230690630     gbest265.seq
 230689968     gbest266.seq
 230687681     gbest267.seq
 230688011     gbest268.seq
 230688921     gbest269.seq
 230689206     gbest27.seq
 230691698     gbest270.seq
 230689309     gbest271.seq
 230687681     gbest272.seq
 230689848     gbest273.seq
 230689584     gbest274.seq
 230687515     gbest275.seq
 230689559     gbest276.seq
 230689465     gbest277.seq
 230690476     gbest278.seq
 230687826     gbest279.seq
 230689065     gbest28.seq
 230687677     gbest280.seq
 230690026     gbest281.seq
 230689654     gbest282.seq
 230688803     gbest283.seq
 230690796     gbest284.seq
 230690106     gbest285.seq
 230688959     gbest286.seq
 230689357     gbest287.seq
 230689821     gbest288.seq
 230689679     gbest289.seq
 230689702     gbest29.seq
 230688579     gbest290.seq
 221880829     gbest291.seq
 207493449     gbest292.seq
 230688651     gbest293.seq
 230687642     gbest294.seq
 230688872     gbest295.seq
 230689237     gbest296.seq
 230688543     gbest297.seq
 230687531     gbest298.seq
 230691574     gbest299.seq
 230690315     gbest3.seq
 230687774     gbest30.seq
 230687926     gbest300.seq
 230688032     gbest301.seq
 230687850     gbest302.seq
 230690512     gbest303.seq
 230689660     gbest304.seq
 230687568     gbest305.seq
 230689918     gbest306.seq
 230689616     gbest307.seq
 230688284     gbest308.seq
 230689148     gbest309.seq
 230690000     gbest31.seq
 230687706     gbest310.seq
 230691084     gbest311.seq
 230689972     gbest312.seq
 230688608     gbest313.seq
 230689021     gbest314.seq
 230691260     gbest315.seq
 230690625     gbest316.seq
 230690241     gbest317.seq
 230689985     gbest318.seq
 230687675     gbest319.seq
 230687761     gbest32.seq
 230688331     gbest320.seq
 230689458     gbest321.seq
 230690871     gbest322.seq
 230687852     gbest323.seq
 230689997     gbest324.seq
 230688986     gbest325.seq
 230689169     gbest326.seq
 230689251     gbest327.seq
 230689462     gbest328.seq
 230690074     gbest329.seq
 230688747     gbest33.seq
 230687557     gbest330.seq
 230689043     gbest331.seq
 230688490     gbest332.seq
 230690534     gbest333.seq
 230688376     gbest334.seq
 230688387     gbest335.seq
 230688286     gbest336.seq
 230687908     gbest337.seq
 230689256     gbest338.seq
 230689893     gbest339.seq
 230687836     gbest34.seq
 230689615     gbest340.seq
 230688958     gbest341.seq
 230687815     gbest342.seq
 207961001     gbest343.seq
 230687445     gbest344.seq
 230689448     gbest345.seq
 230689030     gbest346.seq
 230691218     gbest347.seq
 230690100     gbest348.seq
 230689339     gbest349.seq
 230690403     gbest35.seq
 157461947     gbest350.seq
 164846417     gbest351.seq
 230689535     gbest352.seq
 230691598     gbest353.seq
 230688549     gbest354.seq
 230687450     gbest355.seq
 230689159     gbest356.seq
 230687905     gbest357.seq
 230688600     gbest358.seq
 230688494     gbest359.seq
 230689786     gbest36.seq
 230688697     gbest360.seq
 230688975     gbest361.seq
 230687967     gbest362.seq
 230687907     gbest363.seq
 230689153     gbest364.seq
 230689874     gbest365.seq
 230688146     gbest366.seq
 230687457     gbest367.seq
 230688361     gbest368.seq
 230688341     gbest369.seq
 230687550     gbest37.seq
 230689626     gbest370.seq
 230688933     gbest371.seq
 230688498     gbest372.seq
 230690674     gbest373.seq
 230691067     gbest374.seq
 230689863     gbest375.seq
 230687886     gbest376.seq
 230690693     gbest377.seq
 230689530     gbest378.seq
 230688015     gbest379.seq
 230688643     gbest38.seq
 230690224     gbest380.seq
 230690525     gbest381.seq
 230688148     gbest382.seq
 230687546     gbest383.seq
 230689847     gbest384.seq
 230690614     gbest385.seq
 230688360     gbest386.seq
 230689722     gbest387.seq
 230688763     gbest388.seq
 230688549     gbest389.seq
 230688297     gbest39.seq
 230689827     gbest390.seq
 230689509     gbest391.seq
 230688889     gbest392.seq
 191520372     gbest393.seq
 178590075     gbest394.seq
 230688403     gbest395.seq
 229019937     gbest396.seq
 221327962     gbest397.seq
 206316442     gbest398.seq
 196133181     gbest399.seq
 230688895     gbest4.seq
 230690662     gbest40.seq
 230689918     gbest400.seq
 230687806     gbest401.seq
 230690691     gbest402.seq
 230687624     gbest403.seq
 230687999     gbest404.seq
 222400318     gbest405.seq
 230690993     gbest406.seq
 230690441     gbest407.seq
 230693537     gbest408.seq
 230690176     gbest409.seq
 230687820     gbest41.seq
 230689054     gbest410.seq
 230688080     gbest411.seq
 230689515     gbest412.seq
 230690691     gbest413.seq
 230690470     gbest414.seq
 230689461     gbest415.seq
 230689329     gbest416.seq
 230690231     gbest417.seq
 230689455     gbest418.seq
 230688657     gbest419.seq
 230689087     gbest42.seq
 230687502     gbest420.seq
 230687560     gbest421.seq
 230690340     gbest422.seq
 230690400     gbest423.seq
 230689033     gbest424.seq
 230689220     gbest425.seq
 230689636     gbest426.seq
 230688555     gbest427.seq
 230694054     gbest428.seq
 230688895     gbest429.seq
 230688224     gbest43.seq
 218416506     gbest430.seq
 208440362     gbest431.seq
 208169192     gbest432.seq
 208441924     gbest433.seq
 208281505     gbest434.seq
 208543193     gbest435.seq
 208575595     gbest436.seq
 210167647     gbest437.seq
 209612605     gbest438.seq
 209123600     gbest439.seq
 230688434     gbest44.seq
 212273190     gbest440.seq
 209916799     gbest441.seq
 208759227     gbest442.seq
 208775997     gbest443.seq
 208896544     gbest444.seq
 208232783     gbest445.seq
 208261914     gbest446.seq
 208288817     gbest447.seq
 208106123     gbest448.seq
 207317232     gbest449.seq
 230687764     gbest45.seq
 230689708     gbest450.seq
 230689506     gbest451.seq
 230687576     gbest452.seq
 230687566     gbest453.seq
 230687693     gbest454.seq
 230688768     gbest455.seq
 230689604     gbest456.seq
 230688153     gbest457.seq
 230687833     gbest458.seq
 230688000     gbest459.seq
 230688420     gbest46.seq
 230688538     gbest460.seq
 230687909     gbest461.seq
 230687677     gbest462.seq
 230689388     gbest463.seq
 230690702     gbest464.seq
 230688307     gbest465.seq
 230688097     gbest466.seq
 230688532     gbest467.seq
 230687546     gbest468.seq
 230688261     gbest469.seq
 189039533     gbest47.seq
 230688642     gbest470.seq
 230690424     gbest471.seq
 230690582     gbest472.seq
 230688145     gbest473.seq
 230688819     gbest474.seq
 230688872     gbest475.seq
 230687487     gbest476.seq
 230688943     gbest477.seq
 230689287     gbest478.seq
 230689185     gbest479.seq
 188239305     gbest48.seq
 230687484     gbest480.seq
 230689267     gbest481.seq
 230687562     gbest482.seq
 230689761     gbest483.seq
 230690521     gbest484.seq
 230691540     gbest485.seq
 230690094     gbest486.seq
 230689890     gbest487.seq
 230687608     gbest488.seq
 230688735     gbest489.seq
 204604195     gbest49.seq
 230688961     gbest490.seq
 230690819     gbest491.seq
 230688913     gbest492.seq
 230688493     gbest493.seq
 230690420     gbest494.seq
 230688926     gbest495.seq
 230688349     gbest496.seq
 230687504     gbest497.seq
 230689709     gbest498.seq
 230688004     gbest499.seq
 164142208     gbest5.seq
 215035877     gbest50.seq
 230689451     gbest500.seq
 230691121     gbest501.seq
 230689243     gbest502.seq
 230688907     gbest503.seq
 230689515     gbest504.seq
 230688858     gbest505.seq
 230689117     gbest506.seq
 230689691     gbest507.seq
 230687648     gbest508.seq
 230689008     gbest509.seq
 214764221     gbest51.seq
 230690684     gbest510.seq
 230688821     gbest511.seq
 230689685     gbest512.seq
 230690533     gbest513.seq
 230688896     gbest514.seq
 230687716     gbest515.seq
 230687626     gbest516.seq
 230688051     gbest517.seq
 230688148     gbest518.seq
 230688612     gbest519.seq
 215584722     gbest52.seq
 230687918     gbest520.seq
 230689244     gbest521.seq
 230688294     gbest522.seq
 230690262     gbest523.seq
 230688458     gbest524.seq
 230687744     gbest525.seq
 230690080     gbest526.seq
 230688375     gbest527.seq
 224684537     gbest528.seq
 230688516     gbest529.seq
 228569087     gbest53.seq
 230690484     gbest530.seq
 230689816     gbest531.seq
 230688754     gbest532.seq
 230687942     gbest533.seq
 230687659     gbest534.seq
 230689060     gbest535.seq
 230687808     gbest536.seq
 230688200     gbest537.seq
 230691901     gbest538.seq
 230687998     gbest539.seq
 230688190     gbest54.seq
 230689287     gbest540.seq
 230689089     gbest541.seq
 230688071     gbest542.seq
 211781528     gbest543.seq
 196104690     gbest544.seq
 230688126     gbest545.seq
 230689201     gbest546.seq
 230688501     gbest547.seq
 230689576     gbest548.seq
 230688014     gbest549.seq
 230689693     gbest55.seq
 230690120     gbest550.seq
 230689959     gbest551.seq
 230688759     gbest552.seq
 230689287     gbest553.seq
 230688448     gbest554.seq
 230689689     gbest555.seq
 230689455     gbest556.seq
 230687750     gbest557.seq
 221936068     gbest558.seq
 228751361     gbest559.seq
 230687887     gbest56.seq
 230689856     gbest560.seq
 230689270     gbest561.seq
 230690010     gbest562.seq
 230690637     gbest563.seq
 230687833     gbest564.seq
 230687539     gbest565.seq
 219836801     gbest566.seq
 221890279     gbest567.seq
 230688145     gbest568.seq
 230690619     gbest569.seq
 223995399     gbest57.seq
 230687790     gbest570.seq
 230689362     gbest571.seq
 230688051     gbest572.seq
 230688909     gbest573.seq
 230687906     gbest574.seq
 230691165     gbest575.seq
 230688697     gbest576.seq
 230690287     gbest577.seq
 230687500     gbest578.seq
 230689085     gbest579.seq
 230688857     gbest58.seq
 230688668     gbest580.seq
 230691263     gbest581.seq
 224175322     gbest582.seq
 230689224     gbest583.seq
 230689069     gbest584.seq
 230690295     gbest585.seq
 230689932     gbest586.seq
 230688666     gbest587.seq
 230688639     gbest588.seq
 230688994     gbest589.seq
 230688510     gbest59.seq
 230689428     gbest590.seq
 230688460     gbest591.seq
 230688377     gbest592.seq
 230687592     gbest593.seq
 230688922     gbest594.seq
 230688202     gbest595.seq
 230690885     gbest596.seq
 230689187     gbest597.seq
 230689492     gbest598.seq
 230688287     gbest599.seq
 177420861     gbest6.seq
 230688514     gbest60.seq
 230687691     gbest600.seq
 230688598     gbest601.seq
 230690157     gbest602.seq
 230687575     gbest603.seq
 230687946     gbest604.seq
 230689240     gbest605.seq
 230689585     gbest606.seq
 230690785     gbest607.seq
 230687850     gbest608.seq
 230688412     gbest609.seq
 230688842     gbest61.seq
 230688341     gbest610.seq
 230690721     gbest611.seq
 230688472     gbest612.seq
 230688375     gbest613.seq
 230689260     gbest614.seq
 230689220     gbest615.seq
 230687824     gbest616.seq
 230688091     gbest617.seq
 230687472     gbest618.seq
 230687902     gbest619.seq
 230691258     gbest62.seq
 230690403     gbest620.seq
 230687657     gbest621.seq
 230690491     gbest622.seq
 230689321     gbest623.seq
 230690349     gbest624.seq
 230688446     gbest625.seq
 230687754     gbest626.seq
 230688585     gbest627.seq
 230688732     gbest628.seq
 230689501     gbest629.seq
 230689321     gbest63.seq
 230688402     gbest630.seq
 230688240     gbest631.seq
 230688082     gbest632.seq
 230687540     gbest633.seq
 230688050     gbest634.seq
 230689551     gbest635.seq
 230688278     gbest636.seq
 230687964     gbest637.seq
 230687871     gbest638.seq
 230687461     gbest639.seq
 230688651     gbest64.seq
 230690059     gbest640.seq
 230689693     gbest641.seq
 218378084     gbest642.seq
 230688834     gbest643.seq
 230689627     gbest644.seq
 230689203     gbest645.seq
 217358608     gbest646.seq
 228143810     gbest647.seq
 230687891     gbest648.seq
 198361072     gbest649.seq
 230687696     gbest65.seq
 191409194     gbest650.seq
 190606082     gbest651.seq
 194209443     gbest652.seq
 190936326     gbest653.seq
 192360264     gbest654.seq
 191273783     gbest655.seq
 193286667     gbest656.seq
 191829849     gbest657.seq
 191013769     gbest658.seq
 195788155     gbest659.seq
 230689920     gbest66.seq
 230687958     gbest660.seq
 230688633     gbest661.seq
 230689882     gbest662.seq
 230688660     gbest663.seq
 230690570     gbest664.seq
 230691017     gbest665.seq
 230687579     gbest666.seq
 175153573     gbest667.seq
 186700778     gbest668.seq
 230687972     gbest669.seq
 230690115     gbest67.seq
 230690631     gbest670.seq
 230688108     gbest671.seq
 230690406     gbest672.seq
 230690015     gbest673.seq
 230687649     gbest674.seq
 230690470     gbest675.seq
 230688148     gbest676.seq
 230689430     gbest677.seq
 230687637     gbest678.seq
 230687679     gbest679.seq
 230688576     gbest68.seq
 230689921     gbest680.seq
 230687636     gbest681.seq
 230688064     gbest682.seq
 230688908     gbest683.seq
 230689777     gbest684.seq
 230690102     gbest685.seq
 230687627     gbest686.seq
 230688635     gbest687.seq
 230689085     gbest688.seq
 230689552     gbest689.seq
 230689464     gbest69.seq
 230690438     gbest690.seq
 230688751     gbest691.seq
 230689618     gbest692.seq
 230688096     gbest693.seq
 230688301     gbest694.seq
 230689997     gbest695.seq
 230690602     gbest696.seq
 230688005     gbest697.seq
 230688594     gbest698.seq
 230689655     gbest699.seq
 230687843     gbest7.seq
 230687943     gbest70.seq
 230691029     gbest700.seq
 230690828     gbest701.seq
 230688831     gbest702.seq
 230687624     gbest703.seq
 230687749     gbest704.seq
 230688380     gbest705.seq
 230689516     gbest706.seq
 216391737     gbest707.seq
 216709712     gbest708.seq
 218358158     gbest709.seq
 229836978     gbest71.seq
 216526092     gbest710.seq
 215896564     gbest711.seq
 230687924     gbest712.seq
 230688693     gbest713.seq
 230690920     gbest714.seq
 230689176     gbest715.seq
 230688505     gbest716.seq
 230688673     gbest717.seq
 230687552     gbest718.seq
 230689194     gbest719.seq
 230688215     gbest72.seq
 230690335     gbest720.seq
 230689519     gbest721.seq
 230687952     gbest722.seq
 230689511     gbest723.seq
 230689380     gbest724.seq
 230692005     gbest725.seq
 230689417     gbest726.seq
 230688160     gbest727.seq
 230689810     gbest728.seq
 230687986     gbest729.seq
 209824547     gbest73.seq
 230689194     gbest730.seq
 230688322     gbest731.seq
 230691811     gbest732.seq
 230691009     gbest733.seq
 230689471     gbest734.seq
 230688822     gbest735.seq
 230688396     gbest736.seq
 230687942     gbest737.seq
 204288675     gbest738.seq
 230689901     gbest739.seq
 208186115     gbest74.seq
 230689724     gbest740.seq
 230688948     gbest741.seq
 230689335     gbest742.seq
 230687920     gbest743.seq
 230691002     gbest744.seq
 230690748     gbest745.seq
 230687633     gbest746.seq
 230688000     gbest747.seq
 230689521     gbest748.seq
 230689343     gbest749.seq
 207525203     gbest75.seq
 230687717     gbest750.seq
 230689801     gbest751.seq
 230688764     gbest752.seq
 230687895     gbest753.seq
 230688639     gbest754.seq
 208127856     gbest755.seq
 199729341     gbest756.seq
 230690124     gbest757.seq
 230687442     gbest758.seq
 230690411     gbest759.seq
 207839886     gbest76.seq
 230693084     gbest760.seq
 230694573     gbest761.seq
 230689561     gbest762.seq
 230687900     gbest763.seq
 230687551     gbest764.seq
 230688433     gbest765.seq
 230689544     gbest766.seq
 230688275     gbest767.seq
 230688795     gbest768.seq
 230688482     gbest769.seq
 208353100     gbest77.seq
 230690579     gbest770.seq
 230688333     gbest771.seq
 230690462     gbest772.seq
 230689921     gbest773.seq
 230689619     gbest774.seq
 230689600     gbest775.seq
 230688237     gbest776.seq
 230689204     gbest777.seq
 230688114     gbest778.seq
 230688819     gbest779.seq
 209299571     gbest78.seq
 230689066     gbest780.seq
 230688491     gbest781.seq
 230689194     gbest782.seq
 230689785     gbest783.seq
 230689477     gbest784.seq
 230687542     gbest785.seq
 230690187     gbest786.seq
 230688993     gbest787.seq
 230690045     gbest788.seq
 230687668     gbest789.seq
 208466832     gbest79.seq
 230689385     gbest790.seq
 230688996     gbest791.seq
 230688565     gbest792.seq
 230691253     gbest793.seq
 230687489     gbest794.seq
 230689520     gbest795.seq
 230688209     gbest796.seq
 230689366     gbest797.seq
 230690078     gbest798.seq
 230690704     gbest799.seq
 230688355     gbest8.seq
 207079218     gbest80.seq
 230689110     gbest800.seq
 230689635     gbest801.seq
 230687725     gbest802.seq
 230688879     gbest803.seq
 230689321     gbest804.seq
 230688255     gbest805.seq
 230689574     gbest806.seq
 230688479     gbest807.seq
 230690814     gbest808.seq
 230690035     gbest809.seq
 209000787     gbest81.seq
 230690006     gbest810.seq
 230690955     gbest811.seq
 230688621     gbest812.seq
 230687814     gbest813.seq
 230689969     gbest814.seq
 230690259     gbest815.seq
 230690831     gbest816.seq
 230691322     gbest817.seq
 230690271     gbest818.seq
 230688214     gbest819.seq
 207206132     gbest82.seq
 230690633     gbest820.seq
 230687526     gbest821.seq
 230689768     gbest822.seq
 230689096     gbest823.seq
 230690281     gbest824.seq
 230691307     gbest825.seq
 230688187     gbest826.seq
 230689036     gbest827.seq
 230687456     gbest828.seq
 230688104     gbest829.seq
 204099078     gbest83.seq
 230687917     gbest830.seq
 230688181     gbest831.seq
 230690012     gbest832.seq
 230689445     gbest833.seq
 230690274     gbest834.seq
 230100653     gbest835.seq
 230690496     gbest836.seq
 230690243     gbest837.seq
  73097006     gbest838.seq
 207238114     gbest84.seq
 206863656     gbest85.seq
 210427721     gbest86.seq
 226200480     gbest87.seq
 230691230     gbest88.seq
 230688404     gbest89.seq
 230689534     gbest9.seq
 217600919     gbest90.seq
 213208523     gbest91.seq
 214395926     gbest92.seq
 230688220     gbest93.seq
 230690517     gbest94.seq
 230689300     gbest95.seq
 230689724     gbest96.seq
 230689279     gbest97.seq
 230688897     gbest98.seq
 230689555     gbest99.seq
  99040819     gbgen.idx
 230688621     gbgss1.seq
 230690079     gbgss10.seq
 230690035     gbgss100.seq
 227521086     gbgss101.seq
 228875559     gbgss102.seq
 228596267     gbgss103.seq
 228615888     gbgss104.seq
 227686814     gbgss105.seq
 228555325     gbgss106.seq
 230689745     gbgss107.seq
 230687739     gbgss108.seq
 230689049     gbgss109.seq
 230689764     gbgss11.seq
 230689255     gbgss110.seq
 230689922     gbgss111.seq
 230689753     gbgss112.seq
 230688058     gbgss113.seq
 230688819     gbgss114.seq
 230688198     gbgss115.seq
 230689674     gbgss116.seq
 230688532     gbgss117.seq
 230688707     gbgss118.seq
 230689716     gbgss119.seq
 230687679     gbgss12.seq
 230688555     gbgss120.seq
 230687697     gbgss121.seq
 230688733     gbgss122.seq
 230689158     gbgss123.seq
 230689913     gbgss124.seq
 230690468     gbgss125.seq
 230689846     gbgss126.seq
 230689628     gbgss127.seq
 230688826     gbgss128.seq
 230688210     gbgss129.seq
 230690347     gbgss13.seq
 230688232     gbgss130.seq
 230689462     gbgss131.seq
 230689523     gbgss132.seq
 230688603     gbgss133.seq
 230689065     gbgss134.seq
 230689484     gbgss135.seq
 230689746     gbgss136.seq
 230689358     gbgss137.seq
 230688487     gbgss138.seq
 230687703     gbgss139.seq
 230689893     gbgss14.seq
 230688675     gbgss140.seq
 230688985     gbgss141.seq
 230689543     gbgss142.seq
 230689924     gbgss143.seq
 230689064     gbgss144.seq
 226612794     gbgss145.seq
 229946274     gbgss146.seq
 230690042     gbgss147.seq
 209811233     gbgss148.seq
 230687924     gbgss149.seq
 230689648     gbgss15.seq
 230689347     gbgss150.seq
 230690516     gbgss151.seq
 230689865     gbgss152.seq
 230689892     gbgss153.seq
 230687733     gbgss154.seq
 230688909     gbgss155.seq
 230689972     gbgss156.seq
 230688489     gbgss157.seq
 230688291     gbgss158.seq
 230690235     gbgss159.seq
 230689778     gbgss16.seq
 230688265     gbgss160.seq
 230688101     gbgss161.seq
 230687975     gbgss162.seq
 230690557     gbgss163.seq
 230688427     gbgss164.seq
 230689812     gbgss165.seq
 230688375     gbgss166.seq
 230688147     gbgss167.seq
 230687586     gbgss168.seq
 230689373     gbgss169.seq
 230688655     gbgss17.seq
 230690260     gbgss170.seq
 230687784     gbgss171.seq
 230687576     gbgss172.seq
 230690394     gbgss173.seq
 215439556     gbgss174.seq
 207680840     gbgss175.seq
 209736325     gbgss176.seq
 210658743     gbgss177.seq
 209802884     gbgss178.seq
 209435656     gbgss179.seq
 230688580     gbgss18.seq
 207666214     gbgss180.seq
 207220227     gbgss181.seq
 207815197     gbgss182.seq
 208975385     gbgss183.seq
 209311592     gbgss184.seq
 209108278     gbgss185.seq
 205918837     gbgss186.seq
 205546367     gbgss187.seq
 205324571     gbgss188.seq
 205574857     gbgss189.seq
 230688247     gbgss19.seq
 205196483     gbgss190.seq
 205854927     gbgss191.seq
 207598151     gbgss192.seq
 208351027     gbgss193.seq
 207922875     gbgss194.seq
 207970893     gbgss195.seq
 208698449     gbgss196.seq
 208829644     gbgss197.seq
 208901745     gbgss198.seq
 206067497     gbgss199.seq
 230688628     gbgss2.seq
 230689216     gbgss20.seq
 206186488     gbgss200.seq
 206463244     gbgss201.seq
 205613538     gbgss202.seq
 205712778     gbgss203.seq
 207390282     gbgss204.seq
 207096037     gbgss205.seq
 207100931     gbgss206.seq
 207252162     gbgss207.seq
 207142034     gbgss208.seq
 207087884     gbgss209.seq
 230687808     gbgss21.seq
 206875895     gbgss210.seq
 206974647     gbgss211.seq
 206714783     gbgss212.seq
 207731296     gbgss213.seq
 207861032     gbgss214.seq
 209179398     gbgss215.seq
 210105431     gbgss216.seq
 209229062     gbgss217.seq
 210271181     gbgss218.seq
 217142955     gbgss219.seq
 230691288     gbgss22.seq
 218861813     gbgss220.seq
 230689586     gbgss221.seq
 230689807     gbgss222.seq
 230689583     gbgss223.seq
 230689436     gbgss224.seq
 230687487     gbgss225.seq
 230689309     gbgss226.seq
 217905847     gbgss227.seq
 217931093     gbgss228.seq
 230688850     gbgss229.seq
 230690275     gbgss23.seq
 230689300     gbgss230.seq
 230688185     gbgss231.seq
 230689401     gbgss232.seq
 230688322     gbgss233.seq
 230688006     gbgss234.seq
 230687731     gbgss235.seq
 230687923     gbgss236.seq
 230687481     gbgss237.seq
 230689430     gbgss238.seq
 230687486     gbgss239.seq
 230687584     gbgss24.seq
 230689295     gbgss240.seq
 230688846     gbgss241.seq
 230689271     gbgss242.seq
 230689619     gbgss243.seq
 230689540     gbgss244.seq
 230687641     gbgss245.seq
 230688879     gbgss246.seq
 230687816     gbgss247.seq
 230691087     gbgss248.seq
 230688024     gbgss249.seq
 230688860     gbgss25.seq
 230689729     gbgss250.seq
 230687916     gbgss251.seq
 230689301     gbgss252.seq
  32304218     gbgss253.seq
 249999071     gbgss254.seq
 249999202     gbgss255.seq
 249997657     gbgss256.seq
 249997031     gbgss257.seq
  27149251     gbgss258.seq
 249999305     gbgss259.seq
 230689933     gbgss26.seq
 249998059     gbgss260.seq
 249997528     gbgss261.seq
 249999261     gbgss262.seq
 223609630     gbgss263.seq
 249998415     gbgss264.seq
 249998761     gbgss265.seq
 249998880     gbgss266.seq
 249999296     gbgss267.seq
 173665419     gbgss268.seq
 249996883     gbgss269.seq
 230687500     gbgss27.seq
 249998407     gbgss270.seq
 249998682     gbgss271.seq
 249999133     gbgss272.seq
 249997900     gbgss273.seq
  77373170     gbgss274.seq
 249998863     gbgss275.seq
   3042312     gbgss276.seq
  79503481     gbgss277.seq
 249999793     gbgss278.seq
 249999574     gbgss279.seq
 230691150     gbgss28.seq
  80246184     gbgss280.seq
 249998484     gbgss281.seq
 249999450     gbgss282.seq
 249999932     gbgss283.seq
 106015837     gbgss284.seq
 249999531     gbgss285.seq
 249999540     gbgss286.seq
 249999193     gbgss287.seq
 245561962     gbgss288.seq
 249997836     gbgss289.seq
 230689347     gbgss29.seq
 249999279     gbgss290.seq
 249999994     gbgss291.seq
 242660422     gbgss292.seq
 249999336     gbgss293.seq
 249999456     gbgss294.seq
 249998293     gbgss295.seq
 249999491     gbgss296.seq
 114414437     gbgss297.seq
 249998009     gbgss298.seq
 250000031     gbgss299.seq
 230689286     gbgss3.seq
 230689385     gbgss30.seq
 249998209     gbgss300.seq
 249999909     gbgss301.seq
  94193676     gbgss302.seq
 249998892     gbgss303.seq
 249999850     gbgss304.seq
 250000016     gbgss305.seq
 203677706     gbgss306.seq
 249999236     gbgss307.seq
 249997993     gbgss308.seq
 249998006     gbgss309.seq
 230690225     gbgss31.seq
 249999353     gbgss310.seq
  95926739     gbgss311.seq
 249999461     gbgss312.seq
 249999350     gbgss313.seq
 249998406     gbgss314.seq
 249998619     gbgss315.seq
 104014105     gbgss316.seq
 249999853     gbgss317.seq
 249998411     gbgss318.seq
 249998272     gbgss319.seq
 230688976     gbgss32.seq
  42310440     gbgss320.seq
  52138985     gbgss321.seq
  90500177     gbgss322.seq
 230688128     gbgss33.seq
 230690193     gbgss34.seq
 230688810     gbgss35.seq
 230689089     gbgss36.seq
 230689278     gbgss37.seq
 230688359     gbgss38.seq
 230689487     gbgss39.seq
 230688064     gbgss4.seq
 230688189     gbgss40.seq
 230687914     gbgss41.seq
 230689468     gbgss42.seq
 230689860     gbgss43.seq
 230688625     gbgss44.seq
 230688829     gbgss45.seq
 230690346     gbgss46.seq
 230688963     gbgss47.seq
 230687625     gbgss48.seq
 230688321     gbgss49.seq
 230688342     gbgss5.seq
 230688467     gbgss50.seq
 230688749     gbgss51.seq
 230689377     gbgss52.seq
 230689505     gbgss53.seq
 230690049     gbgss54.seq
 230688759     gbgss55.seq
 230687592     gbgss56.seq
 230688956     gbgss57.seq
 230690150     gbgss58.seq
 230688240     gbgss59.seq
 230689182     gbgss6.seq
 230689458     gbgss60.seq
 228978887     gbgss61.seq
 230688786     gbgss62.seq
 230688562     gbgss63.seq
 230688493     gbgss64.seq
 230688511     gbgss65.seq
 230688084     gbgss66.seq
 230688090     gbgss67.seq
 230687948     gbgss68.seq
 230687896     gbgss69.seq
 230687458     gbgss7.seq
 230689872     gbgss70.seq
 230689371     gbgss71.seq
 230689612     gbgss72.seq
 230689793     gbgss73.seq
 230688465     gbgss74.seq
 230687944     gbgss75.seq
 230688682     gbgss76.seq
 230688590     gbgss77.seq
 230688102     gbgss78.seq
 230688694     gbgss79.seq
 230690430     gbgss8.seq
 230688922     gbgss80.seq
 225707360     gbgss81.seq
 194162099     gbgss82.seq
 194321118     gbgss83.seq
 230691378     gbgss84.seq
 230689444     gbgss85.seq
 230688634     gbgss86.seq
 230689771     gbgss87.seq
 230688430     gbgss88.seq
 230689328     gbgss89.seq
 230689298     gbgss9.seq
 230689609     gbgss90.seq
 230689497     gbgss91.seq
 230687463     gbgss92.seq
 230688240     gbgss93.seq
 230688298     gbgss94.seq
 230689356     gbgss95.seq
 230690100     gbgss96.seq
 230689349     gbgss97.seq
 230689178     gbgss98.seq
 230689772     gbgss99.seq
 249998256     gbhtc1.seq
 249999575     gbhtc10.seq
 189556049     gbhtc11.seq
 249998738     gbhtc12.seq
 249999560     gbhtc13.seq
  38916288     gbhtc14.seq
 249993961     gbhtc2.seq
 249987935     gbhtc3.seq
 249988571     gbhtc4.seq
 249999714     gbhtc5.seq
 249988093     gbhtc6.seq
 249999558     gbhtc7.seq
  71734126     gbhtc8.seq
 249998991     gbhtc9.seq
 249927410     gbhtg1.seq
 249805795     gbhtg10.seq
 249708241     gbhtg100.seq
 249864146     gbhtg101.seq
 194375936     gbhtg102.seq
 249745841     gbhtg103.seq
 249971713     gbhtg104.seq
 249906882     gbhtg105.seq
 249860611     gbhtg106.seq
 249825436     gbhtg107.seq
  19643434     gbhtg108.seq
 249821890     gbhtg109.seq
   1643239     gbhtg11.seq
 249909099     gbhtg110.seq
 249906787     gbhtg111.seq
 249979392     gbhtg112.seq
 249998308     gbhtg113.seq
 248428469     gbhtg114.seq
 249627030     gbhtg115.seq
 249749695     gbhtg116.seq
 249766503     gbhtg117.seq
 249805284     gbhtg118.seq
 249912994     gbhtg119.seq
 249672637     gbhtg12.seq
 107216300     gbhtg120.seq
 249833745     gbhtg121.seq
 249813647     gbhtg122.seq
 249980030     gbhtg123.seq
 249679355     gbhtg124.seq
 249914933     gbhtg125.seq
 204659559     gbhtg126.seq
 249822544     gbhtg127.seq
 249934033     gbhtg128.seq
 249833638     gbhtg129.seq
 249786112     gbhtg13.seq
 249984150     gbhtg130.seq
 249876826     gbhtg131.seq
 249909331     gbhtg132.seq
 226166960     gbhtg133.seq
 249841524     gbhtg14.seq
 249728138     gbhtg15.seq
 249897905     gbhtg16.seq
 249916268     gbhtg17.seq
 249948859     gbhtg18.seq
 249980721     gbhtg19.seq
 249995175     gbhtg2.seq
 249981917     gbhtg20.seq
 249962697     gbhtg21.seq
   1969518     gbhtg22.seq
 249684160     gbhtg23.seq
 249675351     gbhtg24.seq
 249717424     gbhtg25.seq
 249979217     gbhtg26.seq
 249920268     gbhtg27.seq
 249844470     gbhtg28.seq
 249953949     gbhtg29.seq
 249928345     gbhtg3.seq
 249972102     gbhtg30.seq
 249918589     gbhtg31.seq
 249755381     gbhtg32.seq
   2656099     gbhtg33.seq
 249676597     gbhtg34.seq
 249895536     gbhtg35.seq
 249952321     gbhtg36.seq
 249811813     gbhtg37.seq
 249900983     gbhtg38.seq
 249968137     gbhtg39.seq
 249925673     gbhtg4.seq
 249858540     gbhtg40.seq
 249815821     gbhtg41.seq
 249860663     gbhtg42.seq
 249738799     gbhtg43.seq
    582834     gbhtg44.seq
 249971929     gbhtg45.seq
 249834661     gbhtg46.seq
 249956774     gbhtg47.seq
 249839082     gbhtg48.seq
 249963460     gbhtg49.seq
 249980040     gbhtg5.seq
 249787520     gbhtg50.seq
 249619294     gbhtg51.seq
 249946111     gbhtg52.seq
 249738475     gbhtg53.seq
 249135690     gbhtg54.seq
 249884138     gbhtg55.seq
 249829274     gbhtg56.seq
 249950134     gbhtg57.seq
 249761648     gbhtg58.seq
 249987019     gbhtg59.seq
 249974518     gbhtg6.seq
  21324925     gbhtg60.seq
 249812692     gbhtg61.seq
 249738037     gbhtg62.seq
 249846387     gbhtg63.seq
 249905223     gbhtg64.seq
 229373446     gbhtg65.seq
 249867547     gbhtg66.seq
 249821147     gbhtg67.seq
 249748908     gbhtg68.seq
 249959468     gbhtg69.seq
 249851850     gbhtg7.seq
 249833907     gbhtg70.seq
  19193487     gbhtg71.seq
 249955271     gbhtg72.seq
 249973586     gbhtg73.seq
 249953795     gbhtg74.seq
 249872746     gbhtg75.seq
 229540315     gbhtg76.seq
 249664812     gbhtg77.seq
 249995310     gbhtg78.seq
 249881017     gbhtg79.seq
 249791419     gbhtg8.seq
 249754570     gbhtg80.seq
 249829940     gbhtg81.seq
   5765707     gbhtg82.seq
 249974957     gbhtg83.seq
 249922868     gbhtg84.seq
 249780224     gbhtg85.seq
 249998563     gbhtg86.seq
 227110095     gbhtg87.seq
 249861904     gbhtg88.seq
 249863061     gbhtg89.seq
 249971606     gbhtg9.seq
 249942480     gbhtg90.seq
 249984043     gbhtg91.seq
 240485988     gbhtg92.seq
 249831953     gbhtg93.seq
 249959162     gbhtg94.seq
 249892088     gbhtg95.seq
 249857275     gbhtg96.seq
 248690383     gbhtg97.seq
 249731895     gbhtg98.seq
 249952475     gbhtg99.seq
 249921031     gbinv1.seq
 249962451     gbinv10.seq
 120398195     gbinv11.seq
 249997893     gbinv12.seq
 249999717     gbinv13.seq
 248734464     gbinv14.seq
 249852565     gbinv2.seq
 232421314     gbinv3.seq
 249999406     gbinv4.seq
 250000089     gbinv5.seq
 248112027     gbinv6.seq
 197465683     gbinv7.seq
 249998746     gbinv8.seq
 249998974     gbinv9.seq
 141107173     gbjou1.idx
 161437109     gbjou2.idx
 204378563     gbjou3.idx
 294415360     gbjou4.idx
 293054019     gbjou5.idx
 166299091     gbjou6.idx
 187074631     gbkey1.idx
 293838214     gbkey2.idx
  64553095     gbkey3.idx
 249747504     gbmam1.seq
 249999646     gbmam2.seq
 249999033     gbmam3.seq
 249501241     gbmam4.seq
  46102565     gbnew.txt
 250000004     gbpat1.seq
 250000192     gbpat10.seq
 178569709     gbpat11.seq
 249999647     gbpat12.seq
 249999861     gbpat13.seq
 249999054     gbpat14.seq
 249998799     gbpat15.seq
 249999870     gbpat16.seq
  66708391     gbpat17.seq
 250000049     gbpat18.seq
 250000127     gbpat19.seq
 249999480     gbpat2.seq
 249999084     gbpat20.seq
 249993011     gbpat21.seq
 183857133     gbpat22.seq
 249999876     gbpat23.seq
 249901146     gbpat24.seq
 249999869     gbpat25.seq
 249999703     gbpat26.seq
  70930226     gbpat27.seq
 250000240     gbpat28.seq
 249997829     gbpat29.seq
 249999446     gbpat3.seq
 249997798     gbpat30.seq
 249998976     gbpat31.seq
 249998814     gbpat32.seq
 179933903     gbpat33.seq
 249997542     gbpat34.seq
 249999765     gbpat35.seq
 249996681     gbpat36.seq
 250000262     gbpat37.seq
 249999284     gbpat38.seq
 249998765     gbpat39.seq
 249999110     gbpat4.seq
 249999600     gbpat40.seq
 249999794     gbpat41.seq
 157220891     gbpat42.seq
 249998738     gbpat43.seq
 249999246     gbpat44.seq
 249999730     gbpat45.seq
 249999601     gbpat46.seq
 222932013     gbpat47.seq
 249999057     gbpat48.seq
 249999815     gbpat49.seq
  71756414     gbpat5.seq
 249999501     gbpat50.seq
 249992729     gbpat51.seq
 249999960     gbpat52.seq
 249999355     gbpat53.seq
  42217044     gbpat54.seq
 249999879     gbpat55.seq
 249999564     gbpat56.seq
 249929730     gbpat57.seq
 249824878     gbpat58.seq
 249998855     gbpat59.seq
 249999527     gbpat6.seq
 185893732     gbpat60.seq
 249999715     gbpat61.seq
 249999409     gbpat62.seq
 249998956     gbpat63.seq
 249953338     gbpat64.seq
 211161346     gbpat65.seq
 250000211     gbpat7.seq
 249994223     gbpat8.seq
 250000215     gbpat9.seq
  81979637     gbphg1.seq
 249998823     gbpln1.seq
 249767179     gbpln10.seq
 249963112     gbpln11.seq
  82670729     gbpln12.seq
 249993089     gbpln13.seq
 249982135     gbpln14.seq
 249998087     gbpln15.seq
 242468843     gbpln16.seq
 249896648     gbpln17.seq
 249792294     gbpln18.seq
 216657212     gbpln19.seq
 249989098     gbpln2.seq
 249163495     gbpln20.seq
 249976308     gbpln21.seq
 111943415     gbpln22.seq
 249996354     gbpln23.seq
  94013211     gbpln24.seq
 249997754     gbpln25.seq
 249117234     gbpln26.seq
 249999490     gbpln27.seq
 249998748     gbpln28.seq
 249995191     gbpln29.seq
 249857407     gbpln3.seq
 249999236     gbpln30.seq
 122053853     gbpln31.seq
 249998123     gbpln32.seq
 249997056     gbpln33.seq
 249996079     gbpln34.seq
 249999288     gbpln35.seq
 249999607     gbpln36.seq
 173984978     gbpln37.seq
 249905010     gbpln4.seq
 249998417     gbpln5.seq
 249998386     gbpln6.seq
  26499877     gbpln7.seq
 249998422     gbpln8.seq
 249992357     gbpln9.seq
 148885906     gbpri1.seq
 249820729     gbpri10.seq
 112694681     gbpri11.seq
 249966221     gbpri12.seq
 249900325     gbpri13.seq
 249891160     gbpri14.seq
 249940560     gbpri15.seq
 249944401     gbpri16.seq
 249922829     gbpri17.seq
 249967453     gbpri18.seq
 249953793     gbpri19.seq
 249919874     gbpri2.seq
 249971074     gbpri20.seq
 179773910     gbpri21.seq
 180000565     gbpri22.seq
 249998908     gbpri23.seq
 204578310     gbpri24.seq
 249924449     gbpri25.seq
 249970558     gbpri26.seq
 249996315     gbpri27.seq
 249906892     gbpri28.seq
 249922017     gbpri29.seq
 249924474     gbpri3.seq
 249918212     gbpri30.seq
 249943855     gbpri31.seq
 249974179     gbpri32.seq
  81914661     gbpri33.seq
 249997287     gbpri34.seq
 249996575     gbpri35.seq
 249613821     gbpri36.seq
 249999043     gbpri37.seq
 249999821     gbpri38.seq
 193329681     gbpri39.seq
 249877079     gbpri4.seq
 249919524     gbpri5.seq
 249989029     gbpri6.seq
 249996238     gbpri7.seq
 249844007     gbpri8.seq
 249863095     gbpri9.seq
    333324     gbrel.txt
 249925422     gbrod1.seq
 249939561     gbrod10.seq
   7472079     gbrod11.seq
 249932781     gbrod12.seq
 249847967     gbrod13.seq
 249977548     gbrod14.seq
 249846993     gbrod15.seq
 249802987     gbrod16.seq
 249809664     gbrod17.seq
 249999351     gbrod18.seq
  39940612     gbrod19.seq
 249834637     gbrod2.seq
 249937396     gbrod20.seq
 249896181     gbrod21.seq
 226408693     gbrod22.seq
 249999402     gbrod23.seq
 249993988     gbrod24.seq
 249980894     gbrod25.seq
 249988948     gbrod26.seq
 249999858     gbrod27.seq
 209201751     gbrod28.seq
 249713477     gbrod3.seq
 249866174     gbrod4.seq
 249953902     gbrod5.seq
 249851887     gbrod6.seq
 249822746     gbrod7.seq
 249918516     gbrod8.seq
 249980747     gbrod9.seq
1857786054     gbsdr1.txt
4820151102     gbsdr2.txt
1989107330     gbsdr3.txt
 150965483     gbsec.idx
 249999671     gbsts1.seq
 249997362     gbsts10.seq
 212226966     gbsts11.seq
 249996524     gbsts12.seq
 249999267     gbsts13.seq
 250000110     gbsts14.seq
 249998866     gbsts15.seq
  26459034     gbsts16.seq
 249998905     gbsts17.seq
 249997604     gbsts18.seq
 249997948     gbsts19.seq
 249999935     gbsts2.seq
 108842414     gbsts20.seq
 249998948     gbsts3.seq
 249996077     gbsts4.seq
  28213075     gbsts5.seq
 249997222     gbsts6.seq
 249997899     gbsts7.seq
 249998458     gbsts8.seq
 249996448     gbsts9.seq
 249997863     gbsyn1.seq
 194876599     gbsyn2.seq
 108188499     gbtsa1.seq
    437307     gbuna1.seq
 249996234     gbvrl1.seq
 249998874     gbvrl10.seq
  85301169     gbvrl11.seq
 249998380     gbvrl2.seq
 249999661     gbvrl3.seq
 249999002     gbvrl4.seq
 105236566     gbvrl5.seq
 250000082     gbvrl6.seq
 249999653     gbvrl7.seq
 249997336     gbvrl8.seq
 249987109     gbvrl9.seq
 249727943     gbvrt1.seq
 249767797     gbvrt10.seq
 137461875     gbvrt11.seq
 249998367     gbvrt12.seq
 249889221     gbvrt13.seq
 249971115     gbvrt14.seq
 249998472     gbvrt15.seq
 249998024     gbvrt16.seq
 249998337     gbvrt17.seq
  75920101     gbvrt18.seq
 249997677     gbvrt2.seq
 249975226     gbvrt3.seq
 219087832     gbvrt4.seq
 249996560     gbvrt5.seq
 249993774     gbvrt6.seq
 249807557     gbvrt7.seq
 249890467     gbvrt8.seq
 249915029     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         39619      98445667
BCT10        16138      92175540
BCT11        53627      85123823
BCT12        98         108531102
BCT13        151        93984019
BCT14        61         112455059
BCT15        51         108348224
BCT16        46         110993195
BCT17        56         110572060
BCT18        66         108817610
BCT19        36         96325907
BCT2         3251       108309512
BCT20        40         106881287
BCT21        58         105533856
BCT22        74         111675191
BCT23        55         110045255
BCT24        63         106845562
BCT25        57         109770611
BCT26        49         107411541
BCT27        81         110997546
BCT28        64         108238469
BCT29        60         109975664
BCT3         52         109691243
BCT30        134        107904348
BCT31        82         102604697
BCT32        269        102355126
BCT33        24075      60952140
BCT34        25162      27507508
BCT35        50336      53718090
BCT36        77849      79699553
BCT37        33136      98692714
BCT38        12791      28250080
BCT4         14518      106332014
BCT5         23938      37979413
BCT6         39049      87464069
BCT7         6953       91057722
BCT8         13958      92278174
BCT9         4468       107283435
ENV1         92595      69422277
ENV10        85263      88578060
ENV11        82904      86652271
ENV12        82673      69131968
ENV2         90908      71375713
ENV3         85144      80693045
ENV4         89411      85593405
ENV5         102075     65857511
ENV6         743        76725
ENV7         131948     31465558
ENV8         87108      71221691
ENV9         94091      74557776
EST1         68125      26289403
EST10        76524      29834002
EST100       75273      34948115
EST101       75184      43117694
EST102       71174      36578285
EST103       74322      36857144
EST104       73052      40333045
EST105       74352      39471182
EST106       70487      39793131
EST107       68675      36743699
EST108       73289      36590895
EST109       72191      45397348
EST11        75175      28789926
EST110       72195      45800070
EST111       69902      43213450
EST112       72902      33141582
EST113       69576      29413518
EST114       67248      37623231
EST115       68221      36554764
EST116       68480      41661199
EST117       72364      37028375
EST118       75097      34618365
EST119       74539      27230927
EST12        77544      30745583
EST120       73737      34214463
EST121       73873      36004981
EST122       64816      36658625
EST123       80434      44893985
EST124       78196      43234401
EST125       68632      48209410
EST126       67539      39476257
EST127       74495      51032702
EST128       69118      41611327
EST129       74291      44796964
EST13        76983      29267115
EST130       74053      45644494
EST131       71406      49220051
EST132       72736      47905752
EST133       79062      44669739
EST134       75052      31066365
EST135       78151      33867462
EST136       79242      46003472
EST137       74716      42935440
EST138       64510      34827353
EST139       70836      36467326
EST14        78878      31975922
EST140       67720      36970068
EST141       65848      36684622
EST142       71472      43613201
EST143       72624      45487776
EST144       67792      39297423
EST145       68465      39568950
EST146       74672      45407663
EST147       67726      39854882
EST148       62204      35426094
EST149       99517      54171105
EST15        74545      31495394
EST150       79571      45530902
EST151       84388      43920295
EST152       103823     54910787
EST153       104966     57129899
EST154       99161      56458094
EST155       73896      44445532
EST156       94074      55845808
EST157       98855      59177887
EST158       93094      55203696
EST159       78954      44939103
EST16        75885      33356445
EST160       68758      38130661
EST161       66261      30209871
EST162       60449      27744227
EST163       56214      27470384
EST164       65018      31375319
EST165       54461      27400431
EST166       78871      51988236
EST167       67663      37827891
EST168       72068      52279838
EST169       73078      41669353
EST17        82059      33785895
EST170       60185      30298659
EST171       63753      36519872
EST172       65282      34169708
EST173       63705      45567225
EST174       62830      36263926
EST175       106943     47537621
EST176       86699      51300241
EST177       103583     59990166
EST178       107537     59440356
EST179       96736      52224094
EST18        80674      32398580
EST180       82676      38463327
EST181       96496      44601788
EST182       97749      48385453
EST183       93222      37364172
EST184       90646      43215276
EST185       63827      44603596
EST186       70680      37409915
EST187       57507      33424796
EST188       71154      43814598
EST189       72795      27090098
EST19        78687      31698202
EST190       76038      45267797
EST191       72872      36916614
EST192       68464      34910927
EST193       68367      39530297
EST194       69639      51932708
EST195       68628      39698861
EST196       67785      33927325
EST197       69054      52541447
EST198       68146      46611649
EST199       72312      37061770
EST2         74644      28643983
EST20        74622      30764662
EST200       68040      45610826
EST201       70213      58479910
EST202       63810      47397260
EST203       63446      46605031
EST204       63732      46116953
EST205       64785      45816226
EST206       67013      50632948
EST207       61635      40020780
EST208       61849      35780282
EST209       66456      37730884
EST21        74081      34372835
EST210       67975      38255216
EST211       90698      51568315
EST212       72236      50514468
EST213       87767      51742146
EST214       113126     69960062
EST215       115263     68359500
EST216       103715     62404193
EST217       98497      64052138
EST218       118980     56343613
EST219       87102      45531840
EST22        74869      29982206
EST220       85745      52541073
EST221       92540      41985338
EST222       89670      44967950
EST223       73327      48487702
EST224       66750      41022911
EST225       68733      57682118
EST226       68706      59138564
EST227       77769      42849349
EST228       81565      43797510
EST229       73474      52843234
EST23        77388      32710695
EST230       70644      50849688
EST231       51152      29900273
EST232       27984      10641902
EST233       27995      10367295
EST234       26710      9925050
EST235       26943      9190034
EST236       27612      9551933
EST237       27311      10254640
EST238       27387      9800327
EST239       27509      10284213
EST24        74746      32777581
EST240       27339      12085284
EST241       27421      11352863
EST242       27489      10349882
EST243       27801      9431872
EST244       27083      9204750
EST245       27977      11290676
EST246       28029      10868407
EST247       27343      11399098
EST248       26788      11997450
EST249       27268      11485436
EST25        74123      32011033
EST250       27262      10955058
EST251       27221      11609155
EST252       27341      11640052
EST253       27475      11250453
EST254       27476      10902927
EST255       27394      10643004
EST256       27408      10883577
EST257       24797      17419571
EST258       25827      17215412
EST259       41618      19362127
EST26        75149      30992919
EST260       87776      40233729
EST261       76559      44098474
EST262       58902      30635990
EST263       101211     41539281
EST264       70772      42266609
EST265       68773      44584273
EST266       69410      44341491
EST267       69709      43863146
EST268       68983      40488732
EST269       69671      40218555
EST27        74442      32424560
EST270       64868      49380528
EST271       63690      31164073
EST272       85693      42201295
EST273       98283      45945214
EST274       71791      40964276
EST275       64670      32686764
EST276       69708      33602333
EST277       69693      42682617
EST278       74827      34706292
EST279       70801      36542545
EST28        107843     51021980
EST280       71864      46608085
EST281       64264      35549074
EST282       67851      35776062
EST283       84468      45105316
EST284       72581      40144411
EST285       81522      54893027
EST286       82369      53074790
EST287       110354     49043630
EST288       77851      42502155
EST289       73745      45564726
EST29        97114      45861756
EST290       72926      40450372
EST291       70112      34481896
EST292       70139      27306706
EST293       67851      41137202
EST294       62345      35117141
EST295       64622      41472669
EST296       70444      40498589
EST297       64746      44498116
EST298       62938      32277665
EST299       80832      42840000
EST3         73730      29915710
EST30        98652      53904126
EST300       83238      44136905
EST301       81277      50107869
EST302       108569     54260836
EST303       117488     48204024
EST304       72699      35300837
EST305       67342      36447410
EST306       70518      46087317
EST307       81397      40401923
EST308       69888      41663660
EST309       71360      41466664
EST31        86670      50577575
EST310       60146      34155023
EST311       53482      32527316
EST312       66648      42024838
EST313       69748      45844842
EST314       66297      41109545
EST315       69756      40303090
EST316       73732      37512618
EST317       60668      31698835
EST318       55697      28543561
EST319       54622      29113502
EST32        65504      40981489
EST320       54882      29283337
EST321       53735      28858927
EST322       56946      25993861
EST323       58053      25538809
EST324       56909      23579687
EST325       56936      23157938
EST326       57458      21956779
EST327       57918      23609322
EST328       57570      22482322
EST329       57853      21733654
EST33        71114      57761125
EST330       58838      21744728
EST331       74771      44099226
EST332       77280      34815615
EST333       79023      32040686
EST334       76169      32673939
EST335       85672      49441630
EST336       67386      50516494
EST337       70065      47017674
EST338       95918      59365814
EST339       96797      58470659
EST34        84882      48610976
EST340       101663     57328861
EST341       99948      54709493
EST342       77071      41338407
EST343       70466      39659953
EST344       76912      43262091
EST345       62773      55291922
EST346       63895      46107363
EST347       63565      40931791
EST348       61411      34425321
EST349       72492      51361902
EST35        85770      42934909
EST350       50699      27980999
EST351       52778      26185217
EST352       70664      38324983
EST353       60569      32773682
EST354       62503      31411049
EST355       64447      41487696
EST356       84652      43296305
EST357       70244      41779239
EST358       68203      43726779
EST359       67443      37360508
EST36        90243      48682086
EST360       63295      41708150
EST361       86759      50186216
EST362       84354      50004875
EST363       78512      42708325
EST364       63759      37332891
EST365       66155      34198953
EST366       73743      40446935
EST367       46772      24285782
EST368       67304      38003635
EST369       69121      42363373
EST37        86879      61548320
EST370       98797      45756651
EST371       74970      45078984
EST372       71512      47253035
EST373       71572      46031365
EST374       62759      35813561
EST375       74890      36523788
EST376       82518      37877038
EST377       58051      41146062
EST378       53671      38058336
EST379       64349      37273061
EST38        76923      50430091
EST380       85852      51784450
EST381       87979      47968793
EST382       68054      42401681
EST383       78003      41455201
EST384       55185      36015886
EST385       43608      22190035
EST386       62640      39361189
EST387       82104      43245949
EST388       77691      46322989
EST389       72611      44970164
EST39        95533      56124198
EST390       79275      47034898
EST391       76763      49214748
EST392       88893      62606794
EST393       49770      47488840
EST394       43203      36962684
EST395       89855      53414907
EST396       84271      40165878
EST397       79011      38260109
EST398       55636      38224649
EST399       55032      43284327
EST4         74560      28391201
EST40        63824      49141951
EST400       72478      45958503
EST401       63039      40606190
EST402       67963      38918296
EST403       62934      36882023
EST404       65933      32383565
EST405       79622      25589456
EST406       74512      40091922
EST407       67405      39935658
EST408       65136      32564773
EST409       74623      46137603
EST41        78040      55105480
EST410       71308      47165566
EST411       65721      40957069
EST412       68187      43363309
EST413       62134      34654160
EST414       69611      42122817
EST415       73413      45921084
EST416       80436      49131716
EST417       84945      47751130
EST418       61043      39348544
EST419       55982      40804563
EST42        101375     48387599
EST420       56802      39975741
EST421       58940      40226651
EST422       78465      48158380
EST423       55191      32235271
EST424       53181      35115386
EST425       65030      41187610
EST426       58184      41095994
EST427       60147      41857381
EST428       50936      36148444
EST429       63492      40476328
EST43        75537      45740396
EST430       88110      39938115
EST431       70492      38934675
EST432       70678      38581527
EST433       70464      39345629
EST434       70552      38737345
EST435       70307      39408494
EST436       70164      38910970
EST437       69797      38879728
EST438       69658      39428663
EST439       69850      39130508
EST44        105089     44842203
EST440       67966      38478113
EST441       69873      38268686
EST442       70266      39722426
EST443       70263      38993305
EST444       70251      38195229
EST445       70692      38736778
EST446       70638      38879090
EST447       70538      38786881
EST448       70774      38460185
EST449       71960      37544730
EST45        92386      51423354
EST450       92314      53816285
EST451       82661      37001972
EST452       99152      55994293
EST453       87991      49537835
EST454       74391      44738032
EST455       83996      50761782
EST456       76660      39775828
EST457       91053      56044894
EST458       98612      60427898
EST459       79722      46640645
EST46        103502     45865997
EST460       88705      48739151
EST461       88638      51430451
EST462       76948      57324929
EST463       91768      53734934
EST464       78134      48914660
EST465       65690      43539824
EST466       101742     63585962
EST467       96554      65997606
EST468       100161     63994481
EST469       111952     44941621
EST47        70160      19062003
EST470       97788      48745651
EST471       58265      40562762
EST472       51389      40232173
EST473       74519      44780633
EST474       59373      36072073
EST475       75343      44876215
EST476       115475     57813226
EST477       76006      46349146
EST478       82188      59172241
EST479       49420      27397460
EST48        70453      18746054
EST480       46707      45450683
EST481       46404      58893125
EST482       75564      55025518
EST483       63028      37582335
EST484       72103      43367439
EST485       71791      41165044
EST486       67635      44110529
EST487       64272      48897188
EST488       76193      45801076
EST489       109188     47935845
EST49        73004      21781880
EST490       87491      51339989
EST491       62940      43078243
EST492       56665      41261414
EST493       56220      38032524
EST494       65796      47557093
EST495       64903      45672220
EST496       62819      46151101
EST497       52185      37074951
EST498       51823      38200022
EST499       59691      42542794
EST5         48193      15292118
EST50        44094      12165142
EST500       61835      35507653
EST501       71299      45018107
EST502       57381      38200093
EST503       57181      39688358
EST504       62428      46452008
EST505       60144      46255599
EST506       70513      45886667
EST507       49826      39782726
EST508       58117      39404706
EST509       53125      34816741
EST51        44040      12204029
EST510       58056      40085811
EST511       57542      36629575
EST512       73945      44614048
EST513       69105      58471823
EST514       68780      49894054
EST515       74429      51306835
EST516       46163      58583809
EST517       56869      49546830
EST518       67191      46589450
EST519       61671      40694818
EST52        43820      11896636
EST520       77481      44919333
EST521       83054      53439745
EST522       82859      52431015
EST523       69514      41617569
EST524       63374      39165950
EST525       71586      49817578
EST526       80643      49929572
EST527       77755      60596768
EST528       69226      47417504
EST529       71872      49817674
EST53        63753      24263518
EST530       67157      46986236
EST531       60366      48379561
EST532       62711      45582513
EST533       79918      44490589
EST534       71840      42101616
EST535       113672     46008076
EST536       113365     49969588
EST537       76271      49257729
EST538       50574      49868991
EST539       62927      46276139
EST54        96695      39152593
EST540       97721      13854655
EST541       99743      10984440
EST542       99131      22917276
EST543       89155      38124597
EST544       86879      31661720
EST545       80791      42783653
EST546       65139      60583514
EST547       91124      55890959
EST548       80999      44612310
EST549       67443      43767041
EST55        96996      42467616
EST550       72091      47279320
EST551       74707      49555461
EST552       86052      50947884
EST553       72701      53039637
EST554       67917      47818584
EST555       71237      54373563
EST556       84665      51601976
EST557       84587      45528532
EST558       82782      45455999
EST559       84597      39933246
EST56        97643      47025744
EST560       81958      44609534
EST561       77208      52193364
EST562       72734      55563565
EST563       73971      51554353
EST564       79880      44675682
EST565       102623     47834721
EST566       111614     48217104
EST567       118652     49732115
EST568       130659     59335542
EST569       96223      53809089
EST57        92597      46566573
EST570       79657      53702643
EST571       80000      25094995
EST572       84289      8750603
EST573       100083     38627665
EST574       117048     57763649
EST575       106685     52204516
EST576       66260      44349063
EST577       70580      41361245
EST578       72719      50678088
EST579       74023      44252219
EST58        103243     50952553
EST580       74969      45866818
EST581       70604      47665702
EST582       70325      52063805
EST583       96948      54770008
EST584       92806      46194636
EST585       65701      39166453
EST586       63813      45244719
EST587       89356      55862956
EST588       94888      55975118
EST589       75444      43630655
EST59        106796     54846583
EST590       80762      34713436
EST591       96836      10350479
EST592       96863      10301352
EST593       95533      16812938
EST594       69564      44787200
EST595       93327      46664348
EST596       77131      49274450
EST597       76221      52533015
EST598       84761      53805372
EST599       78756      50671600
EST6         54905      17436848
EST60        76034      33349096
EST600       77719      51848627
EST601       77909      45427657
EST602       87224      52909047
EST603       74619      43324122
EST604       69123      49158527
EST605       55844      35651817
EST606       107321     32902747
EST607       62425      40041626
EST608       51070      32385155
EST609       51308      33233478
EST61        66766      28459023
EST610       52702      36830264
EST611       76249      49201626
EST612       65582      46914125
EST613       96048      29009953
EST614       122590     11127797
EST615       118236     14517641
EST616       122483     11289449
EST617       120693     12522113
EST618       65767      47093426
EST619       63842      49698871
EST62        72615      32629523
EST620       74513      48704904
EST621       78800      50420762
EST622       67882      49054899
EST623       76497      44850311
EST624       62718      41751659
EST625       68138      41064893
EST626       103339     27712741
EST627       127260     11747791
EST628       99365      26050437
EST629       79824      48248270
EST63        70606      29950663
EST630       69518      51908686
EST631       79491      46089003
EST632       85861      47670365
EST633       82688      53722962
EST634       58650      30699056
EST635       73767      42962286
EST636       71166      59579532
EST637       88341      48172270
EST638       107458     50972060
EST639       69127      49380517
EST64        79585      32613333
EST640       61157      48491489
EST641       68840      55451422
EST642       74247      34918595
EST643       84752      52047258
EST644       88631      52506803
EST645       83729      37566209
EST646       71374      47280540
EST647       71885      50338193
EST648       81924      51796075
EST649       77950      29177639
EST65        77468      30384948
EST650       76924      26006146
EST651       77538      25575440
EST652       74933      29983050
EST653       77145      25660501
EST654       75737      30705563
EST655       76474      28760892
EST656       75608      28091210
EST657       76402      28703033
EST658       76621      29278616
EST659       76279      31236018
EST66        70312      28257710
EST660       78888      46337041
EST661       81616      57635722
EST662       81937      59834927
EST663       83855      53547011
EST664       62191      32380406
EST665       59884      40279061
EST666       79034      45081404
EST667       47931      26295798
EST668       43604      35543260
EST669       58856      44804883
EST67        64547      29563459
EST670       58387      45008540
EST671       68434      46912822
EST672       80004      39267474
EST673       65110      41546403
EST674       91792      49088858
EST675       72495      42922113
EST676       65036      42964874
EST677       79276      51181420
EST678       77592      41586773
EST679       62707      38317663
EST68        73116      32558178
EST680       71940      50238239
EST681       72264      46178749
EST682       61191      42883289
EST683       70733      52231309
EST684       72127      46942662
EST685       74219      46057302
EST686       68529      48757386
EST687       71397      54099049
EST688       81507      70006229
EST689       82258      69026905
EST69        79304      35581806
EST690       79327      61306740
EST691       77328      39017904
EST692       71295      32347108
EST693       54248      32032483
EST694       67214      47727359
EST695       63605      40445648
EST696       66252      48872245
EST697       67835      45174471
EST698       58590      39171851
EST699       55151      37975286
EST7         74531      29353676
EST70        73577      29310685
EST700       63765      42604009
EST701       69032      44334635
EST702       65456      44748029
EST703       65768      46206224
EST704       66137      44963394
EST705       70638      45827407
EST706       76772      55423120
EST707       68096      39512271
EST708       68224      35953220
EST709       66766      39754593
EST71        73713      25115873
EST710       68172      38035850
EST711       68351      40680657
EST712       71230      58131043
EST713       71425      46813633
EST714       62253      37261008
EST715       78793      46449525
EST716       66782      42218810
EST717       63503      44437039
EST718       65445      36754378
EST719       61701      39143716
EST72        86938      42129352
EST720       64697      40550467
EST721       78991      49694252
EST722       100634     51881394
EST723       87966      43529905
EST724       61668      36882025
EST725       54168      27941954
EST726       51069      32252482
EST727       56093      36040358
EST728       58519      40728574
EST729       60072      38269326
EST73        44226      12876694
EST730       61353      37835545
EST731       65537      41684301
EST732       55958      35023190
EST733       52472      32897119
EST734       66977      40760949
EST735       85334      38586131
EST736       117275     37288887
EST737       80616      39411957
EST738       74465      28658101
EST739       76929      42483114
EST74        40872      11252491
EST740       63959      42932802
EST741       82439      47313835
EST742       77858      48303109
EST743       67892      44031062
EST744       78199      43341066
EST745       57374      38696734
EST746       57868      37478595
EST747       60774      41711916
EST748       59759      39271335
EST749       60117      38389180
EST75        40856      12507750
EST750       62778      42255354
EST751       82131      49179475
EST752       90726      62899211
EST753       68757      44701998
EST754       77432      43741619
EST755       64831      29855319
EST756       58717      32141042
EST757       86611      50323697
EST758       80393      58888849
EST759       77519      59122199
EST76        41226      12732698
EST760       48191      31503498
EST761       32398      19844649
EST762       32682      19344021
EST763       32557      19311085
EST764       63685      32316429
EST765       64592      38225218
EST766       58781      35109337
EST767       58673      35378329
EST768       59197      34067766
EST769       68217      24783804
EST77        41264      12320742
EST770       70976      14773146
EST771       71193      14215071
EST772       70819      15091826
EST773       71351      13846569
EST774       70750      15253912
EST775       73708      42190491
EST776       89827      51854401
EST777       88405      55687804
EST778       113047     52962823
EST779       113745     52138390
EST78        41248      13354376
EST780       113960     51879081
EST781       113865     52012115
EST782       94072      49736457
EST783       67185      42674410
EST784       66946      43932004
EST785       60249      39818113
EST786       60771      38370599
EST787       62062      39747749
EST788       62198      36836944
EST789       69347      40778746
EST79        41022      12967436
EST790       82998      51010586
EST791       80881      53146626
EST792       78810      33904478
EST793       63208      33154880
EST794       83885      43539680
EST795       77554      35891845
EST796       75269      6046673
EST797       75789      5815795
EST798       73758      5878371
EST799       69052      6237655
EST8         75810      30584188
EST80        41022      12322631
EST800       69430      6904763
EST801       71093      14449744
EST802       70820      15089240
EST803       71155      14306699
EST804       71322      13913528
EST805       70838      15045801
EST806       71332      13889815
EST807       68829      27337847
EST808       65691      43702747
EST809       66021      40058997
EST81        40608      12104694
EST810       86656      47313600
EST811       86451      57468648
EST812       70375      49232354
EST813       72833      51012595
EST814       79333      43559026
EST815       73006      47961032
EST816       73517      52919880
EST817       66796      43524932
EST818       61135      42077826
EST819       63573      44673819
EST82        41346      12916581
EST820       63586      45661543
EST821       67723      46165749
EST822       64904      39508157
EST823       76044      57787910
EST824       77646      60455654
EST825       55912      34961530
EST826       71231      46715146
EST827       81972      25498763
EST828       75372      11941159
EST829       75367      11966439
EST83        41916      11971789
EST830       73504      21907426
EST831       73574      36795180
EST832       71524      25485226
EST833       73258      27068191
EST834       72340      26361889
EST835       79566      26982670
EST836       72646      26786032
EST837       68233      29224954
EST838       28175      9130534
EST84        41490      13239091
EST85        41352      13044415
EST86        42926      13114405
EST87        46638      17100691
EST88        43388      27249112
EST89        43017      19651560
EST9         77564      29870697
EST90        49364      20229316
EST91        51545      22273469
EST92        51055      22002262
EST93        84065      49711390
EST94        79577      38931267
EST95        72593      27524688
EST96        74461      29287843
EST97        74649      40733023
EST98        77348      40801996
EST99        76814      44069819
GSS1         90430      38662943
GSS10        74787      43607320
GSS100       77153      52288992
GSS101       74876      41893586
GSS102       73303      45860059
GSS103       73626      45046922
GSS104       73386      45471300
GSS105       73314      44699409
GSS106       73806      44750095
GSS107       80850      53979987
GSS108       83478      55583770
GSS109       80253      53368574
GSS11        70802      35983221
GSS110       83781      51161543
GSS111       84007      52414770
GSS112       79866      63704216
GSS113       89195      45918585
GSS114       91176      54695576
GSS115       75591      50163283
GSS116       87581      62417839
GSS117       82482      61296217
GSS118       75435      37731405
GSS119       82014      54981508
GSS12        73150      38495437
GSS120       95150      53302967
GSS121       84690      54604955
GSS122       85147      54475757
GSS123       82785      54168349
GSS124       76244      69444443
GSS125       76017      67352011
GSS126       79740      57032690
GSS127       72569      50207340
GSS128       72525      50053427
GSS129       73052      49179493
GSS13        76795      38906116
GSS130       72272      50532205
GSS131       72848      49448235
GSS132       84207      59798338
GSS133       81570      58237005
GSS134       71173      56818093
GSS135       69370      54502841
GSS136       76003      67405067
GSS137       75134      64191881
GSS138       77791      52240612
GSS139       84472      53328934
GSS14        71379      32114760
GSS140       94540      58273302
GSS141       93479      59663600
GSS142       81864      54441668
GSS143       91438      49403668
GSS144       71185      61013112
GSS145       113859     58721017
GSS146       111951     58051213
GSS147       81541      58660340
GSS148       60027      37043223
GSS149       65339      44847525
GSS15        70493      35055254
GSS150       72889      55870580
GSS151       72986      55913938
GSS152       72999      55891267
GSS153       73006      55877910
GSS154       72975      55929930
GSS155       72985      55914569
GSS156       76440      59395042
GSS157       81600      37612301
GSS158       87572      59564765
GSS159       88978      63190315
GSS16        78213      46093569
GSS160       85589      61840087
GSS161       93855      58724369
GSS162       82377      55631866
GSS163       77475      51622751
GSS164       73873      46942305
GSS165       92616      58648790
GSS166       90981      59801751
GSS167       84523      61269321
GSS168       99194      31082870
GSS169       106848     22488181
GSS17        70895      33315071
GSS170       78156      49289740
GSS171       83017      53560139
GSS172       55866      40586380
GSS173       50318      37750629
GSS174       62623      52397689
GSS175       59011      45514213
GSS176       57910      48087980
GSS177       57498      48764488
GSS178       58104      46864850
GSS179       58370      46067120
GSS18        58792      27918452
GSS180       58895      47573893
GSS181       58975      48339200
GSS182       58563      49611947
GSS183       58344      48506122
GSS184       58620      46124420
GSS185       58496      49051108
GSS186       60057      50461791
GSS187       60323      49708240
GSS188       60479      49247627
GSS189       60307      49767491
GSS19        56814      29015258
GSS190       60568      48981460
GSS191       60184      47489580
GSS192       59126      45434141
GSS193       58600      47096146
GSS194       58897      46166124
GSS195       58865      46268926
GSS196       58358      47857263
GSS197       58266      48144906
GSS198       58215      48303023
GSS199       59937      49775241
GSS2         89000      39334171
GSS20        57683      26671178
GSS200       59826      50913546
GSS201       59783      49956125
GSS202       60583      46034177
GSS203       60517      46249292
GSS204       59353      49843249
GSS205       59557      49220109
GSS206       59556      49224490
GSS207       59447      49555268
GSS208       59522      49325581
GSS209       59562      49205274
GSS21        61491      29519987
GSS210       59711      48752502
GSS211       59641      48965443
GSS212       59823      48412044
GSS213       59000      46434084
GSS214       58892      45911683
GSS215       58471      47365644
GSS216       58216      48239868
GSS217       58805      46210446
GSS218       57860      48083779
GSS219       63524      53343149
GSS22        64602      37591837
GSS220       64816      54771086
GSS221       87010      58527418
GSS222       86806      45793287
GSS223       76495      58006741
GSS224       81724      54274501
GSS225       93016      52069871
GSS226       75566      50426548
GSS227       71275      47094648
GSS228       71249      47158889
GSS229       91602      51067125
GSS23        57530      27078431
GSS230       101587     62687079
GSS231       87084      56933507
GSS232       96370      62265483
GSS233       94695      64347896
GSS234       96632      61941218
GSS235       95265      63548800
GSS236       93910      65107785
GSS237       93692      65372477
GSS238       94364      64543522
GSS239       94879      63898172
GSS24        66204      42045465
GSS240       92753      66547982
GSS241       93155      66045163
GSS242       93394      65755004
GSS243       92534      67056989
GSS244       93327      64417292
GSS245       91021      68995136
GSS246       90023      69955200
GSS247       73768      55328268
GSS248       64017      37373751
GSS249       55904      35836532
GSS25        68012      28208036
GSS250       71512      41308624
GSS251       77128      38136179
GSS252       80356      34544297
GSS253       13618      4968578
GSS254       87215      64322450
GSS255       83560      62785662
GSS256       103506     48466292
GSS257       68557      58493942
GSS258       7255       6715675
GSS259       68689      57997997
GSS26        58165      25385995
GSS260       69318      56731875
GSS261       69558      56262131
GSS262       71310      56073507
GSS263       68163      51560938
GSS264       75915      58209304
GSS265       87237      74898207
GSS266       81830      44609896
GSS267       92728      44802864
GSS268       56936      44483078
GSS269       77450      61364360
GSS27        65496      32012382
GSS270       69674      58716476
GSS271       67726      62729803
GSS272       62115      53378890
GSS273       95374      42846906
GSS274       21124      4925389
GSS275       112598     70576666
GSS276       1162       860167
GSS277       23226      28867035
GSS278       106545     69076642
GSS279       84506      34579222
GSS28        65277      32524263
GSS280       38340      23887677
GSS281       120690     73137800
GSS282       118608     75280747
GSS283       107827     64313380
GSS284       44875      22452831
GSS285       83122      54662699
GSS286       95854      61476351
GSS287       107385     78564022
GSS288       106112     76516066
GSS289       106101     79982459
GSS29        77560      39751724
GSS290       104023     80029991
GSS291       76699      51240599
GSS292       104177     63042260
GSS293       109868     66415305
GSS294       106304     59376521
GSS295       68468      37495987
GSS296       70288      39120208
GSS297       36242      16959499
GSS298       85481      46023427
GSS299       97119      55907586
GSS3         87422      41844005
GSS30        82722      39709532
GSS300       94941      49578268
GSS301       96269      55917369
GSS302       42190      23639634
GSS303       114638     43642267
GSS304       117085     39368203
GSS305       103278     77900651
GSS306       81613      53566266
GSS307       95891      36542252
GSS308       95417      37268709
GSS309       96671      35161518
GSS31        74196      40403296
GSS310       94285      39167432
GSS311       37736      17626556
GSS312       103939     66277823
GSS313       94551      61190929
GSS314       95128      60357048
GSS315       94773      60868501
GSS316       33134      33073975
GSS317       83875      28283031
GSS318       84362      27389237
GSS319       85085      25924821
GSS32        70296      48150506
GSS320       14410      4314220
GSS321       16547      7508221
GSS322       32110      14916280
GSS33        79819      37806757
GSS34        75886      40326853
GSS35        74137      39965937
GSS36        87407      56321961
GSS37        87597      58175336
GSS38        85527      44938754
GSS39        86748      50382457
GSS4         79227      41150659
GSS40        86338      39890925
GSS41        83128      32053103
GSS42        81246      56934526
GSS43        80119      58036205
GSS44        72015      47522099
GSS45        72042      47418737
GSS46        77593      45700878
GSS47        77817      38710219
GSS48        83136      57946480
GSS49        86562      64736594
GSS5         78819      40567994
GSS50        81619      54415202
GSS51        93859      59286241
GSS52        88468      58760461
GSS53        76598      42227197
GSS54        72837      40526305
GSS55        86497      47027164
GSS56        88038      58467263
GSS57        76195      63888101
GSS58        70809      77994698
GSS59        85505      69015835
GSS6         78088      38842501
GSS60        89580      60228581
GSS61        63450      44798512
GSS62        66010      45382089
GSS63        89643      67177279
GSS64        84960      58429020
GSS65        86085      52989465
GSS66        85463      55672245
GSS67        93346      57853897
GSS68        97857      52536797
GSS69        97528      52972908
GSS7         77657      39174963
GSS70        98228      52048388
GSS71        99183      50781820
GSS72        99205      50753178
GSS73        99077      50923874
GSS74        99695      50102347
GSS75        97770      52652118
GSS76        91867      64654021
GSS77        89865      70740033
GSS78        88925      70111547
GSS79        87858      69635748
GSS8         75881      38134490
GSS80        87908      63986891
GSS81        88312      44882444
GSS82        78277      23271484
GSS83        78145      23584254
GSS84        84149      48917342
GSS85        77098      45548204
GSS86        88958      56028697
GSS87        84342      58665578
GSS88        75464      75654161
GSS89        78488      73099327
GSS9         72240      37167492
GSS90        83987      46687847
GSS91        85043      49406143
GSS92        73869      40395541
GSS93        80113      56218088
GSS94        76470      56904902
GSS95        82996      52876349
GSS96        82955      59175062
GSS97        85633      57672187
GSS98        86989      52202127
GSS99        82271      66179489
HTC1         25181      27238735
HTC10        77317      71981901
HTC11        48993      67612949
HTC12        66997      61008541
HTC13        68495      69600205
HTC14        14416      9280278
HTC2         16162      36527196
HTC3         16149      36808896
HTC4         16389      35873366
HTC5         16090      40456968
HTC6         16183      37872493
HTC7         55450      33944681
HTC8         28838      15503974
HTC9         65502      65512606
HTG1         1317       188816214
HTG10        1297       186286287
HTG100       1055       189273704
HTG101       1076       189543191
HTG102       789        147606980
HTG103       1021       189695564
HTG104       991        189502567
HTG105       998        189429695
HTG106       986        189362399
HTG107       1199       190615351
HTG108       105        15014740
HTG109       1144       189995079
HTG11        9          1245953
HTG110       1058       189852924
HTG111       1415       191568844
HTG112       1475       190168202
HTG113       1133       190375624
HTG114       1106       185711518
HTG115       1620       188255303
HTG116       966        193130291
HTG117       745        168729335
HTG118       1089       193698917
HTG119       1103       193053665
HTG12        1451       183812880
HTG120       444        83026878
HTG121       1035       189495229
HTG122       1070       192088955
HTG123       1117       192038469
HTG124       1154       192364942
HTG125       1099       192783531
HTG126       922        157840964
HTG127       1150       192449089
HTG128       1127       192151791
HTG129       1141       191775000
HTG13        874        191650584
HTG130       1200       192009828
HTG131       1277       191165376
HTG132       1223       191624269
HTG133       1159       172827905
HTG14        749        192110729
HTG15        743        191921974
HTG16        781        192051526
HTG17        803        191886436
HTG18        767        192108035
HTG19        2063       170975488
HTG2         2450       186032194
HTG20        1068       187807593
HTG21        967        189317203
HTG22        6          1514774
HTG23        783        191603739
HTG24        922        190025834
HTG25        901        190315755
HTG26        809        191385146
HTG27        777        191923142
HTG28        865        191139891
HTG29        882        190698357
HTG3         2521       185182868
HTG30        953        189839684
HTG31        896        190966035
HTG32        928        190131907
HTG33        8          2037633
HTG34        869        191018182
HTG35        965        189483972
HTG36        883        191044824
HTG37        861        191237769
HTG38        823        191727728
HTG39        945        190001392
HTG4         2561       188413286
HTG40        931        190596947
HTG41        935        190210055
HTG42        1040       189130068
HTG43        1205       186629025
HTG44        2          447800
HTG45        1260       188090390
HTG46        1173       187815668
HTG47        1151       187889230
HTG48        1118       191276740
HTG49        1271       190652279
HTG5         1284       185519279
HTG50        1177       190961917
HTG51        1129       191051631
HTG52        1037       191355213
HTG53        1019       189616774
HTG54        1120       189398938
HTG55        970        190169796
HTG56        1107       190096598
HTG57        1046       190300011
HTG58        1014       189664607
HTG59        968        189200544
HTG6         1274       185170203
HTG60        92         16208344
HTG61        1010       189318336
HTG62        1030       189823146
HTG63        1067       187350605
HTG64        1128       188162657
HTG65        1011       174017282
HTG66        1086       189582464
HTG67        1066       189417481
HTG68        1170       188701608
HTG69        1174       187595036
HTG7         1275       185326125
HTG70        1286       184359652
HTG71        105        14120535
HTG72        1221       185311372
HTG73        1239       184674446
HTG74        1244       184625496
HTG75        1183       187627905
HTG76        1040       173550426
HTG77        1118       188186640
HTG78        1101       190905728
HTG79        1137       190873267
HTG8         1459       184483094
HTG80        1186       190765939
HTG81        1120       190308789
HTG82        25         4422338
HTG83        1173       190344907
HTG84        1115       190052368
HTG85        1213       189898674
HTG86        1121       189865798
HTG87        1008       172685536
HTG88        1226       188482018
HTG89        1268       187709582
HTG9         1200       186953640
HTG90        1144       190162722
HTG91        1156       189914940
HTG92        1066       182922925
HTG93        1190       189927414
HTG94        1129       190333692
HTG95        1151       190267505
HTG96        1104       190556399
HTG97        1157       190026122
HTG98        1073       190861453
HTG99        1177       191158041
INV1         88084      59752660
INV10        83100      65971384
INV11        41237      31217200
INV12        85921      65001435
INV13        80256      68366456
INV14        37713      105486567
INV2         1597       184882420
INV3         854        148526675
INV4         35502      110653903
INV5         79413      70799415
INV6         27780      121386121
INV7         40843      73832577
INV8         80860      72007210
INV9         60570      87767590
MAM1         12730      165469799
MAM2         52118      111147462
MAM3         32498      125346833
MAM4         80992      74661115
PAT1         222592     70119231
PAT10        124662     102623629
PAT11        98038      63865682
PAT12        141721     62598360
PAT13        105778     59940133
PAT14        103495     50220603
PAT15        121403     53121635
PAT16        112890     61312711
PAT17        39713      16493824
PAT18        147080     52719692
PAT19        154046     77955924
PAT2         194509     84662483
PAT20        104975     118360610
PAT21        133104     95934759
PAT22        84414      77984688
PAT23        123593     103416980
PAT24        119386     105821309
PAT25        145800     86555404
PAT26        175041     64242009
PAT27        71180      1779500
PAT28        102205     77408400
PAT29        93953      87654524
PAT3         171989     95891307
PAT30        119938     61664315
PAT31        96671      78978369
PAT32        128430     55051342
PAT33        92094      51065481
PAT34        111309     78153687
PAT35        138110     29117720
PAT36        158494     24101055
PAT37        114726     49001210
PAT38        88808      90768098
PAT39        107101     72497480
PAT4         153748     106057898
PAT40        100251     75398789
PAT41        160038     12232851
PAT42        77822      35447972
PAT43        135194     108002157
PAT44        167081     97033001
PAT45        116398     127555097
PAT46        196344     76721733
PAT47        80299      127990882
PAT48        27631      180872621
PAT49        185408     93066629
PAT5         57162      23941642
PAT50        274454     6861350
PAT51        202556     46308329
PAT52        132010     90720657
PAT53        82503      91350321
PAT54        57076      1514274
PAT55        342935     8573375
PAT56        188806     88519660
PAT57        111348     132068608
PAT58        3850       194703659
PAT59        131292     110979300
PAT6         170642     91909261
PAT60        154034     52782819
PAT61        227267     32431180
PAT62        250082     15843586
PAT63        171467     69435253
PAT64        140361     94608497
PAT65        159534     72949823
PAT7         154872     88278449
PAT8         131154     97088564
PAT9         129741     101115498
PHG1         4149       33189649
PLN1         59953      93358288
PLN10        36733      73755943
PLN11        14010      137039375
PLN12        7630       35193369
PLN13        17560      144723042
PLN14        17617      146198585
PLN15        17555      146290364
PLN16        23149      127492566
PLN17        3932       153535845
PLN18        1185       170734189
PLN19        495        134850450
PLN2         5077       159858845
PLN20        5          161804357
PLN21        413        169201588
PLN22        20246      50278464
PLN23        67583      69949776
PLN24        28255      30553064
PLN25        77110      76836896
PLN26        57413      89566182
PLN27        9562       138213537
PLN28        25210      133413988
PLN29        77936      75086103
PLN3         1535       182723274
PLN30        94230      63238162
PLN31        40648      32078329
PLN32        80668      72259584
PLN33        78201      76007703
PLN34        82272      70500628
PLN35        96820      66130384
PLN36        93804      66008115
PLN37        36218      64997028
PLN4         1993       190732752
PLN5         15645      153447236
PLN6         76073      79355247
PLN7         7791       8159033
PLN8         73565      76155641
PLN9         37034      49251982
PRI1         23000      59623243
PRI10        1293       179790591
PRI11        677        81616015
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191750406
PRI17        1138       193709944
PRI18        1099       194284788
PRI19        1167       193628453
PRI2         14216      155416058
PRI20        1914       191587583
PRI21        21048      101941362
PRI22        32471      85298122
PRI23        61498      78361060
PRI24        30544      68472730
PRI25        6599       166943400
PRI26        2121       180859994
PRI27        1605       181682300
PRI28        2030       181855518
PRI29        1978       180698659
PRI3         1442       176076379
PRI30        13085      154633754
PRI31        1290       182850037
PRI32        44510      103535150
PRI33        20778      26548646
PRI34        32258      63794651
PRI35        20317      117929100
PRI36        19116      145712835
PRI37        67542      87517203
PRI38        61518      84793668
PRI39        43210      80543933
PRI4         1291       186566909
PRI5         1305       182845348
PRI6         1189       180931436
PRI7         1242       180909108
PRI8         1230       177748301
PRI9         1346       174678115
ROD1         29504      144857574
ROD10        975        181268212
ROD11        32         5552055
ROD12        1036       185695241
ROD13        941        182821513
ROD14        1038       189314524
ROD15        950        180262138
ROD16        966        181908034
ROD17        994        185933619
ROD18        8576       177712769
ROD19        8537       16576499
ROD2         912        174961028
ROD20        20161      149007208
ROD21        1137       182391172
ROD22        1061       165449321
ROD23        13731      162805392
ROD24        38619      69912056
ROD25        21748      105133042
ROD26        1503       187964614
ROD27        137627     34576660
ROD28        65201      61855407
ROD3         911        173305253
ROD4         901        173922850
ROD5         929        174094986
ROD6         981        179089083
ROD7         956        179726978
ROD8         994        181886274
ROD9         996        182118913
STS1         84833      36485693
STS10        57907      44419978
STS11        49213      37736560
STS12        57924      43637361
STS13        64551      42980742
STS14        93413      34049365
STS15        103343     26267125
STS16        10841      2934356
STS17        102913     27263965
STS18        86856      34266062
STS19        98933      33239270
STS2         84925      49968955
STS20        43321      14181837
STS3         70538      26667728
STS4         73630      37206308
STS5         6080       3577544
STS6         54177      31603126
STS7         54081      31788805
STS8         54235      31906296
STS9         55657      37682948
SYN1         47896      72188115
SYN2         38737      51722377
TSA1         51641      23426202
UNA1         218        117659
VRL1         71945      66546631
VRL10        65460      74561473
VRL11        23899      23327560
VRL2         71615      64700830
VRL3         72243      63668591
VRL4         69608      69334940
VRL5         24596      29507520
VRL6         57654      73508634
VRL7         62336      72706621
VRL8         68341      67502779
VRL9         55142      74558107
VRT1         25488      151200491
VRT10        8904       177126820
VRT11        3112       101363221
VRT12        13268      170678994
VRT13        5187       183174974
VRT14        4021       185963954
VRT15        55598      105860146
VRT16        79986      69234919
VRT17        78322      67197718
VRT18        22601      24037643
VRT2         38812      136201031
VRT3         34926      133166976
VRT4         37871      105644411
VRT5         73001      66792369
VRT6         31746      63585286
VRT7         20997      133151998
VRT8         1221       189843295
VRT9         1271       189205637

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 170.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

12356641 13434048990   Homo sapiens
7279663   8413454413   Mus musculus
1761820   6062786202   Rattus norvegicus
2087489   5248593559   Bos taurus
3785081   4959749043   Zea mays
2549469   3917008407   Sus scrofa
1686074   3048930986   Danio rerio
1213939   1545075149   Oryza sativa Japonica Group
228118    1352796133   Strongylocentrotus purpuratus
1423013   1146676820   Xenopus (Silurana) tropicalis
1675719   1144359189   Nicotiana tabacum
1195886   1032101570   Drosophila melanogaster
213067     997314145   Pan troglodytes
2230397    938991402   Arabidopsis thaliana
1433313    927847792   Canis lupus familiaris
651273     906384104   Vitis vinifera
805911     878632145   Gallus gallus
77877      805813840   Macaca mulatta
1216101    748118121   Ciona intestinalis
1780681    720743480   Glycine max

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          February 15 2009

                NCBI-GenBank Flat File Release 170.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 PROJECT Format

  This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
PROJECT     GenomeProject:18787

  A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second 
contains the actual project identifier ("18787").

  PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 170.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev

User Support
	Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center