Release Notes For GenBank Release 171

GBREL.TXT          Genetic Sequence Data Bank
                         April 15 2009

               NCBI-GenBank Flat File Release 171.0

                    Distribution Release Notes

 103335421 loci, 102980268709 bases, from 103335421 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 171.0
1.2 Cutoff Date
1.3 Important Changes in Release 171.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 171.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 171.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:

	ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/  (Japan)
	ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/  (Korea)
	ftp://bio-mirror.sg.apan.net/biomirrors/genbank/     (Singapore)

1.2 Cutoff Date

  This full release, 171.0, incorporates data available to the collaborating
databases as of April 10, 2009 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 171.0

1.3.1 PROJECT linetype to be replaced by DBLINK (April 2009)

  The new DBLINK linetype was introduced as of the February 2009
GenBank Release 170.0.

  Genome Project IDs and Trace Assembly Archive IDs are now presented
via DBLINK, in conjunction with the legacy PROJECT linetype, as this
mock-up for CP000964 illustrates:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
PROJECT     GenomeProject:28471
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

PROJECT and DBLINK have co-existed for GenBank releases 170.0 and 171.0 .
But subsequent to this April release, the PROJECT line will be removed from the
flatfile format. In its final state, the above mock-up for CP000964 becomes:

LOCUS       CP000964             5641239 bp    DNA     circular BCT 24-SEP-2008
DEFINITION  Klebsiella pneumoniae 342, complete genome.
ACCESSION   CP000964
VERSION     CP000964.1  GI:206564770
DBLINK      Project:28471
            Trace Assembly Archive:123456
....
COMMENT     The source for the DNA and/or cells is:  Professor Eric W.
            Triplett, Chair, Department of Microbiology and Cell Science,
            Institute of Food and Agricultural Sciences, University of Florida,
            P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.

  In summary: The PROJECT linetype will cease to be displayed in post-171.0
GenBank Update data products within the next two weeks. The same will be
true of all future complete GenBank releases.

1.3.2 Organizational changes

The total number of sequence data files increased by 34 with this release:

  - the BCT division is now composed of  40 files (+2)
  - the CON division is now composed of 131 files (+3)
  - the ENV division is now composed of  13 files (+1)
  - the EST division is now composed of 860 files (+22)
  - the GSS division is now composed of 335 files (+13)
  - the INV division is now composed of  15 files (+1)
  - the MAM division is now composed of   5 files (+1)
  - the PAT division is now composed of  67 files (+2)
  - the PLN division is now composed of  38 files (+1)

1.3.3 CON-division records for 'segmented sets' restored.

  A previously overlooked problem in Release 170.0 processing resulted in
the exclusion of roughly 14,000 CON-division entries for a type of record
referred to as a 'segmented set'. Segmented sets consist of small sequence
fragments of an incompletely sequenced molecule, packaged together, with a
top-level sequence that specifies the order of the underlying fragments.
That top-level sequence can be displayed as a CON division record. AH000819
is an example:

ASN.1 for AH000819:

      http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/405204?report=asn1&log$=seqview

Flatfile view of the nine sequenced fragments:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/405204

These (largely legacy) CON-division records have been restored in
Release 171.0 and can be found in gbcon131.seq .

1.3.4 File header problem for EST and GSS files

  A new method of generating the EST and GSS sequence files has been 
developed, which has reduced the time required to generate a GenBank
release by one day. However, a minor problem in the formatting of the
header of the sequence files was inadvertently introduced : a leading 
space exists before the filename on the very first line. For example:

 GBGSS100.SEQ          Genetic Sequence Data Bank                              
                         April 15 2009                                         

It should be:

GBGSS100.SEQ          Genetic Sequence Data Bank                              
                         April 15 2009                                         

The problem effects all EST files and most GSS files. We doubt that it
will cause significant problems for users, however the problem will be
corrected for our next release.

1.3.5 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.6 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
seventy-two of the GSS flatfiles in Release 171.0. Consider gbgss264.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                           April 15 2009

                NCBI-GenBank Flat File Release 171.0

                           GSS Sequences (Part 1)

   87206 loci,    64290178 bases, from    87206 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "254" based on the number of files dumped from the other
system.  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.

1.4 Upcoming Changes

  There are no scheduled format changes for GenBank.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1858 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut7.idx - Index of the entries according to author name, part 7.
67. gbaut8.idx - Index of the entries according to author name, part 8.
68. gbaut9.idx - Index of the entries according to author name, part 9.
69. gbbct1.seq - Bacterial sequence entries, part 1.
70. gbbct10.seq - Bacterial sequence entries, part 10.
71. gbbct11.seq - Bacterial sequence entries, part 11.
72. gbbct12.seq - Bacterial sequence entries, part 12.
73. gbbct13.seq - Bacterial sequence entries, part 13.
74. gbbct14.seq - Bacterial sequence entries, part 14.
75. gbbct15.seq - Bacterial sequence entries, part 15.
76. gbbct16.seq - Bacterial sequence entries, part 16.
77. gbbct17.seq - Bacterial sequence entries, part 17.
78. gbbct18.seq - Bacterial sequence entries, part 18.
79. gbbct19.seq - Bacterial sequence entries, part 19.
80. gbbct2.seq - Bacterial sequence entries, part 2.
81. gbbct20.seq - Bacterial sequence entries, part 20.
82. gbbct21.seq - Bacterial sequence entries, part 21.
83. gbbct22.seq - Bacterial sequence entries, part 22.
84. gbbct23.seq - Bacterial sequence entries, part 23.
85. gbbct24.seq - Bacterial sequence entries, part 24.
86. gbbct25.seq - Bacterial sequence entries, part 25.
87. gbbct26.seq - Bacterial sequence entries, part 26.
88. gbbct27.seq - Bacterial sequence entries, part 27.
89. gbbct28.seq - Bacterial sequence entries, part 28.
90. gbbct29.seq - Bacterial sequence entries, part 29.
91. gbbct3.seq - Bacterial sequence entries, part 3.
92. gbbct30.seq - Bacterial sequence entries, part 30.
93. gbbct31.seq - Bacterial sequence entries, part 31.
94. gbbct32.seq - Bacterial sequence entries, part 32.
95. gbbct33.seq - Bacterial sequence entries, part 33.
96. gbbct34.seq - Bacterial sequence entries, part 34.
97. gbbct35.seq - Bacterial sequence entries, part 35.
98. gbbct36.seq - Bacterial sequence entries, part 36.
99. gbbct37.seq - Bacterial sequence entries, part 37.
100. gbbct38.seq - Bacterial sequence entries, part 38.
101. gbbct39.seq - Bacterial sequence entries, part 39.
102. gbbct4.seq - Bacterial sequence entries, part 4.
103. gbbct40.seq - Bacterial sequence entries, part 40.
104. gbbct5.seq - Bacterial sequence entries, part 5.
105. gbbct6.seq - Bacterial sequence entries, part 6.
106. gbbct7.seq - Bacterial sequence entries, part 7.
107. gbbct8.seq - Bacterial sequence entries, part 8.
108. gbbct9.seq - Bacterial sequence entries, part 9.
109. gbchg.txt - Accession numbers of entries updated since the previous release.
110. gbcon1.seq - Constructed sequence entries, part 1.
111. gbcon10.seq - Constructed sequence entries, part 10.
112. gbcon100.seq - Constructed sequence entries, part 100.
113. gbcon101.seq - Constructed sequence entries, part 101.
114. gbcon102.seq - Constructed sequence entries, part 102.
115. gbcon103.seq - Constructed sequence entries, part 103.
116. gbcon104.seq - Constructed sequence entries, part 104.
117. gbcon105.seq - Constructed sequence entries, part 105.
118. gbcon106.seq - Constructed sequence entries, part 106.
119. gbcon107.seq - Constructed sequence entries, part 107.
120. gbcon108.seq - Constructed sequence entries, part 108.
121. gbcon109.seq - Constructed sequence entries, part 109.
122. gbcon11.seq - Constructed sequence entries, part 11.
123. gbcon110.seq - Constructed sequence entries, part 110.
124. gbcon111.seq - Constructed sequence entries, part 111.
125. gbcon112.seq - Constructed sequence entries, part 112.
126. gbcon113.seq - Constructed sequence entries, part 113.
127. gbcon114.seq - Constructed sequence entries, part 114.
128. gbcon115.seq - Constructed sequence entries, part 115.
129. gbcon116.seq - Constructed sequence entries, part 116.
130. gbcon117.seq - Constructed sequence entries, part 117.
131. gbcon118.seq - Constructed sequence entries, part 118.
132. gbcon119.seq - Constructed sequence entries, part 119.
133. gbcon12.seq - Constructed sequence entries, part 12.
134. gbcon120.seq - Constructed sequence entries, part 120.
135. gbcon121.seq - Constructed sequence entries, part 121.
136. gbcon122.seq - Constructed sequence entries, part 122.
137. gbcon123.seq - Constructed sequence entries, part 123.
138. gbcon124.seq - Constructed sequence entries, part 124.
139. gbcon125.seq - Constructed sequence entries, part 125.
140. gbcon126.seq - Constructed sequence entries, part 126.
141. gbcon127.seq - Constructed sequence entries, part 127.
142. gbcon128.seq - Constructed sequence entries, part 128.
143. gbcon129.seq - Constructed sequence entries, part 129.
144. gbcon13.seq - Constructed sequence entries, part 13.
145. gbcon130.seq - Constructed sequence entries, part 130.
146. gbcon131.seq - Constructed sequence entries, part 131.
147. gbcon14.seq - Constructed sequence entries, part 14.
148. gbcon15.seq - Constructed sequence entries, part 15.
149. gbcon16.seq - Constructed sequence entries, part 16.
150. gbcon17.seq - Constructed sequence entries, part 17.
151. gbcon18.seq - Constructed sequence entries, part 18.
152. gbcon19.seq - Constructed sequence entries, part 19.
153. gbcon2.seq - Constructed sequence entries, part 2.
154. gbcon20.seq - Constructed sequence entries, part 20.
155. gbcon21.seq - Constructed sequence entries, part 21.
156. gbcon22.seq - Constructed sequence entries, part 22.
157. gbcon23.seq - Constructed sequence entries, part 23.
158. gbcon24.seq - Constructed sequence entries, part 24.
159. gbcon25.seq - Constructed sequence entries, part 25.
160. gbcon26.seq - Constructed sequence entries, part 26.
161. gbcon27.seq - Constructed sequence entries, part 27.
162. gbcon28.seq - Constructed sequence entries, part 28.
163. gbcon29.seq - Constructed sequence entries, part 29.
164. gbcon3.seq - Constructed sequence entries, part 3.
165. gbcon30.seq - Constructed sequence entries, part 30.
166. gbcon31.seq - Constructed sequence entries, part 31.
167. gbcon32.seq - Constructed sequence entries, part 32.
168. gbcon33.seq - Constructed sequence entries, part 33.
169. gbcon34.seq - Constructed sequence entries, part 34.
170. gbcon35.seq - Constructed sequence entries, part 35.
171. gbcon36.seq - Constructed sequence entries, part 36.
172. gbcon37.seq - Constructed sequence entries, part 37.
173. gbcon38.seq - Constructed sequence entries, part 38.
174. gbcon39.seq - Constructed sequence entries, part 39.
175. gbcon4.seq - Constructed sequence entries, part 4.
176. gbcon40.seq - Constructed sequence entries, part 40.
177. gbcon41.seq - Constructed sequence entries, part 41.
178. gbcon42.seq - Constructed sequence entries, part 42.
179. gbcon43.seq - Constructed sequence entries, part 43.
180. gbcon44.seq - Constructed sequence entries, part 44.
181. gbcon45.seq - Constructed sequence entries, part 45.
182. gbcon46.seq - Constructed sequence entries, part 46.
183. gbcon47.seq - Constructed sequence entries, part 47.
184. gbcon48.seq - Constructed sequence entries, part 48.
185. gbcon49.seq - Constructed sequence entries, part 49.
186. gbcon5.seq - Constructed sequence entries, part 5.
187. gbcon50.seq - Constructed sequence entries, part 50.
188. gbcon51.seq - Constructed sequence entries, part 51.
189. gbcon52.seq - Constructed sequence entries, part 52.
190. gbcon53.seq - Constructed sequence entries, part 53.
191. gbcon54.seq - Constructed sequence entries, part 54.
192. gbcon55.seq - Constructed sequence entries, part 55.
193. gbcon56.seq - Constructed sequence entries, part 56.
194. gbcon57.seq - Constructed sequence entries, part 57.
195. gbcon58.seq - Constructed sequence entries, part 58.
196. gbcon59.seq - Constructed sequence entries, part 59.
197. gbcon6.seq - Constructed sequence entries, part 6.
198. gbcon60.seq - Constructed sequence entries, part 60.
199. gbcon61.seq - Constructed sequence entries, part 61.
200. gbcon62.seq - Constructed sequence entries, part 62.
201. gbcon63.seq - Constructed sequence entries, part 63.
202. gbcon64.seq - Constructed sequence entries, part 64.
203. gbcon65.seq - Constructed sequence entries, part 65.
204. gbcon66.seq - Constructed sequence entries, part 66.
205. gbcon67.seq - Constructed sequence entries, part 67.
206. gbcon68.seq - Constructed sequence entries, part 68.
207. gbcon69.seq - Constructed sequence entries, part 69.
208. gbcon7.seq - Constructed sequence entries, part 7.
209. gbcon70.seq - Constructed sequence entries, part 70.
210. gbcon71.seq - Constructed sequence entries, part 71.
211. gbcon72.seq - Constructed sequence entries, part 72.
212. gbcon73.seq - Constructed sequence entries, part 73.
213. gbcon74.seq - Constructed sequence entries, part 74.
214. gbcon75.seq - Constructed sequence entries, part 75.
215. gbcon76.seq - Constructed sequence entries, part 76.
216. gbcon77.seq - Constructed sequence entries, part 77.
217. gbcon78.seq - Constructed sequence entries, part 78.
218. gbcon79.seq - Constructed sequence entries, part 79.
219. gbcon8.seq - Constructed sequence entries, part 8.
220. gbcon80.seq - Constructed sequence entries, part 80.
221. gbcon81.seq - Constructed sequence entries, part 81.
222. gbcon82.seq - Constructed sequence entries, part 82.
223. gbcon83.seq - Constructed sequence entries, part 83.
224. gbcon84.seq - Constructed sequence entries, part 84.
225. gbcon85.seq - Constructed sequence entries, part 85.
226. gbcon86.seq - Constructed sequence entries, part 86.
227. gbcon87.seq - Constructed sequence entries, part 87.
228. gbcon88.seq - Constructed sequence entries, part 88.
229. gbcon89.seq - Constructed sequence entries, part 89.
230. gbcon9.seq - Constructed sequence entries, part 9.
231. gbcon90.seq - Constructed sequence entries, part 90.
232. gbcon91.seq - Constructed sequence entries, part 91.
233. gbcon92.seq - Constructed sequence entries, part 92.
234. gbcon93.seq - Constructed sequence entries, part 93.
235. gbcon94.seq - Constructed sequence entries, part 94.
236. gbcon95.seq - Constructed sequence entries, part 95.
237. gbcon96.seq - Constructed sequence entries, part 96.
238. gbcon97.seq - Constructed sequence entries, part 97.
239. gbcon98.seq - Constructed sequence entries, part 98.
240. gbcon99.seq - Constructed sequence entries, part 99.
241. gbdel.txt - Accession numbers of entries deleted since the previous release.
242. gbenv1.seq - Environmental sampling sequence entries, part 1.
243. gbenv10.seq - Environmental sampling sequence entries, part 10.
244. gbenv11.seq - Environmental sampling sequence entries, part 11.
245. gbenv12.seq - Environmental sampling sequence entries, part 12.
246. gbenv13.seq - Environmental sampling sequence entries, part 13.
247. gbenv2.seq - Environmental sampling sequence entries, part 2.
248. gbenv3.seq - Environmental sampling sequence entries, part 3.
249. gbenv4.seq - Environmental sampling sequence entries, part 4.
250. gbenv5.seq - Environmental sampling sequence entries, part 5.
251. gbenv6.seq - Environmental sampling sequence entries, part 6.
252. gbenv7.seq - Environmental sampling sequence entries, part 7.
253. gbenv8.seq - Environmental sampling sequence entries, part 8.
254. gbenv9.seq - Environmental sampling sequence entries, part 9.
255. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
256. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
257. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
258. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
259. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
260. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
261. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
262. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
263. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
264. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
265. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
266. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
267. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
268. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
269. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
270. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
271. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
272. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
273. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
274. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
275. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
276. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
277. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
278. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
279. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
280. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
281. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
282. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
283. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
284. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
285. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
286. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
287. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
288. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
289. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
290. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
291. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
292. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
293. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
294. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
295. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
296. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
297. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
298. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
299. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
300. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
301. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
302. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
303. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
304. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
305. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
306. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
307. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
308. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
309. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
310. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
311. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
312. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
313. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
314. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
315. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
316. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
317. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
318. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
319. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
320. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
321. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
322. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
323. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
324. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
325. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
326. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
327. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
328. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
329. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
330. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
331. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
332. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
333. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
334. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
335. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
336. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
337. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
338. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
339. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
340. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
341. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
342. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
343. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
344. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
345. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
346. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
347. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
348. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
349. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
350. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
351. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
352. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
353. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
354. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
355. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
356. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
357. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
358. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
359. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
360. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
361. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
362. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
363. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
364. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
365. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
366. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
367. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
368. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
369. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
370. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
371. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
372. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
373. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
374. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
375. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
376. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
377. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
378. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
379. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
380. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
381. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
382. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
383. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
384. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
385. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
386. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
387. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
388. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
389. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
390. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
391. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
392. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
393. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
394. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
395. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
396. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
397. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
398. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
399. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
400. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
401. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
402. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
403. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
404. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
405. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
406. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
407. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
408. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
409. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
410. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
411. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
412. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
413. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
414. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
415. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
416. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
417. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
418. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
419. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
420. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
421. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
422. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
423. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
424. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
425. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
426. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
427. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
428. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
429. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
430. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
431. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
432. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
433. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
434. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
435. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
436. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
437. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
438. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
439. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
440. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
441. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
442. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
443. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
444. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
445. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
446. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
447. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
448. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
449. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
450. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
451. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
452. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
453. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
454. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
455. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
456. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
457. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
458. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
459. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
460. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
461. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
462. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
463. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
464. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
465. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
466. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
467. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
468. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
469. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
470. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
471. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
472. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
473. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
474. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
475. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
476. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
477. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
478. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
479. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
480. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
481. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
482. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
483. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
484. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
485. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
486. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
487. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
488. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
489. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
490. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
491. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
492. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
493. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
494. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
495. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
496. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
497. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
498. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
499. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
500. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
501. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
502. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
503. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
504. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
505. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
506. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
507. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
508. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
509. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
510. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
511. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
512. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
513. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
514. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
515. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
516. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
517. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
518. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
519. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
520. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
521. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
522. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
523. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
524. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
525. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
526. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
527. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
528. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
529. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
530. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
531. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
532. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
533. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
534. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
535. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
536. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
537. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
538. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
539. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
540. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
541. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
542. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
543. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
544. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
545. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
546. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
547. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
548. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
549. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
550. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
551. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
552. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
553. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
554. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
555. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
556. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
557. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
558. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
559. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
560. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
561. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
562. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
563. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
564. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
565. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
566. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
567. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
568. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
569. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
570. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
571. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
572. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
573. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
574. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
575. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
576. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
577. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
578. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
579. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
580. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
581. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
582. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
583. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
584. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
585. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
586. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
587. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
588. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
589. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
590. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
591. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
592. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
593. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
594. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
595. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
596. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
597. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
598. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
599. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
600. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
601. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
602. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
603. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
604. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
605. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
606. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
607. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
608. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
609. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
610. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
611. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
612. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
613. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
614. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
615. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
616. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
617. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
618. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
619. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
620. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
621. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
622. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
623. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
624. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
625. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
626. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
627. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
628. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
629. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
630. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
631. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
632. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
633. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
634. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
635. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
636. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
637. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
638. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
639. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
640. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
641. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
642. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
643. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
644. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
645. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
646. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
647. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
648. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
649. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
650. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
651. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
652. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
653. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
654. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
655. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
656. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
657. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
658. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
659. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
660. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
661. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
662. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
663. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
664. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
665. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
666. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
667. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
668. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
669. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
670. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
671. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
672. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
673. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
674. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
675. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
676. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
677. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
678. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
679. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
680. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
681. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
682. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
683. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
684. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
685. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
686. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
687. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
688. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
689. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
690. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
691. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
692. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
693. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
694. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
695. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
696. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
697. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
698. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
699. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
700. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
701. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
702. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
703. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
704. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
705. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
706. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
707. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
708. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
709. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
710. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
711. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
712. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
713. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
714. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
715. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
716. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
717. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
718. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
719. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
720. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
721. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
722. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
723. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
724. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
725. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
726. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
727. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
728. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
729. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
730. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
731. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
732. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
733. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
734. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
735. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
736. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
737. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
738. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
739. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
740. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
741. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
742. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
743. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
744. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
745. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
746. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
747. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
748. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
749. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
750. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
751. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
752. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
753. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
754. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
755. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
756. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
757. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
758. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
759. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
760. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
761. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
762. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
763. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
764. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
765. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
766. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
767. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
768. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
769. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
770. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
771. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
772. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
773. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
774. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
775. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
776. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
777. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
778. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
779. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
780. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
781. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
782. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
783. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
784. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
785. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
786. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
787. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
788. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
789. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
790. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
791. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
792. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
793. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
794. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
795. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
796. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
797. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
798. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
799. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
800. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
801. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
802. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
803. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
804. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
805. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
806. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
807. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
808. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
809. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
810. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
811. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
812. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
813. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
814. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
815. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
816. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
817. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
818. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
819. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
820. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
821. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
822. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
823. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
824. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
825. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
826. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
827. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
828. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
829. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
830. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
831. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
832. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
833. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
834. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
835. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
836. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
837. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
838. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
839. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
840. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
841. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
842. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
843. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
844. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
845. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
846. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
847. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
848. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
849. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
850. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
851. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
852. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
853. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
854. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
855. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
856. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
857. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
858. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
859. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
860. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
861. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
862. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
863. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
864. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
865. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
866. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
867. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
868. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
869. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
870. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
871. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
872. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
873. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
874. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
875. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
876. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
877. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
878. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
879. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
880. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
881. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
882. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
883. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
884. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
885. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
886. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
887. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
888. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
889. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
890. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
891. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
892. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
893. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
894. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
895. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
896. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
897. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
898. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
899. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
900. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
901. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
902. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
903. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
904. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
905. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
906. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
907. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
908. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
909. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
910. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
911. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
912. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
913. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
914. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
915. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
916. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
917. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
918. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
919. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
920. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
921. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
922. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
923. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
924. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
925. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
926. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
927. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
928. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
929. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
930. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
931. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
932. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
933. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
934. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
935. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
936. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
937. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
938. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
939. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
940. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
941. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
942. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
943. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
944. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
945. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
946. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
947. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
948. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
949. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
950. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
951. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
952. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
953. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
954. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
955. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
956. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
957. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
958. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
959. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
960. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
961. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
962. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
963. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
964. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
965. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
966. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
967. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
968. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
969. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
970. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
971. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
972. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
973. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
974. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
975. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
976. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
977. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
978. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
979. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
980. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
981. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
982. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
983. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
984. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
985. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
986. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
987. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
988. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
989. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
990. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
991. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
992. gbest763.seq - EST (expressed sequence tag) sequence entries, part 763.
993. gbest764.seq - EST (expressed sequence tag) sequence entries, part 764.
994. gbest765.seq - EST (expressed sequence tag) sequence entries, part 765.
995. gbest766.seq - EST (expressed sequence tag) sequence entries, part 766.
996. gbest767.seq - EST (expressed sequence tag) sequence entries, part 767.
997. gbest768.seq - EST (expressed sequence tag) sequence entries, part 768.
998. gbest769.seq - EST (expressed sequence tag) sequence entries, part 769.
999. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1000. gbest770.seq - EST (expressed sequence tag) sequence entries, part 770.
1001. gbest771.seq - EST (expressed sequence tag) sequence entries, part 771.
1002. gbest772.seq - EST (expressed sequence tag) sequence entries, part 772.
1003. gbest773.seq - EST (expressed sequence tag) sequence entries, part 773.
1004. gbest774.seq - EST (expressed sequence tag) sequence entries, part 774.
1005. gbest775.seq - EST (expressed sequence tag) sequence entries, part 775.
1006. gbest776.seq - EST (expressed sequence tag) sequence entries, part 776.
1007. gbest777.seq - EST (expressed sequence tag) sequence entries, part 777.
1008. gbest778.seq - EST (expressed sequence tag) sequence entries, part 778.
1009. gbest779.seq - EST (expressed sequence tag) sequence entries, part 779.
1010. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1011. gbest780.seq - EST (expressed sequence tag) sequence entries, part 780.
1012. gbest781.seq - EST (expressed sequence tag) sequence entries, part 781.
1013. gbest782.seq - EST (expressed sequence tag) sequence entries, part 782.
1014. gbest783.seq - EST (expressed sequence tag) sequence entries, part 783.
1015. gbest784.seq - EST (expressed sequence tag) sequence entries, part 784.
1016. gbest785.seq - EST (expressed sequence tag) sequence entries, part 785.
1017. gbest786.seq - EST (expressed sequence tag) sequence entries, part 786.
1018. gbest787.seq - EST (expressed sequence tag) sequence entries, part 787.
1019. gbest788.seq - EST (expressed sequence tag) sequence entries, part 788.
1020. gbest789.seq - EST (expressed sequence tag) sequence entries, part 789.
1021. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1022. gbest790.seq - EST (expressed sequence tag) sequence entries, part 790.
1023. gbest791.seq - EST (expressed sequence tag) sequence entries, part 791.
1024. gbest792.seq - EST (expressed sequence tag) sequence entries, part 792.
1025. gbest793.seq - EST (expressed sequence tag) sequence entries, part 793.
1026. gbest794.seq - EST (expressed sequence tag) sequence entries, part 794.
1027. gbest795.seq - EST (expressed sequence tag) sequence entries, part 795.
1028. gbest796.seq - EST (expressed sequence tag) sequence entries, part 796.
1029. gbest797.seq - EST (expressed sequence tag) sequence entries, part 797.
1030. gbest798.seq - EST (expressed sequence tag) sequence entries, part 798.
1031. gbest799.seq - EST (expressed sequence tag) sequence entries, part 799.
1032. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1033. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1034. gbest800.seq - EST (expressed sequence tag) sequence entries, part 800.
1035. gbest801.seq - EST (expressed sequence tag) sequence entries, part 801.
1036. gbest802.seq - EST (expressed sequence tag) sequence entries, part 802.
1037. gbest803.seq - EST (expressed sequence tag) sequence entries, part 803.
1038. gbest804.seq - EST (expressed sequence tag) sequence entries, part 804.
1039. gbest805.seq - EST (expressed sequence tag) sequence entries, part 805.
1040. gbest806.seq - EST (expressed sequence tag) sequence entries, part 806.
1041. gbest807.seq - EST (expressed sequence tag) sequence entries, part 807.
1042. gbest808.seq - EST (expressed sequence tag) sequence entries, part 808.
1043. gbest809.seq - EST (expressed sequence tag) sequence entries, part 809.
1044. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1045. gbest810.seq - EST (expressed sequence tag) sequence entries, part 810.
1046. gbest811.seq - EST (expressed sequence tag) sequence entries, part 811.
1047. gbest812.seq - EST (expressed sequence tag) sequence entries, part 812.
1048. gbest813.seq - EST (expressed sequence tag) sequence entries, part 813.
1049. gbest814.seq - EST (expressed sequence tag) sequence entries, part 814.
1050. gbest815.seq - EST (expressed sequence tag) sequence entries, part 815.
1051. gbest816.seq - EST (expressed sequence tag) sequence entries, part 816.
1052. gbest817.seq - EST (expressed sequence tag) sequence entries, part 817.
1053. gbest818.seq - EST (expressed sequence tag) sequence entries, part 818.
1054. gbest819.seq - EST (expressed sequence tag) sequence entries, part 819.
1055. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1056. gbest820.seq - EST (expressed sequence tag) sequence entries, part 820.
1057. gbest821.seq - EST (expressed sequence tag) sequence entries, part 821.
1058. gbest822.seq - EST (expressed sequence tag) sequence entries, part 822.
1059. gbest823.seq - EST (expressed sequence tag) sequence entries, part 823.
1060. gbest824.seq - EST (expressed sequence tag) sequence entries, part 824.
1061. gbest825.seq - EST (expressed sequence tag) sequence entries, part 825.
1062. gbest826.seq - EST (expressed sequence tag) sequence entries, part 826.
1063. gbest827.seq - EST (expressed sequence tag) sequence entries, part 827.
1064. gbest828.seq - EST (expressed sequence tag) sequence entries, part 828.
1065. gbest829.seq - EST (expressed sequence tag) sequence entries, part 829.
1066. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1067. gbest830.seq - EST (expressed sequence tag) sequence entries, part 830.
1068. gbest831.seq - EST (expressed sequence tag) sequence entries, part 831.
1069. gbest832.seq - EST (expressed sequence tag) sequence entries, part 832.
1070. gbest833.seq - EST (expressed sequence tag) sequence entries, part 833.
1071. gbest834.seq - EST (expressed sequence tag) sequence entries, part 834.
1072. gbest835.seq - EST (expressed sequence tag) sequence entries, part 835.
1073. gbest836.seq - EST (expressed sequence tag) sequence entries, part 836.
1074. gbest837.seq - EST (expressed sequence tag) sequence entries, part 837.
1075. gbest838.seq - EST (expressed sequence tag) sequence entries, part 838.
1076. gbest839.seq - EST (expressed sequence tag) sequence entries, part 839.
1077. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1078. gbest840.seq - EST (expressed sequence tag) sequence entries, part 840.
1079. gbest841.seq - EST (expressed sequence tag) sequence entries, part 841.
1080. gbest842.seq - EST (expressed sequence tag) sequence entries, part 842.
1081. gbest843.seq - EST (expressed sequence tag) sequence entries, part 843.
1082. gbest844.seq - EST (expressed sequence tag) sequence entries, part 844.
1083. gbest845.seq - EST (expressed sequence tag) sequence entries, part 845.
1084. gbest846.seq - EST (expressed sequence tag) sequence entries, part 846.
1085. gbest847.seq - EST (expressed sequence tag) sequence entries, part 847.
1086. gbest848.seq - EST (expressed sequence tag) sequence entries, part 848.
1087. gbest849.seq - EST (expressed sequence tag) sequence entries, part 849.
1088. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1089. gbest850.seq - EST (expressed sequence tag) sequence entries, part 850.
1090. gbest851.seq - EST (expressed sequence tag) sequence entries, part 851.
1091. gbest852.seq - EST (expressed sequence tag) sequence entries, part 852.
1092. gbest853.seq - EST (expressed sequence tag) sequence entries, part 853.
1093. gbest854.seq - EST (expressed sequence tag) sequence entries, part 854.
1094. gbest855.seq - EST (expressed sequence tag) sequence entries, part 855.
1095. gbest856.seq - EST (expressed sequence tag) sequence entries, part 856.
1096. gbest857.seq - EST (expressed sequence tag) sequence entries, part 857.
1097. gbest858.seq - EST (expressed sequence tag) sequence entries, part 858.
1098. gbest859.seq - EST (expressed sequence tag) sequence entries, part 859.
1099. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1100. gbest860.seq - EST (expressed sequence tag) sequence entries, part 860.
1101. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1102. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1103. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1104. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1105. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1106. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1107. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1108. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1109. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1110. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1111. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1112. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1113. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1114. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1115. gbgen.idx - Index of the entries according to gene symbols.
1116. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1117. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1118. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1119. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1120. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1121. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1122. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1123. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1124. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1125. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1126. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1127. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1128. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1129. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1130. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1131. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1132. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1133. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1134. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1135. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1136. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1137. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1138. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1139. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1140. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1141. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1142. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1143. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1144. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1145. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1146. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1147. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1148. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1149. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1150. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1151. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1152. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1153. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1154. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1155. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1156. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1157. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1158. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1159. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1160. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1161. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1162. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1163. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1164. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1165. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1166. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1167. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1168. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1169. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1170. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1171. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1172. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1173. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1174. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1175. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1176. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1177. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1178. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1179. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1180. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1181. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1182. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1183. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1184. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1185. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1186. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1187. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1188. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1189. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1190. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1191. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1192. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1193. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1194. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1195. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1196. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1197. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1198. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1199. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1200. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1201. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1202. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1203. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1204. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1205. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1206. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1207. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1208. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1209. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1210. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1211. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1212. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1213. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1214. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1215. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1216. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1217. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1218. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1219. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1220. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1221. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1222. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1223. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1224. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1225. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1226. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1227. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1228. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1229. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1230. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1231. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1232. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1233. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1234. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1235. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1236. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1237. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1238. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1239. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1240. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1241. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1242. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1243. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1244. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1245. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1246. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1247. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1248. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1249. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1250. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1251. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1252. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1253. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1254. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1255. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1256. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1257. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1258. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1259. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1260. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1261. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1262. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1263. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1264. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1265. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1266. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1267. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1268. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1269. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1270. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1271. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1272. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1273. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1274. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1275. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1276. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1277. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1278. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1279. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1280. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1281. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1282. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1283. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1284. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1285. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1286. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1287. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1288. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1289. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1290. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1291. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1292. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1293. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1294. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1295. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1296. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1297. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1298. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1299. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1300. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1301. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1302. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1303. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1304. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1305. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1306. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1307. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1308. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1309. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1310. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1311. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1312. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1313. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1314. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1315. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1316. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1317. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1318. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1319. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1320. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1321. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1322. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1323. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1324. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1325. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1326. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1327. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1328. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1329. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1330. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1331. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1332. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1333. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1334. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1335. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1336. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1337. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1338. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1339. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1340. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1341. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1342. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1343. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1344. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1345. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1346. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1347. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1348. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1349. gbgss309.seq - GSS (genome survey sequence) sequence entries, part 309.
1350. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1351. gbgss310.seq - GSS (genome survey sequence) sequence entries, part 310.
1352. gbgss311.seq - GSS (genome survey sequence) sequence entries, part 311.
1353. gbgss312.seq - GSS (genome survey sequence) sequence entries, part 312.
1354. gbgss313.seq - GSS (genome survey sequence) sequence entries, part 313.
1355. gbgss314.seq - GSS (genome survey sequence) sequence entries, part 314.
1356. gbgss315.seq - GSS (genome survey sequence) sequence entries, part 315.
1357. gbgss316.seq - GSS (genome survey sequence) sequence entries, part 316.
1358. gbgss317.seq - GSS (genome survey sequence) sequence entries, part 317.
1359. gbgss318.seq - GSS (genome survey sequence) sequence entries, part 318.
1360. gbgss319.seq - GSS (genome survey sequence) sequence entries, part 319.
1361. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1362. gbgss320.seq - GSS (genome survey sequence) sequence entries, part 320.
1363. gbgss321.seq - GSS (genome survey sequence) sequence entries, part 321.
1364. gbgss322.seq - GSS (genome survey sequence) sequence entries, part 322.
1365. gbgss323.seq - GSS (genome survey sequence) sequence entries, part 323.
1366. gbgss324.seq - GSS (genome survey sequence) sequence entries, part 324.
1367. gbgss325.seq - GSS (genome survey sequence) sequence entries, part 325.
1368. gbgss326.seq - GSS (genome survey sequence) sequence entries, part 326.
1369. gbgss327.seq - GSS (genome survey sequence) sequence entries, part 327.
1370. gbgss328.seq - GSS (genome survey sequence) sequence entries, part 328.
1371. gbgss329.seq - GSS (genome survey sequence) sequence entries, part 329.
1372. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1373. gbgss330.seq - GSS (genome survey sequence) sequence entries, part 330.
1374. gbgss331.seq - GSS (genome survey sequence) sequence entries, part 331.
1375. gbgss332.seq - GSS (genome survey sequence) sequence entries, part 332.
1376. gbgss333.seq - GSS (genome survey sequence) sequence entries, part 333.
1377. gbgss334.seq - GSS (genome survey sequence) sequence entries, part 334.
1378. gbgss335.seq - GSS (genome survey sequence) sequence entries, part 335.
1379. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1380. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1381. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1382. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1383. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1384. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1385. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1386. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1387. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1388. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1389. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1390. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1391. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1392. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1393. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1394. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1395. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1396. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1397. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1398. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1399. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1400. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1401. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1402. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1403. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1404. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1405. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1406. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1407. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1408. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1409. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1410. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1411. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1412. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1413. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1414. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1415. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1416. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1417. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1418. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1419. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1420. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1421. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1422. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1423. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1424. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1425. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1426. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1427. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1428. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1429. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1430. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1431. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1432. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1433. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1434. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1435. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1436. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1437. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1438. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1439. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1440. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1441. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1442. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1443. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1444. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1445. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1446. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1447. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1448. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1449. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1450. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1451. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1452. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1453. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1454. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1455. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1456. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1457. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1458. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1459. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1460. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1461. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1462. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1463. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1464. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1465. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1466. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1467. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1468. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1469. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1470. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1471. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1472. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1473. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1474. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1475. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1476. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1477. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1478. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1479. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1480. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1481. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1482. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1483. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1484. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1485. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1486. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1487. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1488. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1489. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1490. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1491. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1492. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1493. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1494. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1495. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1496. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1497. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1498. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1499. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1500. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1501. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1502. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1503. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1504. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1505. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1506. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1507. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1508. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1509. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1510. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1511. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1512. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1513. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1514. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1515. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1516. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1517. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1518. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1519. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1520. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1521. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1522. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1523. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1524. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1525. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1526. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1527. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1528. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1529. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1530. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1531. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1532. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1533. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1534. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1535. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1536. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1537. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1538. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1539. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1540. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1541. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1542. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1543. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1544. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1545. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1546. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1547. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1548. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1549. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1550. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1551. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1552. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1553. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1554. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1555. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1556. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1557. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1558. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1559. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1560. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1561. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1562. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1563. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1564. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1565. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1566. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1567. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1568. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1569. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1570. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1571. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1572. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1573. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1574. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1575. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1576. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1577. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1578. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1579. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1580. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1581. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1582. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1583. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1584. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1585. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1586. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1587. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1588. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1589. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1590. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1591. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1592. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1593. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1594. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1595. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1596. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1597. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1598. gbinv1.seq - Invertebrate sequence entries, part 1.
1599. gbinv10.seq - Invertebrate sequence entries, part 10.
1600. gbinv11.seq - Invertebrate sequence entries, part 11.
1601. gbinv12.seq - Invertebrate sequence entries, part 12.
1602. gbinv13.seq - Invertebrate sequence entries, part 13.
1603. gbinv14.seq - Invertebrate sequence entries, part 14.
1604. gbinv15.seq - Invertebrate sequence entries, part 15.
1605. gbinv2.seq - Invertebrate sequence entries, part 2.
1606. gbinv3.seq - Invertebrate sequence entries, part 3.
1607. gbinv4.seq - Invertebrate sequence entries, part 4.
1608. gbinv5.seq - Invertebrate sequence entries, part 5.
1609. gbinv6.seq - Invertebrate sequence entries, part 6.
1610. gbinv7.seq - Invertebrate sequence entries, part 7.
1611. gbinv8.seq - Invertebrate sequence entries, part 8.
1612. gbinv9.seq - Invertebrate sequence entries, part 9.
1613. gbjou1.idx - Index of the entries according to journal citation, part 1.
1614. gbjou2.idx - Index of the entries according to journal citation, part 2.
1615. gbjou3.idx - Index of the entries according to journal citation, part 3.
1616. gbjou4.idx - Index of the entries according to journal citation, part 4.
1617. gbjou5.idx - Index of the entries according to journal citation, part 5.
1618. gbjou6.idx - Index of the entries according to journal citation, part 6.
1619. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1620. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1621. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1622. gbmam1.seq - Other mammalian sequence entries, part 1.
1623. gbmam2.seq - Other mammalian sequence entries, part 2.
1624. gbmam3.seq - Other mammalian sequence entries, part 3.
1625. gbmam4.seq - Other mammalian sequence entries, part 4.
1626. gbmam5.seq - Other mammalian sequence entries, part 5.
1627. gbnew.txt - Accession numbers of entries new since the previous release.
1628. gbpat1.seq - Patent sequence entries, part 1.
1629. gbpat10.seq - Patent sequence entries, part 10.
1630. gbpat11.seq - Patent sequence entries, part 11.
1631. gbpat12.seq - Patent sequence entries, part 12.
1632. gbpat13.seq - Patent sequence entries, part 13.
1633. gbpat14.seq - Patent sequence entries, part 14.
1634. gbpat15.seq - Patent sequence entries, part 15.
1635. gbpat16.seq - Patent sequence entries, part 16.
1636. gbpat17.seq - Patent sequence entries, part 17.
1637. gbpat18.seq - Patent sequence entries, part 18.
1638. gbpat19.seq - Patent sequence entries, part 19.
1639. gbpat2.seq - Patent sequence entries, part 2.
1640. gbpat20.seq - Patent sequence entries, part 20.
1641. gbpat21.seq - Patent sequence entries, part 21.
1642. gbpat22.seq - Patent sequence entries, part 22.
1643. gbpat23.seq - Patent sequence entries, part 23.
1644. gbpat24.seq - Patent sequence entries, part 24.
1645. gbpat25.seq - Patent sequence entries, part 25.
1646. gbpat26.seq - Patent sequence entries, part 26.
1647. gbpat27.seq - Patent sequence entries, part 27.
1648. gbpat28.seq - Patent sequence entries, part 28.
1649. gbpat29.seq - Patent sequence entries, part 29.
1650. gbpat3.seq - Patent sequence entries, part 3.
1651. gbpat30.seq - Patent sequence entries, part 30.
1652. gbpat31.seq - Patent sequence entries, part 31.
1653. gbpat32.seq - Patent sequence entries, part 32.
1654. gbpat33.seq - Patent sequence entries, part 33.
1655. gbpat34.seq - Patent sequence entries, part 34.
1656. gbpat35.seq - Patent sequence entries, part 35.
1657. gbpat36.seq - Patent sequence entries, part 36.
1658. gbpat37.seq - Patent sequence entries, part 37.
1659. gbpat38.seq - Patent sequence entries, part 38.
1660. gbpat39.seq - Patent sequence entries, part 39.
1661. gbpat4.seq - Patent sequence entries, part 4.
1662. gbpat40.seq - Patent sequence entries, part 40.
1663. gbpat41.seq - Patent sequence entries, part 41.
1664. gbpat42.seq - Patent sequence entries, part 42.
1665. gbpat43.seq - Patent sequence entries, part 43.
1666. gbpat44.seq - Patent sequence entries, part 44.
1667. gbpat45.seq - Patent sequence entries, part 45.
1668. gbpat46.seq - Patent sequence entries, part 46.
1669. gbpat47.seq - Patent sequence entries, part 47.
1670. gbpat48.seq - Patent sequence entries, part 48.
1671. gbpat49.seq - Patent sequence entries, part 49.
1672. gbpat5.seq - Patent sequence entries, part 5.
1673. gbpat50.seq - Patent sequence entries, part 50.
1674. gbpat51.seq - Patent sequence entries, part 51.
1675. gbpat52.seq - Patent sequence entries, part 52.
1676. gbpat53.seq - Patent sequence entries, part 53.
1677. gbpat54.seq - Patent sequence entries, part 54.
1678. gbpat55.seq - Patent sequence entries, part 55.
1679. gbpat56.seq - Patent sequence entries, part 56.
1680. gbpat57.seq - Patent sequence entries, part 57.
1681. gbpat58.seq - Patent sequence entries, part 58.
1682. gbpat59.seq - Patent sequence entries, part 59.
1683. gbpat6.seq - Patent sequence entries, part 6.
1684. gbpat60.seq - Patent sequence entries, part 60.
1685. gbpat61.seq - Patent sequence entries, part 61.
1686. gbpat62.seq - Patent sequence entries, part 62.
1687. gbpat63.seq - Patent sequence entries, part 63.
1688. gbpat64.seq - Patent sequence entries, part 64.
1689. gbpat65.seq - Patent sequence entries, part 65.
1690. gbpat66.seq - Patent sequence entries, part 66.
1691. gbpat67.seq - Patent sequence entries, part 67.
1692. gbpat7.seq - Patent sequence entries, part 7.
1693. gbpat8.seq - Patent sequence entries, part 8.
1694. gbpat9.seq - Patent sequence entries, part 9.
1695. gbphg1.seq - Phage sequence entries, part 1.
1696. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1697. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1698. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1699. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1700. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1701. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1702. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1703. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1704. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1705. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1706. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1707. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1708. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1709. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1710. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1711. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1712. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1713. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1714. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1715. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1716. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1717. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1718. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1719. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1720. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1721. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1722. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1723. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1724. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1725. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1726. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1727. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1728. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1729. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1730. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1731. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1732. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1733. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1734. gbpri1.seq - Primate sequence entries, part 1.
1735. gbpri10.seq - Primate sequence entries, part 10.
1736. gbpri11.seq - Primate sequence entries, part 11.
1737. gbpri12.seq - Primate sequence entries, part 12.
1738. gbpri13.seq - Primate sequence entries, part 13.
1739. gbpri14.seq - Primate sequence entries, part 14.
1740. gbpri15.seq - Primate sequence entries, part 15.
1741. gbpri16.seq - Primate sequence entries, part 16.
1742. gbpri17.seq - Primate sequence entries, part 17.
1743. gbpri18.seq - Primate sequence entries, part 18.
1744. gbpri19.seq - Primate sequence entries, part 19.
1745. gbpri2.seq - Primate sequence entries, part 2.
1746. gbpri20.seq - Primate sequence entries, part 20.
1747. gbpri21.seq - Primate sequence entries, part 21.
1748. gbpri22.seq - Primate sequence entries, part 22.
1749. gbpri23.seq - Primate sequence entries, part 23.
1750. gbpri24.seq - Primate sequence entries, part 24.
1751. gbpri25.seq - Primate sequence entries, part 25.
1752. gbpri26.seq - Primate sequence entries, part 26.
1753. gbpri27.seq - Primate sequence entries, part 27.
1754. gbpri28.seq - Primate sequence entries, part 28.
1755. gbpri29.seq - Primate sequence entries, part 29.
1756. gbpri3.seq - Primate sequence entries, part 3.
1757. gbpri30.seq - Primate sequence entries, part 30.
1758. gbpri31.seq - Primate sequence entries, part 31.
1759. gbpri32.seq - Primate sequence entries, part 32.
1760. gbpri33.seq - Primate sequence entries, part 33.
1761. gbpri34.seq - Primate sequence entries, part 34.
1762. gbpri35.seq - Primate sequence entries, part 35.
1763. gbpri36.seq - Primate sequence entries, part 36.
1764. gbpri37.seq - Primate sequence entries, part 37.
1765. gbpri38.seq - Primate sequence entries, part 38.
1766. gbpri39.seq - Primate sequence entries, part 39.
1767. gbpri4.seq - Primate sequence entries, part 4.
1768. gbpri5.seq - Primate sequence entries, part 5.
1769. gbpri6.seq - Primate sequence entries, part 6.
1770. gbpri7.seq - Primate sequence entries, part 7.
1771. gbpri8.seq - Primate sequence entries, part 8.
1772. gbpri9.seq - Primate sequence entries, part 9.
1773. gbrel.txt - Release notes (this document).
1774. gbrod1.seq - Rodent sequence entries, part 1.
1775. gbrod10.seq - Rodent sequence entries, part 10.
1776. gbrod11.seq - Rodent sequence entries, part 11.
1777. gbrod12.seq - Rodent sequence entries, part 12.
1778. gbrod13.seq - Rodent sequence entries, part 13.
1779. gbrod14.seq - Rodent sequence entries, part 14.
1780. gbrod15.seq - Rodent sequence entries, part 15.
1781. gbrod16.seq - Rodent sequence entries, part 16.
1782. gbrod17.seq - Rodent sequence entries, part 17.
1783. gbrod18.seq - Rodent sequence entries, part 18.
1784. gbrod19.seq - Rodent sequence entries, part 19.
1785. gbrod2.seq - Rodent sequence entries, part 2.
1786. gbrod20.seq - Rodent sequence entries, part 20.
1787. gbrod21.seq - Rodent sequence entries, part 21.
1788. gbrod22.seq - Rodent sequence entries, part 22.
1789. gbrod23.seq - Rodent sequence entries, part 23.
1790. gbrod24.seq - Rodent sequence entries, part 24.
1791. gbrod25.seq - Rodent sequence entries, part 25.
1792. gbrod26.seq - Rodent sequence entries, part 26.
1793. gbrod27.seq - Rodent sequence entries, part 27.
1794. gbrod28.seq - Rodent sequence entries, part 28.
1795. gbrod3.seq - Rodent sequence entries, part 3.
1796. gbrod4.seq - Rodent sequence entries, part 4.
1797. gbrod5.seq - Rodent sequence entries, part 5.
1798. gbrod6.seq - Rodent sequence entries, part 6.
1799. gbrod7.seq - Rodent sequence entries, part 7.
1800. gbrod8.seq - Rodent sequence entries, part 8.
1801. gbrod9.seq - Rodent sequence entries, part 9.
1802. gbsdr1.txt - Short directory of the data bank, part 1.
1803. gbsdr2.txt - Short directory of the data bank, part 2.
1804. gbsdr3.txt - Short directory of the data bank, part 3.
1805. gbsec.idx - Index of the entries according to secondary accession number.
1806. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1807. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1808. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1809. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1810. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1811. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1812. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1813. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1814. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1815. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1816. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1817. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1818. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1819. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1820. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1821. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1822. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1823. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1824. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1825. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1826. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1827. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1828. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1829. gbuna1.seq - Unannotated sequence entries, part 1.
1830. gbvrl1.seq - Viral sequence entries, part 1.
1831. gbvrl10.seq - Viral sequence entries, part 10.
1832. gbvrl11.seq - Viral sequence entries, part 11.
1833. gbvrl2.seq - Viral sequence entries, part 2.
1834. gbvrl3.seq - Viral sequence entries, part 3.
1835. gbvrl4.seq - Viral sequence entries, part 4.
1836. gbvrl5.seq - Viral sequence entries, part 5.
1837. gbvrl6.seq - Viral sequence entries, part 6.
1838. gbvrl7.seq - Viral sequence entries, part 7.
1839. gbvrl8.seq - Viral sequence entries, part 8.
1840. gbvrl9.seq - Viral sequence entries, part 9.
1841. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1842. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1843. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1844. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1845. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1846. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1847. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1848. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1849. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1850. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1851. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1852. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1853. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1854. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1855. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1856. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1857. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1858. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 171.0 flatfiles require roughly 395 GB (sequence
files only) or 422 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 959228080     gbacc1.idx
2006344635     gbacc2.idx
 651714630     gbacc3.idx
 185449577     gbaut1.idx
 184081813     gbaut10.idx
 183735247     gbaut11.idx
 195487360     gbaut12.idx
 200881968     gbaut13.idx
 213705313     gbaut14.idx
 186454473     gbaut15.idx
 187436784     gbaut16.idx
 184166227     gbaut17.idx
 187935222     gbaut18.idx
 188226670     gbaut19.idx
 191881158     gbaut2.idx
 184749596     gbaut20.idx
 183971275     gbaut21.idx
 210458121     gbaut22.idx
 185981781     gbaut23.idx
 185503007     gbaut24.idx
 190220182     gbaut25.idx
 192078337     gbaut26.idx
 200533051     gbaut27.idx
 186348326     gbaut28.idx
 183691960     gbaut29.idx
 183959009     gbaut3.idx
 203264444     gbaut30.idx
 212280598     gbaut31.idx
 223417897     gbaut32.idx
 193133338     gbaut33.idx
 185172802     gbaut34.idx
 227948332     gbaut35.idx
 185155380     gbaut36.idx
 191359996     gbaut37.idx
 192882140     gbaut38.idx
 190541083     gbaut39.idx
 185964123     gbaut4.idx
 185859872     gbaut40.idx
 183930794     gbaut41.idx
 184323680     gbaut42.idx
 185308577     gbaut43.idx
 193951611     gbaut44.idx
 184848985     gbaut45.idx
 183944350     gbaut46.idx
 192137137     gbaut47.idx
 184345049     gbaut48.idx
 185323782     gbaut49.idx
 186575594     gbaut5.idx
 184228783     gbaut50.idx
 222142913     gbaut51.idx
 231163735     gbaut52.idx
 254206491     gbaut53.idx
 184183956     gbaut54.idx
 184644769     gbaut55.idx
 188500497     gbaut56.idx
 225870135     gbaut57.idx
 198531683     gbaut58.idx
 184651437     gbaut59.idx
 188116258     gbaut6.idx
 240193230     gbaut60.idx
 253069460     gbaut61.idx
 209329383     gbaut62.idx
 183945504     gbaut63.idx
 216012607     gbaut64.idx
  16616991     gbaut65.idx
 186183079     gbaut7.idx
 225773437     gbaut8.idx
 212126881     gbaut9.idx
 246813936     gbbct1.seq
 249998223     gbbct10.seq
  32366800     gbbct11.seq
 241557885     gbbct12.seq
 249752942     gbbct13.seq
 248576617     gbbct14.seq
 239206911     gbbct15.seq
 242926619     gbbct16.seq
 242184211     gbbct17.seq
 237745728     gbbct18.seq
 239545791     gbbct19.seq
 249292424     gbbct2.seq
 217727668     gbbct20.seq
 242658326     gbbct21.seq
 240357169     gbbct22.seq
 248560207     gbbct23.seq
 247733883     gbbct24.seq
 249347553     gbbct25.seq
 244271238     gbbct26.seq
 249575262     gbbct27.seq
 247310011     gbbct28.seq
 249584306     gbbct29.seq
 247690535     gbbct3.seq
 240613921     gbbct30.seq
 248763319     gbbct31.seq
 246699168     gbbct32.seq
 236048572     gbbct33.seq
 235569059     gbbct34.seq
  44826463     gbbct35.seq
  86147822     gbbct36.seq
 168875849     gbbct37.seq
 249997534     gbbct38.seq
 240111688     gbbct39.seq
 249998643     gbbct4.seq
 137074441     gbbct40.seq
 102962965     gbbct5.seq
 249358251     gbbct6.seq
 249103055     gbbct7.seq
 244489771     gbbct8.seq
 243343455     gbbct9.seq
  16385707     gbchg.txt
 247848443     gbcon1.seq
 250000116     gbcon10.seq
 249993369     gbcon100.seq
 249997335     gbcon101.seq
 249997555     gbcon102.seq
 163255901     gbcon103.seq
 249996102     gbcon104.seq
 249994046     gbcon105.seq
 249975237     gbcon106.seq
 249997030     gbcon107.seq
 179255090     gbcon108.seq
 249998867     gbcon109.seq
 249946852     gbcon11.seq
 249998320     gbcon110.seq
 249997071     gbcon111.seq
 249999529     gbcon112.seq
 121337843     gbcon113.seq
 249998956     gbcon114.seq
 249996592     gbcon115.seq
 249999049     gbcon116.seq
 249731735     gbcon117.seq
 249998525     gbcon118.seq
 119751517     gbcon119.seq
 249943057     gbcon12.seq
 249998659     gbcon120.seq
 249999197     gbcon121.seq
 250000024     gbcon122.seq
 249999316     gbcon123.seq
 137967663     gbcon124.seq
 249999783     gbcon125.seq
 249998590     gbcon126.seq
 249998982     gbcon127.seq
 250000032     gbcon128.seq
 249919586     gbcon129.seq
 207171677     gbcon13.seq
  47122481     gbcon130.seq
  21450572     gbcon131.seq
 249990824     gbcon14.seq
 249999965     gbcon15.seq
 108299829     gbcon16.seq
 249999895     gbcon17.seq
 249367414     gbcon18.seq
 112175376     gbcon19.seq
 249123598     gbcon2.seq
 249998553     gbcon20.seq
  90674709     gbcon21.seq
 249989513     gbcon22.seq
 249861313     gbcon23.seq
 249999162     gbcon24.seq
 249997460     gbcon25.seq
 235840760     gbcon26.seq
 249997621     gbcon27.seq
 249999388     gbcon28.seq
 249999876     gbcon29.seq
 249622908     gbcon3.seq
 249997876     gbcon30.seq
 249115836     gbcon31.seq
 186235665     gbcon32.seq
 249997484     gbcon33.seq
 249998807     gbcon34.seq
 249995914     gbcon35.seq
 249999381     gbcon36.seq
 249997162     gbcon37.seq
 249997147     gbcon38.seq
  69593791     gbcon39.seq
 247899237     gbcon4.seq
 249995723     gbcon40.seq
 249997608     gbcon41.seq
 249998483     gbcon42.seq
 249997361     gbcon43.seq
 249997257     gbcon44.seq
  50037438     gbcon45.seq
 249997472     gbcon46.seq
 249998115     gbcon47.seq
 249998686     gbcon48.seq
 249998339     gbcon49.seq
 249997876     gbcon5.seq
 249997733     gbcon50.seq
  43338717     gbcon51.seq
 249997591     gbcon52.seq
 249998767     gbcon53.seq
 249997248     gbcon54.seq
 249996079     gbcon55.seq
 249997842     gbcon56.seq
 160226878     gbcon57.seq
 249997669     gbcon58.seq
 249996436     gbcon59.seq
 249990025     gbcon6.seq
 249999808     gbcon60.seq
 249999526     gbcon61.seq
 191237268     gbcon62.seq
 249998757     gbcon63.seq
 249997602     gbcon64.seq
 249998020     gbcon65.seq
 249996699     gbcon66.seq
 249999857     gbcon67.seq
   3620179     gbcon68.seq
 249999754     gbcon69.seq
 193517991     gbcon7.seq
 249998303     gbcon70.seq
 249999900     gbcon71.seq
 249998072     gbcon72.seq
 249999407     gbcon73.seq
 104780409     gbcon74.seq
 249994951     gbcon75.seq
 249998478     gbcon76.seq
 250000204     gbcon77.seq
 249999529     gbcon78.seq
 249997910     gbcon79.seq
 249997640     gbcon8.seq
  70070319     gbcon80.seq
 249998746     gbcon81.seq
 249999978     gbcon82.seq
 249998722     gbcon83.seq
 249994815     gbcon84.seq
 249997405     gbcon85.seq
  29097944     gbcon86.seq
 249997415     gbcon87.seq
 249998518     gbcon88.seq
 249999965     gbcon89.seq
 249994972     gbcon9.seq
 249999892     gbcon90.seq
 205025069     gbcon91.seq
 249998030     gbcon92.seq
 249997982     gbcon93.seq
 249993155     gbcon94.seq
 249998245     gbcon95.seq
 249996247     gbcon96.seq
 140335517     gbcon97.seq
 250000065     gbcon98.seq
 249998342     gbcon99.seq
    282660     gbdel.txt
 249974553     gbenv1.seq
 249999116     gbenv10.seq
 250000007     gbenv11.seq
 249998058     gbenv12.seq
 123633785     gbenv13.seq
 250000024     gbenv2.seq
 249999633     gbenv3.seq
 249999780     gbenv4.seq
 249999489     gbenv5.seq
  13281176     gbenv6.seq
 249999035     gbenv7.seq
 249998594     gbenv8.seq
 249998456     gbenv9.seq
 230688057     gbest1.seq
 230690645     gbest10.seq
 230689843     gbest100.seq
 230688257     gbest101.seq
 230687980     gbest102.seq
 230688229     gbest103.seq
 230690033     gbest104.seq
 230688995     gbest105.seq
 230689315     gbest106.seq
 230688925     gbest107.seq
 230689830     gbest108.seq
 230690159     gbest109.seq
 230688513     gbest11.seq
 230687842     gbest110.seq
 230687553     gbest111.seq
 230687773     gbest112.seq
 230689435     gbest113.seq
 230690676     gbest114.seq
 230687825     gbest115.seq
 230688797     gbest116.seq
 230688939     gbest117.seq
 230690375     gbest118.seq
 230689515     gbest119.seq
 230690088     gbest12.seq
  15632182     gbest120.seq
 230674074     gbest121.seq
 230689566     gbest122.seq
 230688137     gbest123.seq
 230690550     gbest124.seq
 230687693     gbest125.seq
 230690228     gbest126.seq
 230689104     gbest127.seq
 230689120     gbest128.seq
 230691081     gbest129.seq
 230688805     gbest13.seq
 230689303     gbest130.seq
 230688825     gbest131.seq
 230689631     gbest132.seq
 230688874     gbest133.seq
 230689739     gbest134.seq
 230687858     gbest135.seq
 230688590     gbest136.seq
 230689523     gbest137.seq
 230687597     gbest138.seq
 230687946     gbest139.seq
 230689870     gbest14.seq
 230689122     gbest140.seq
 230689114     gbest141.seq
 230687697     gbest142.seq
 230689304     gbest143.seq
 230688358     gbest144.seq
 230688098     gbest145.seq
 230688471     gbest146.seq
 230687710     gbest147.seq
 230689775     gbest148.seq
 230689551     gbest149.seq
 230689172     gbest15.seq
  14211042     gbest150.seq
 230688269     gbest151.seq
 230687953     gbest152.seq
 230690579     gbest153.seq
 230688007     gbest154.seq
 230688577     gbest155.seq
 230688573     gbest156.seq
 230688217     gbest157.seq
 230689767     gbest158.seq
 230687920     gbest159.seq
 230690604     gbest16.seq
 230688203     gbest160.seq
 230687711     gbest161.seq
 230690824     gbest162.seq
 230688804     gbest163.seq
 230688082     gbest164.seq
 230689192     gbest165.seq
 230689796     gbest166.seq
 230687458     gbest167.seq
 230689599     gbest168.seq
 230689684     gbest169.seq
 230690080     gbest17.seq
 230689749     gbest170.seq
 230689179     gbest171.seq
 230689202     gbest172.seq
 230689893     gbest173.seq
 230690020     gbest174.seq
 230690548     gbest175.seq
 230688191     gbest176.seq
 230688805     gbest177.seq
 160000216     gbest178.seq
 230690337     gbest179.seq
 230688525     gbest18.seq
 230689354     gbest180.seq
 230687890     gbest181.seq
 230688696     gbest182.seq
 230690225     gbest183.seq
 223669886     gbest184.seq
 230689030     gbest185.seq
 230689529     gbest186.seq
 230687956     gbest187.seq
 230689140     gbest188.seq
 230688263     gbest189.seq
 230689400     gbest19.seq
 230691176     gbest190.seq
 230689141     gbest191.seq
 230687982     gbest192.seq
 230690222     gbest193.seq
 230689808     gbest194.seq
 230687838     gbest195.seq
 230688724     gbest196.seq
 230687685     gbest197.seq
 230689793     gbest198.seq
 230687460     gbest199.seq
 230690765     gbest2.seq
 230689561     gbest20.seq
 230690594     gbest200.seq
 230687489     gbest201.seq
 230689214     gbest202.seq
 230689168     gbest203.seq
 230689887     gbest204.seq
 176714895     gbest205.seq
 230688621     gbest206.seq
 230688919     gbest207.seq
 230688473     gbest208.seq
 230687936     gbest209.seq
 230691103     gbest21.seq
 230688686     gbest210.seq
 230689515     gbest211.seq
 230689081     gbest212.seq
 230688561     gbest213.seq
 230687591     gbest214.seq
 230689130     gbest215.seq
 230689832     gbest216.seq
 230687755     gbest217.seq
 230687847     gbest218.seq
 230687709     gbest219.seq
 230687803     gbest22.seq
 230687600     gbest220.seq
 230688974     gbest221.seq
 230688085     gbest222.seq
 230688515     gbest223.seq
 230688963     gbest224.seq
 230687440     gbest225.seq
 230689211     gbest226.seq
 230688622     gbest227.seq
 230689984     gbest228.seq
 230690782     gbest229.seq
 230689120     gbest23.seq
 230690014     gbest230.seq
 230687565     gbest231.seq
   2733809     gbest232.seq
 230690354     gbest233.seq
 230687860     gbest234.seq
 230688805     gbest235.seq
 183120344     gbest236.seq
 161530561     gbest237.seq
 162852740     gbest238.seq
 170070267     gbest239.seq
 230689848     gbest24.seq
 169029992     gbest240.seq
 162278181     gbest241.seq
 163993354     gbest242.seq
 163563375     gbest243.seq
 162955872     gbest244.seq
 163491635     gbest245.seq
 162974263     gbest246.seq
 163112994     gbest247.seq
 161795992     gbest248.seq
 167277558     gbest249.seq
 230687669     gbest25.seq
 161241877     gbest250.seq
 162193041     gbest251.seq
 166685156     gbest252.seq
 166378528     gbest253.seq
 164736863     gbest254.seq
 164569362     gbest255.seq
 164253515     gbest256.seq
 164026168     gbest257.seq
 163108941     gbest258.seq
 163114712     gbest259.seq
 230688950     gbest26.seq
 164287662     gbest260.seq
 165596736     gbest261.seq
 179900501     gbest262.seq
 169937802     gbest263.seq
 197213429     gbest264.seq
 230688459     gbest265.seq
 230689906     gbest266.seq
 230689120     gbest267.seq
 230690568     gbest268.seq
 230687446     gbest269.seq
 230689269     gbest27.seq
 230687501     gbest270.seq
 230689286     gbest271.seq
 230688795     gbest272.seq
 230688043     gbest273.seq
 230690391     gbest274.seq
 230687907     gbest275.seq
 230690575     gbest276.seq
 230687865     gbest277.seq
 205817258     gbest278.seq
 230690308     gbest279.seq
 216524887     gbest28.seq
 230690101     gbest280.seq
 230690667     gbest281.seq
 230689877     gbest282.seq
 230689584     gbest283.seq
 230689384     gbest284.seq
 230689880     gbest285.seq
 230690798     gbest286.seq
 230688211     gbest287.seq
 230688420     gbest288.seq
 230688521     gbest289.seq
 230687997     gbest29.seq
 230689963     gbest290.seq
 230690753     gbest291.seq
 230687897     gbest292.seq
 230688837     gbest293.seq
 230688664     gbest294.seq
 230687563     gbest295.seq
 216487680     gbest296.seq
 209106457     gbest297.seq
 230689489     gbest298.seq
 230688125     gbest299.seq
 230687584     gbest3.seq
 230688549     gbest30.seq
 230687689     gbest300.seq
 230687578     gbest301.seq
 230688972     gbest302.seq
 230688357     gbest303.seq
 230688040     gbest304.seq
 230688261     gbest305.seq
 230689387     gbest306.seq
  86450659     gbest307.seq
 230689119     gbest308.seq
 230690103     gbest309.seq
 230689412     gbest31.seq
 230689099     gbest310.seq
 230690837     gbest311.seq
 230688476     gbest312.seq
 230688026     gbest313.seq
 230689443     gbest314.seq
 230691210     gbest315.seq
 230690367     gbest316.seq
 230687810     gbest317.seq
 230691174     gbest318.seq
 230687647     gbest319.seq
 230688702     gbest32.seq
 230688898     gbest320.seq
 230688669     gbest321.seq
 230688947     gbest322.seq
 230690718     gbest323.seq
 230689943     gbest324.seq
 230690056     gbest325.seq
 230690319     gbest326.seq
 230687457     gbest327.seq
 230688992     gbest328.seq
 230690209     gbest329.seq
 230687483     gbest33.seq
 230688128     gbest330.seq
 230689165     gbest331.seq
 230688510     gbest332.seq
 230691027     gbest333.seq
 230688765     gbest334.seq
 230689508     gbest335.seq
 230688654     gbest336.seq
 230689156     gbest337.seq
 230687957     gbest338.seq
 126923651     gbest339.seq
 230689956     gbest34.seq
 230687489     gbest340.seq
 230687977     gbest341.seq
 230691027     gbest342.seq
 230687916     gbest343.seq
 230687720     gbest344.seq
 230688993     gbest345.seq
 230688338     gbest346.seq
 230687478     gbest347.seq
 230688943     gbest348.seq
 211004116     gbest349.seq
 230688426     gbest35.seq
 230687877     gbest350.seq
 230690788     gbest351.seq
 230690216     gbest352.seq
 230688968     gbest353.seq
 230690420     gbest354.seq
 230687858     gbest355.seq
 159995891     gbest356.seq
 163539239     gbest357.seq
 230687720     gbest358.seq
 230690976     gbest359.seq
 230688298     gbest36.seq
 230692845     gbest360.seq
 230687488     gbest361.seq
 230690591     gbest362.seq
 230687508     gbest363.seq
 230689933     gbest364.seq
 230690486     gbest365.seq
 230689287     gbest366.seq
 230689176     gbest367.seq
 169214746     gbest368.seq
 230689088     gbest369.seq
 230688757     gbest37.seq
 230689931     gbest370.seq
 230687688     gbest371.seq
 230687851     gbest372.seq
 230691014     gbest373.seq
 230688043     gbest374.seq
 230689429     gbest375.seq
 230688292     gbest376.seq
 230695817     gbest377.seq
 230691630     gbest378.seq
 212508093     gbest379.seq
 230689768     gbest38.seq
 230689961     gbest380.seq
 230687844     gbest381.seq
 230691449     gbest382.seq
 230689141     gbest383.seq
 230689770     gbest384.seq
 230690146     gbest385.seq
 230687471     gbest386.seq
 230688099     gbest387.seq
 230689576     gbest388.seq
 230690034     gbest389.seq
 230689483     gbest39.seq
 230690073     gbest390.seq
 230688999     gbest391.seq
 230690230     gbest392.seq
 230689040     gbest393.seq
 230689498     gbest394.seq
 230690809     gbest395.seq
 230689077     gbest396.seq
 230688938     gbest397.seq
 144594974     gbest398.seq
 230689342     gbest399.seq
 230688316     gbest4.seq
 230690627     gbest40.seq
 179559924     gbest400.seq
 207891051     gbest401.seq
 230688341     gbest402.seq
 223841227     gbest403.seq
 225409970     gbest404.seq
 189716165     gbest405.seq
 207221639     gbest406.seq
 230687933     gbest407.seq
 230690503     gbest408.seq
 230691277     gbest409.seq
 230687588     gbest41.seq
 230690631     gbest410.seq
 230688525     gbest411.seq
 226257728     gbest412.seq
 230690530     gbest413.seq
 230690650     gbest414.seq
 230691581     gbest415.seq
 230689297     gbest416.seq
 230689132     gbest417.seq
 230689470     gbest418.seq
 218755666     gbest419.seq
 230689301     gbest42.seq
 230688007     gbest420.seq
 230688710     gbest421.seq
 230687774     gbest422.seq
 230689212     gbest423.seq
 230688585     gbest424.seq
 230690159     gbest425.seq
 230688185     gbest426.seq
 230689281     gbest427.seq
 230689105     gbest428.seq
 156460619     gbest429.seq
 230689681     gbest43.seq
 230692140     gbest430.seq
 230688350     gbest431.seq
 230689593     gbest432.seq
 230688863     gbest433.seq
 230690959     gbest434.seq
 230695180     gbest435.seq
 230687477     gbest436.seq
 218381177     gbest437.seq
 208431183     gbest438.seq
 208164161     gbest439.seq
 230689232     gbest44.seq
 208433289     gbest440.seq
 208277691     gbest441.seq
 208534698     gbest442.seq
 208577297     gbest443.seq
 210155514     gbest444.seq
 209607235     gbest445.seq
 209116450     gbest446.seq
 212275924     gbest447.seq
 209912341     gbest448.seq
 208750528     gbest449.seq
 230688501     gbest45.seq
 208758988     gbest450.seq
 208890389     gbest451.seq
 208233539     gbest452.seq
 208243420     gbest453.seq
 208281371     gbest454.seq
 208086774     gbest455.seq
 207480039     gbest456.seq
 230689695     gbest457.seq
 230689650     gbest458.seq
 228604411     gbest459.seq
 230688836     gbest46.seq
 230689063     gbest460.seq
 230689363     gbest461.seq
 230687790     gbest462.seq
 230688073     gbest463.seq
 230689337     gbest464.seq
 230688593     gbest465.seq
 230688158     gbest466.seq
 230688857     gbest467.seq
 230689949     gbest468.seq
 230687526     gbest469.seq
 189591511     gbest47.seq
 230691433     gbest470.seq
 230688834     gbest471.seq
 230688437     gbest472.seq
 230687456     gbest473.seq
 230688049     gbest474.seq
 230688084     gbest475.seq
 230688288     gbest476.seq
 230688285     gbest477.seq
 230688343     gbest478.seq
 230692022     gbest479.seq
 188305300     gbest48.seq
 230688566     gbest480.seq
 230690466     gbest481.seq
 230689417     gbest482.seq
 230687693     gbest483.seq
 229144342     gbest484.seq
 230688840     gbest485.seq
 230688866     gbest486.seq
 230688667     gbest487.seq
 230691828     gbest488.seq
 230687575     gbest489.seq
 202960919     gbest49.seq
 230690239     gbest490.seq
 230689217     gbest491.seq
 230689732     gbest492.seq
 230688884     gbest493.seq
 230689634     gbest494.seq
 230688535     gbest495.seq
 230688747     gbest496.seq
 230689419     gbest497.seq
 230690632     gbest498.seq
 230687717     gbest499.seq
 164121151     gbest5.seq
 214543716     gbest50.seq
 230691098     gbest500.seq
 230688537     gbest501.seq
 230688079     gbest502.seq
 230689968     gbest503.seq
 230690047     gbest504.seq
 230689365     gbest505.seq
 230689332     gbest506.seq
 230689562     gbest507.seq
 230690988     gbest508.seq
 230689866     gbest509.seq
 214854152     gbest51.seq
 230689022     gbest510.seq
 230690518     gbest511.seq
 230690343     gbest512.seq
 230688063     gbest513.seq
 230688159     gbest514.seq
 230691753     gbest515.seq
 230690588     gbest516.seq
 179036142     gbest517.seq
 230688741     gbest518.seq
 230688056     gbest519.seq
 215499801     gbest52.seq
 230688122     gbest520.seq
 227198357     gbest521.seq
 230691144     gbest522.seq
 230689512     gbest523.seq
 230689675     gbest524.seq
 230687547     gbest525.seq
 230687534     gbest526.seq
 230687618     gbest527.seq
 230690088     gbest528.seq
 230687660     gbest529.seq
 224801538     gbest53.seq
 230690477     gbest530.seq
 230687875     gbest531.seq
 230689623     gbest532.seq
 230688238     gbest533.seq
 230688631     gbest534.seq
 225045455     gbest535.seq
 223162501     gbest536.seq
 230688001     gbest537.seq
 230689413     gbest538.seq
 230688166     gbest539.seq
 230688496     gbest54.seq
 230688292     gbest540.seq
 230688564     gbest541.seq
 230687787     gbest542.seq
 230689569     gbest543.seq
 230687732     gbest544.seq
 230690010     gbest545.seq
 230687794     gbest546.seq
  77066107     gbest547.seq
 230688445     gbest548.seq
 230689449     gbest549.seq
  88223841     gbest55.seq
 230689616     gbest550.seq
 207681279     gbest551.seq
 196103016     gbest552.seq
 230687623     gbest553.seq
 230687668     gbest554.seq
 230688851     gbest555.seq
 230689422     gbest556.seq
 230686160     gbest557.seq
 230687747     gbest558.seq
 230687588     gbest559.seq
 230688100     gbest56.seq
 230689515     gbest560.seq
 230687572     gbest561.seq
 230689331     gbest562.seq
 230689376     gbest563.seq
 230688022     gbest564.seq
 230689680     gbest565.seq
 222165626     gbest566.seq
 230689454     gbest567.seq
 230688969     gbest568.seq
 230688155     gbest569.seq
 219516194     gbest57.seq
 230689655     gbest570.seq
 230687564     gbest571.seq
 230688375     gbest572.seq
 174113904     gbest573.seq
 219224526     gbest574.seq
 215995131     gbest575.seq
 230688111     gbest576.seq
 230688934     gbest577.seq
 230690079     gbest578.seq
 230689062     gbest579.seq
 230688932     gbest58.seq
 230689587     gbest580.seq
 230689040     gbest581.seq
 230689251     gbest582.seq
 230688193     gbest583.seq
 230689310     gbest584.seq
 230689219     gbest585.seq
 230689706     gbest586.seq
 230690994     gbest587.seq
 230689510     gbest588.seq
 230687756     gbest589.seq
 230689635     gbest59.seq
 230689607     gbest590.seq
 230687560     gbest591.seq
 230687625     gbest592.seq
 230690445     gbest593.seq
 230689866     gbest594.seq
 230689510     gbest595.seq
 230688464     gbest596.seq
 193474023     gbest597.seq
 230688536     gbest598.seq
 230688035     gbest599.seq
 177439448     gbest6.seq
 230687983     gbest60.seq
 230689102     gbest600.seq
 230689007     gbest601.seq
 230689060     gbest602.seq
 230688598     gbest603.seq
 230688386     gbest604.seq
 230690308     gbest605.seq
 230687679     gbest606.seq
 230690046     gbest607.seq
 230688417     gbest608.seq
 230690517     gbest609.seq
 230690220     gbest61.seq
 230688299     gbest610.seq
 230688511     gbest611.seq
 223088420     gbest612.seq
 230688083     gbest613.seq
 230688598     gbest614.seq
 230689054     gbest615.seq
 230690674     gbest616.seq
 230688423     gbest617.seq
 230688249     gbest618.seq
 230689731     gbest619.seq
 230691313     gbest62.seq
 230689022     gbest620.seq
 230688337     gbest621.seq
 230688979     gbest622.seq
 230687837     gbest623.seq
  46785175     gbest624.seq
 230688414     gbest625.seq
 230688528     gbest626.seq
 230688739     gbest627.seq
 230689547     gbest628.seq
 230688285     gbest629.seq
 230689927     gbest63.seq
 230688906     gbest630.seq
 230689217     gbest631.seq
 230690543     gbest632.seq
 230689290     gbest633.seq
 230687821     gbest634.seq
 230688976     gbest635.seq
 230689061     gbest636.seq
 230688439     gbest637.seq
 230688165     gbest638.seq
 230690487     gbest639.seq
 230689161     gbest64.seq
 230689000     gbest640.seq
 230689253     gbest641.seq
 230688589     gbest642.seq
 230692264     gbest643.seq
 230688139     gbest644.seq
 230689837     gbest645.seq
 230689790     gbest646.seq
 230688732     gbest647.seq
 230688050     gbest648.seq
 230690745     gbest649.seq
 230689177     gbest65.seq
 153950473     gbest650.seq
 230687455     gbest651.seq
 219090951     gbest652.seq
 230687501     gbest653.seq
 230687500     gbest654.seq
 230689490     gbest655.seq
 217212028     gbest656.seq
 230687451     gbest657.seq
 230178836     gbest658.seq
 190750878     gbest659.seq
 230687778     gbest66.seq
 190465104     gbest660.seq
 192951914     gbest661.seq
 192369122     gbest662.seq
 191451132     gbest663.seq
 192170114     gbest664.seq
 192510825     gbest665.seq
 192399109     gbest666.seq
 190879680     gbest667.seq
 191712622     gbest668.seq
 230689995     gbest669.seq
 230688459     gbest67.seq
 230689408     gbest670.seq
 230690355     gbest671.seq
 230687560     gbest672.seq
 230689161     gbest673.seq
 230689986     gbest674.seq
 230687501     gbest675.seq
 208012171     gbest676.seq
 178519573     gbest677.seq
 230691257     gbest678.seq
   5123579     gbest679.seq
 230690275     gbest68.seq
 230690933     gbest680.seq
 230689473     gbest681.seq
 230688818     gbest682.seq
 230689792     gbest683.seq
 230688021     gbest684.seq
 230689430     gbest685.seq
 230690037     gbest686.seq
 230687763     gbest687.seq
 230688050     gbest688.seq
 230687759     gbest689.seq
 230688096     gbest69.seq
 230689543     gbest690.seq
 230690324     gbest691.seq
 230689441     gbest692.seq
 230687983     gbest693.seq
 230689437     gbest694.seq
 230687509     gbest695.seq
 230690291     gbest696.seq
 230688078     gbest697.seq
 230690146     gbest698.seq
 230689707     gbest699.seq
 230688633     gbest7.seq
 230687920     gbest70.seq
 230688468     gbest700.seq
 230687846     gbest701.seq
 230688141     gbest702.seq
 230689875     gbest703.seq
 230691238     gbest704.seq
 230688118     gbest705.seq
 230687940     gbest706.seq
 230690156     gbest707.seq
 230690935     gbest708.seq
 180496370     gbest709.seq
 230690692     gbest71.seq
 230690239     gbest710.seq
 230690093     gbest711.seq
 230688236     gbest712.seq
 230687610     gbest713.seq
 230689846     gbest714.seq
 230690154     gbest715.seq
 230688772     gbest716.seq
 228457004     gbest717.seq
 216367095     gbest718.seq
 218302149     gbest719.seq
 230690076     gbest72.seq
 217465330     gbest720.seq
 215136381     gbest721.seq
 218273181     gbest722.seq
 230688627     gbest723.seq
 230687465     gbest724.seq
 230688081     gbest725.seq
 230689762     gbest726.seq
 230688009     gbest727.seq
 230687763     gbest728.seq
 230689097     gbest729.seq
 230692194     gbest73.seq
 230690190     gbest730.seq
 230690706     gbest731.seq
 230688021     gbest732.seq
 230688342     gbest733.seq
 230688153     gbest734.seq
 230690033     gbest735.seq
 230689228     gbest736.seq
 230691044     gbest737.seq
 230690856     gbest738.seq
 230690519     gbest739.seq
 208455600     gbest74.seq
 230690578     gbest740.seq
  42408945     gbest741.seq
 230688334     gbest742.seq
 230690383     gbest743.seq
 230691132     gbest744.seq
 230691001     gbest745.seq
 230688465     gbest746.seq
 230689043     gbest747.seq
 230690362     gbest748.seq
 211346938     gbest749.seq
 208093114     gbest75.seq
 210443409     gbest750.seq
 230689649     gbest751.seq
 230688286     gbest752.seq
 230689138     gbest753.seq
 230687680     gbest754.seq
 230688727     gbest755.seq
 230690002     gbest756.seq
 230687790     gbest757.seq
 230688440     gbest758.seq
 230689872     gbest759.seq
 207432237     gbest76.seq
 230689896     gbest760.seq
 230689306     gbest761.seq
 230688176     gbest762.seq
 230689511     gbest763.seq
 230688000     gbest764.seq
 230689570     gbest765.seq
 230689843     gbest766.seq
 197963288     gbest767.seq
 213940560     gbest768.seq
 230688080     gbest769.seq
 207757313     gbest77.seq
 230689715     gbest770.seq
  44130123     gbest771.seq
 230691971     gbest772.seq
 230691107     gbest773.seq
 230689517     gbest774.seq
 230687696     gbest775.seq
 230688232     gbest776.seq
 230690994     gbest777.seq
 230687984     gbest778.seq
 230690500     gbest779.seq
 209030580     gbest78.seq
 230688061     gbest780.seq
 230689958     gbest781.seq
 230689579     gbest782.seq
 230689874     gbest783.seq
 230689428     gbest784.seq
 230689309     gbest785.seq
 230690099     gbest786.seq
 230690612     gbest787.seq
 230689613     gbest788.seq
 230690022     gbest789.seq
 208628617     gbest79.seq
 230688260     gbest790.seq
 230688522     gbest791.seq
 230689137     gbest792.seq
 230688023     gbest793.seq
 230688841     gbest794.seq
 230688715     gbest795.seq
 230690599     gbest796.seq
 230689645     gbest797.seq
 230688460     gbest798.seq
 230689069     gbest799.seq
 230688964     gbest8.seq
 207455430     gbest80.seq
 230688073     gbest800.seq
 138883980     gbest801.seq
 230689099     gbest802.seq
 230688033     gbest803.seq
 230688516     gbest804.seq
 230688140     gbest805.seq
 230687823     gbest806.seq
 230689899     gbest807.seq
 230687591     gbest808.seq
 230689007     gbest809.seq
 207950285     gbest81.seq
 230688283     gbest810.seq
 230689113     gbest811.seq
 230688891     gbest812.seq
 230690209     gbest813.seq
 230688876     gbest814.seq
 230690590     gbest815.seq
 230688844     gbest816.seq
 230688136     gbest817.seq
 230689512     gbest818.seq
 230688440     gbest819.seq
 209388082     gbest82.seq
 230689777     gbest820.seq
 230688374     gbest821.seq
 230690050     gbest822.seq
 230690193     gbest823.seq
 230690036     gbest824.seq
 230691422     gbest825.seq
 230688379     gbest826.seq
 230689878     gbest827.seq
 230690286     gbest828.seq
 216749851     gbest829.seq
 205322764     gbest83.seq
 230690411     gbest830.seq
 230689267     gbest831.seq
 230689874     gbest832.seq
 230688305     gbest833.seq
 230690279     gbest834.seq
 230688025     gbest835.seq
 230687797     gbest836.seq
 230688628     gbest837.seq
 230687862     gbest838.seq
 230689754     gbest839.seq
 205348678     gbest84.seq
 230687620     gbest840.seq
 230690663     gbest841.seq
 230688063     gbest842.seq
 230688106     gbest843.seq
 230688038     gbest844.seq
 230687757     gbest845.seq
 230688393     gbest846.seq
 230689942     gbest847.seq
 230687961     gbest848.seq
 230687865     gbest849.seq
 206916651     gbest85.seq
 230688534     gbest850.seq
 230689979     gbest851.seq
 230688487     gbest852.seq
 230688490     gbest853.seq
 230689492     gbest854.seq
 230688257     gbest855.seq
 230689102     gbest856.seq
 221468236     gbest857.seq
 230691061     gbest858.seq
  89747162     gbest859.seq
 207320803     gbest86.seq
  44958147     gbest860.seq
 214435926     gbest87.seq
 230689564     gbest88.seq
 135965519     gbest89.seq
 230688681     gbest9.seq
 230691177     gbest90.seq
 219944236     gbest91.seq
 213065394     gbest92.seq
 212490107     gbest93.seq
 230687932     gbest94.seq
 230689506     gbest95.seq
 230688013     gbest96.seq
 230688323     gbest97.seq
 230687971     gbest98.seq
 230688220     gbest99.seq
 101157520     gbgen.idx
 230689602     gbgss1.seq
 230688972     gbgss10.seq
 230688079     gbgss100.seq
 230688521     gbgss101.seq
 230687652     gbgss102.seq
  90602982     gbgss103.seq
 227256480     gbgss104.seq
 228343795     gbgss105.seq
 228718645     gbgss106.seq
 228639571     gbgss107.seq
 227929382     gbgss108.seq
 227432332     gbgss109.seq
  41747711     gbgss11.seq
 230689895     gbgss110.seq
 230689124     gbgss111.seq
 230688829     gbgss112.seq
 230688797     gbgss113.seq
 230689397     gbgss114.seq
 230687535     gbgss115.seq
 230688708     gbgss116.seq
 230688604     gbgss117.seq
 230687465     gbgss118.seq
 230687993     gbgss119.seq
 230690063     gbgss12.seq
 230688007     gbgss120.seq
 230690852     gbgss121.seq
 230687449     gbgss122.seq
 230689273     gbgss123.seq
 230688684     gbgss124.seq
 230687661     gbgss125.seq
 230688438     gbgss126.seq
 230689860     gbgss127.seq
  29453604     gbgss128.seq
 230688125     gbgss129.seq
 230688330     gbgss13.seq
 230690258     gbgss130.seq
 230688282     gbgss131.seq
 230690264     gbgss132.seq
 230687867     gbgss133.seq
 230688520     gbgss134.seq
 230688633     gbgss135.seq
 230688443     gbgss136.seq
 230688348     gbgss137.seq
 230688785     gbgss138.seq
 230690008     gbgss139.seq
 230690273     gbgss14.seq
 230687479     gbgss140.seq
 101722587     gbgss141.seq
 230689447     gbgss142.seq
 230690110     gbgss143.seq
 230688852     gbgss144.seq
 230687698     gbgss145.seq
 230690002     gbgss146.seq
 230689907     gbgss147.seq
 230688676     gbgss148.seq
 230689217     gbgss149.seq
 230688813     gbgss15.seq
 224383742     gbgss150.seq
 230687832     gbgss151.seq
 230687590     gbgss152.seq
 192082858     gbgss153.seq
 230688851     gbgss154.seq
 230688924     gbgss155.seq
 230689590     gbgss156.seq
 230689644     gbgss157.seq
 230688112     gbgss158.seq
 230688558     gbgss159.seq
 230689450     gbgss16.seq
 230689014     gbgss160.seq
 230689025     gbgss161.seq
 230689942     gbgss162.seq
 230688908     gbgss163.seq
 230689217     gbgss164.seq
 230688013     gbgss165.seq
 230687451     gbgss166.seq
  15545118     gbgss167.seq
 230688336     gbgss168.seq
 230688178     gbgss169.seq
 230690343     gbgss17.seq
 230689728     gbgss170.seq
 230688286     gbgss171.seq
 230688641     gbgss172.seq
 230689065     gbgss173.seq
 230688777     gbgss174.seq
 230689098     gbgss175.seq
 229064018     gbgss176.seq
 230688866     gbgss177.seq
 230692011     gbgss178.seq
 230688726     gbgss179.seq
 230689039     gbgss18.seq
 212365195     gbgss180.seq
 207377635     gbgss181.seq
 210307518     gbgss182.seq
 210378046     gbgss183.seq
 209340433     gbgss184.seq
 208960169     gbgss185.seq
 207161956     gbgss186.seq
 207098630     gbgss187.seq
 207344541     gbgss188.seq
 209768428     gbgss189.seq
 230690336     gbgss19.seq
 209102054     gbgss190.seq
 207198316     gbgss191.seq
 205407310     gbgss192.seq
 205349771     gbgss193.seq
 205100661     gbgss194.seq
 205137047     gbgss195.seq
 204745726     gbgss196.seq
 207164855     gbgss197.seq
 207320792     gbgss198.seq
 183832996     gbgss199.seq
 230689563     gbgss2.seq
 230689748     gbgss20.seq
 207529038     gbgss200.seq
 207985406     gbgss201.seq
 208514591     gbgss202.seq
 208595703     gbgss203.seq
 207874919     gbgss204.seq
 205656343     gbgss205.seq
 205816776     gbgss206.seq
 205675592     gbgss207.seq
 204914340     gbgss208.seq
 207148762     gbgss209.seq
 230687801     gbgss21.seq
 206798065     gbgss210.seq
 207035523     gbgss211.seq
 206856936     gbgss212.seq
 207054003     gbgss213.seq
 206669036     gbgss214.seq
 206841592     gbgss215.seq
 206671454     gbgss216.seq
 206598436     gbgss217.seq
 206885248     gbgss218.seq
 207249805     gbgss219.seq
 230688528     gbgss22.seq
 208268746     gbgss220.seq
 209965353     gbgss221.seq
 209382709     gbgss222.seq
 209714594     gbgss223.seq
 213648754     gbgss224.seq
 218856308     gbgss225.seq
 228365504     gbgss226.seq
 230688768     gbgss227.seq
 230687952     gbgss228.seq
 230689599     gbgss229.seq
 230689462     gbgss23.seq
 230689484     gbgss230.seq
 230689346     gbgss231.seq
 217911559     gbgss232.seq
 217923706     gbgss233.seq
 144836624     gbgss234.seq
 230687936     gbgss235.seq
 230689677     gbgss236.seq
 230688377     gbgss237.seq
 230689346     gbgss238.seq
 230688346     gbgss239.seq
 230688272     gbgss24.seq
 230687463     gbgss240.seq
 230688846     gbgss241.seq
 230688791     gbgss242.seq
 230688454     gbgss243.seq
 230688857     gbgss244.seq
 230688259     gbgss245.seq
 230687450     gbgss246.seq
 230689644     gbgss247.seq
 230688934     gbgss248.seq
 230688744     gbgss249.seq
 230688565     gbgss25.seq
 230688738     gbgss250.seq
 230689948     gbgss251.seq
 230688061     gbgss252.seq
 230689454     gbgss253.seq
 230690509     gbgss254.seq
 230688624     gbgss255.seq
 230690190     gbgss256.seq
 230690193     gbgss257.seq
 230687858     gbgss258.seq
 230688447     gbgss259.seq
 230687990     gbgss26.seq
 144357700     gbgss260.seq
 230689099     gbgss261.seq
 230687737     gbgss262.seq
  36446185     gbgss263.seq
 250000201     gbgss264.seq
 249998294     gbgss265.seq
 249999195     gbgss266.seq
 249999639     gbgss267.seq
  27382741     gbgss268.seq
 249999305     gbgss269.seq
 230690915     gbgss27.seq
 249998059     gbgss270.seq
 249997528     gbgss271.seq
 249999266     gbgss272.seq
 223609630     gbgss273.seq
 249998415     gbgss274.seq
 249998761     gbgss275.seq
 249998880     gbgss276.seq
 249998601     gbgss277.seq
 173689071     gbgss278.seq
 249997088     gbgss279.seq
 230688070     gbgss28.seq
 249998903     gbgss280.seq
 249999973     gbgss281.seq
 249998452     gbgss282.seq
 249997095     gbgss283.seq
  77492649     gbgss284.seq
 249998864     gbgss285.seq
   3042312     gbgss286.seq
  79503481     gbgss287.seq
 249999793     gbgss288.seq
 250000116     gbgss289.seq
 230688942     gbgss29.seq
  80246184     gbgss290.seq
 249998484     gbgss291.seq
 249999450     gbgss292.seq
 249999465     gbgss293.seq
 106113212     gbgss294.seq
 249999232     gbgss295.seq
 249998859     gbgss296.seq
 249998763     gbgss297.seq
 245859686     gbgss298.seq
 249999268     gbgss299.seq
 230688019     gbgss3.seq
 230687702     gbgss30.seq
 249998441     gbgss300.seq
 249998109     gbgss301.seq
 242946342     gbgss302.seq
 249999336     gbgss303.seq
 249999917     gbgss304.seq
 249996918     gbgss305.seq
 249999542     gbgss306.seq
 115974109     gbgss307.seq
 249998013     gbgss308.seq
 250000031     gbgss309.seq
 230687623     gbgss31.seq
 249998209     gbgss310.seq
 249999909     gbgss311.seq
  94193676     gbgss312.seq
 249998892     gbgss313.seq
 249999850     gbgss314.seq
 250000016     gbgss315.seq
 203677706     gbgss316.seq
 249999236     gbgss317.seq
 249997993     gbgss318.seq
 249998006     gbgss319.seq
 230688014     gbgss32.seq
 249999353     gbgss320.seq
  95926739     gbgss321.seq
 249999461     gbgss322.seq
 249999350     gbgss323.seq
 249998406     gbgss324.seq
 249998619     gbgss325.seq
 104014105     gbgss326.seq
 249999853     gbgss327.seq
 249998411     gbgss328.seq
 249998272     gbgss329.seq
 230689234     gbgss33.seq
  42310440     gbgss330.seq
  52344567     gbgss331.seq
 249997702     gbgss332.seq
 249998616     gbgss333.seq
 249998787     gbgss334.seq
  42745861     gbgss335.seq
 230690170     gbgss34.seq
 230687446     gbgss35.seq
 230687449     gbgss36.seq
 230689711     gbgss37.seq
 230689333     gbgss38.seq
 230688521     gbgss39.seq
 230688277     gbgss4.seq
 230688678     gbgss40.seq
 230687924     gbgss41.seq
 183378776     gbgss42.seq
 230690039     gbgss43.seq
 230687983     gbgss44.seq
 230689112     gbgss45.seq
 230689023     gbgss46.seq
 230689317     gbgss47.seq
 230687620     gbgss48.seq
 230688563     gbgss49.seq
 230688928     gbgss5.seq
 230689373     gbgss50.seq
 230689939     gbgss51.seq
 230689347     gbgss52.seq
 230689096     gbgss53.seq
 230687835     gbgss54.seq
 230689327     gbgss55.seq
 230688439     gbgss56.seq
 230687627     gbgss57.seq
 230689305     gbgss58.seq
 230690797     gbgss59.seq
 230687903     gbgss6.seq
 230688308     gbgss60.seq
 230689837     gbgss61.seq
 229148385     gbgss62.seq
 230687674     gbgss63.seq
 230688366     gbgss64.seq
 230690076     gbgss65.seq
 230687671     gbgss66.seq
 230689252     gbgss67.seq
  11874385     gbgss68.seq
 230689356     gbgss69.seq
 230688491     gbgss7.seq
 230688943     gbgss70.seq
 230689150     gbgss71.seq
 230687765     gbgss72.seq
 230688682     gbgss73.seq
 230688846     gbgss74.seq
 230687859     gbgss75.seq
 230689630     gbgss76.seq
 230689899     gbgss77.seq
 230688328     gbgss78.seq
 230689003     gbgss79.seq
 230689881     gbgss8.seq
 230689422     gbgss80.seq
 230689083     gbgss81.seq
 230687586     gbgss82.seq
 224043201     gbgss83.seq
 194195467     gbgss84.seq
 194387932     gbgss85.seq
 230690545     gbgss86.seq
 230688978     gbgss87.seq
 230688108     gbgss88.seq
 230688085     gbgss89.seq
 230689954     gbgss9.seq
 230688257     gbgss90.seq
 230687627     gbgss91.seq
 230689107     gbgss92.seq
 230688891     gbgss93.seq
  66346630     gbgss94.seq
 230688492     gbgss95.seq
 230688490     gbgss96.seq
 230689554     gbgss97.seq
 230688267     gbgss98.seq
 230687926     gbgss99.seq
 249997931     gbhtc1.seq
 249997604     gbhtc10.seq
 240293332     gbhtc11.seq
 249998738     gbhtc12.seq
 249999086     gbhtc13.seq
  39668331     gbhtc14.seq
 249993865     gbhtc2.seq
 249987871     gbhtc3.seq
 249988555     gbhtc4.seq
 249999565     gbhtc5.seq
 249987864     gbhtc6.seq
 249999562     gbhtc7.seq
  71744040     gbhtc8.seq
 249998942     gbhtc9.seq
 249927410     gbhtg1.seq
 249805795     gbhtg10.seq
 189225484     gbhtg100.seq
 249851529     gbhtg101.seq
 249806057     gbhtg102.seq
 249640429     gbhtg103.seq
 249854298     gbhtg104.seq
 249890990     gbhtg105.seq
  16822705     gbhtg106.seq
 249984139     gbhtg107.seq
 249876077     gbhtg108.seq
 249923982     gbhtg109.seq
   1643239     gbhtg11.seq
 249797205     gbhtg110.seq
 249949780     gbhtg111.seq
 249985508     gbhtg112.seq
  87740095     gbhtg113.seq
 249976579     gbhtg114.seq
 249686249     gbhtg115.seq
 249645918     gbhtg116.seq
 249877716     gbhtg117.seq
 249943374     gbhtg118.seq
 105318881     gbhtg119.seq
 249672637     gbhtg12.seq
 249953500     gbhtg120.seq
 249797774     gbhtg121.seq
 249976106     gbhtg122.seq
 249858277     gbhtg123.seq
 249910762     gbhtg124.seq
 203984960     gbhtg125.seq
 249823735     gbhtg126.seq
 249989247     gbhtg127.seq
 249773825     gbhtg128.seq
 249751341     gbhtg129.seq
 249994154     gbhtg13.seq
 249810902     gbhtg130.seq
 249742771     gbhtg131.seq
 249883685     gbhtg132.seq
  77603601     gbhtg133.seq
 249923139     gbhtg14.seq
 249887370     gbhtg15.seq
 249903979     gbhtg16.seq
 249928879     gbhtg17.seq
 249897186     gbhtg18.seq
 249782079     gbhtg19.seq
 249995175     gbhtg2.seq
 249922675     gbhtg20.seq
 249705982     gbhtg21.seq
    663923     gbhtg22.seq
 249935637     gbhtg23.seq
 249930338     gbhtg24.seq
 249916817     gbhtg25.seq
 249938388     gbhtg26.seq
 249728773     gbhtg27.seq
 249962257     gbhtg28.seq
 249995659     gbhtg29.seq
 249928345     gbhtg3.seq
 249920218     gbhtg30.seq
 249832811     gbhtg31.seq
 248099972     gbhtg32.seq
 249953487     gbhtg33.seq
 249680797     gbhtg34.seq
 249885526     gbhtg35.seq
 249888558     gbhtg36.seq
 249770779     gbhtg37.seq
 249991862     gbhtg38.seq
 249835225     gbhtg39.seq
 249925673     gbhtg4.seq
 249799074     gbhtg40.seq
 249894066     gbhtg41.seq
 249127224     gbhtg42.seq
 249971930     gbhtg43.seq
 249833555     gbhtg44.seq
 249692004     gbhtg45.seq
 249889579     gbhtg46.seq
 249973501     gbhtg47.seq
 249886925     gbhtg48.seq
 249968530     gbhtg49.seq
 249980040     gbhtg5.seq
 249821273     gbhtg50.seq
 249992446     gbhtg51.seq
 238540519     gbhtg52.seq
 249907538     gbhtg53.seq
 249895260     gbhtg54.seq
 249963171     gbhtg55.seq
 249883402     gbhtg56.seq
 249982830     gbhtg57.seq
  20953216     gbhtg58.seq
 249812053     gbhtg59.seq
 249974518     gbhtg6.seq
 249738037     gbhtg60.seq
 249894473     gbhtg61.seq
 249907692     gbhtg62.seq
 229373446     gbhtg63.seq
 249879507     gbhtg64.seq
 249821147     gbhtg65.seq
 249815058     gbhtg66.seq
 249969238     gbhtg67.seq
 249853035     gbhtg68.seq
  18956917     gbhtg69.seq
 249851850     gbhtg7.seq
 249955271     gbhtg70.seq
 249973586     gbhtg71.seq
 249953795     gbhtg72.seq
 249873260     gbhtg73.seq
 229551400     gbhtg74.seq
 249702828     gbhtg75.seq
 249798131     gbhtg76.seq
 249986935     gbhtg77.seq
 249979375     gbhtg78.seq
 249819509     gbhtg79.seq
 249791419     gbhtg8.seq
   5765707     gbhtg80.seq
 249850231     gbhtg81.seq
 249832183     gbhtg82.seq
 249874096     gbhtg83.seq
 249908203     gbhtg84.seq
 227777780     gbhtg85.seq
 249895274     gbhtg86.seq
 249696456     gbhtg87.seq
 249882152     gbhtg88.seq
 249788509     gbhtg89.seq
 249971606     gbhtg9.seq
 240148231     gbhtg90.seq
 249979932     gbhtg91.seq
 249827811     gbhtg92.seq
 249855904     gbhtg93.seq
 249855546     gbhtg94.seq
 247118118     gbhtg95.seq
 249871892     gbhtg96.seq
 249991442     gbhtg97.seq
 249781983     gbhtg98.seq
 249821096     gbhtg99.seq
 249952469     gbinv1.seq
 249999686     gbinv10.seq
 135785414     gbinv11.seq
 250000173     gbinv12.seq
 249997755     gbinv13.seq
 249997837     gbinv14.seq
  70398337     gbinv15.seq
 249970193     gbinv2.seq
 223027174     gbinv3.seq
 250000240     gbinv4.seq
 249997319     gbinv5.seq
 248271083     gbinv6.seq
 231312208     gbinv7.seq
 249999398     gbinv8.seq
 249999321     gbinv9.seq
 141195389     gbjou1.idx
 163119978     gbjou2.idx
 204744799     gbjou3.idx
 294357517     gbjou4.idx
 293555271     gbjou5.idx
 172879342     gbjou6.idx
 195169533     gbkey1.idx
 295989437     gbkey2.idx
  64941894     gbkey3.idx
 249933973     gbmam1.seq
 250000203     gbmam2.seq
 249804684     gbmam3.seq
 249999204     gbmam4.seq
  41325857     gbmam5.seq
  24215880     gbnew.txt
 249999490     gbpat1.seq
 249998794     gbpat10.seq
 178596932     gbpat11.seq
 249999037     gbpat12.seq
 249999685     gbpat13.seq
 249997481     gbpat14.seq
 249999389     gbpat15.seq
 249999990     gbpat16.seq
  66795332     gbpat17.seq
 249999229     gbpat18.seq
 249999331     gbpat19.seq
 249998408     gbpat2.seq
 249999934     gbpat20.seq
 249996628     gbpat21.seq
 184270095     gbpat22.seq
 249999125     gbpat23.seq
 249911356     gbpat24.seq
 249999926     gbpat25.seq
 249999579     gbpat26.seq
  70937199     gbpat27.seq
 249999301     gbpat28.seq
 249998232     gbpat29.seq
 250000152     gbpat3.seq
 249998730     gbpat30.seq
 250000194     gbpat31.seq
 250000170     gbpat32.seq
 179951281     gbpat33.seq
 249998339     gbpat34.seq
 250000224     gbpat35.seq
 249999348     gbpat36.seq
 249999276     gbpat37.seq
 250000193     gbpat38.seq
 249999085     gbpat39.seq
 250000173     gbpat4.seq
 250000208     gbpat40.seq
 249999473     gbpat41.seq
 249999854     gbpat42.seq
  17859709     gbpat43.seq
 249998738     gbpat44.seq
 249999246     gbpat45.seq
 249999730     gbpat46.seq
 249999601     gbpat47.seq
 222932013     gbpat48.seq
 249999057     gbpat49.seq
  71763868     gbpat5.seq
 249999815     gbpat50.seq
 249999501     gbpat51.seq
 249992715     gbpat52.seq
 250000205     gbpat53.seq
 249999741     gbpat54.seq
  42245913     gbpat55.seq
 249999879     gbpat56.seq
 249999564     gbpat57.seq
 249929730     gbpat58.seq
 249824878     gbpat59.seq
 249999527     gbpat6.seq
 249998855     gbpat60.seq
 185894075     gbpat61.seq
 249999689     gbpat62.seq
 249999409     gbpat63.seq
 249999376     gbpat64.seq
 249948122     gbpat65.seq
 249999832     gbpat66.seq
  22427041     gbpat67.seq
 249999307     gbpat7.seq
 249998425     gbpat8.seq
 249999187     gbpat9.seq
  84440450     gbphg1.seq
 250000173     gbpln1.seq
 249803382     gbpln10.seq
 249827035     gbpln11.seq
  82920633     gbpln12.seq
 249992954     gbpln13.seq
 249999938     gbpln14.seq
 249999503     gbpln15.seq
 245562248     gbpln16.seq
 249912421     gbpln17.seq
 249255965     gbpln18.seq
 218968470     gbpln19.seq
 249914688     gbpln2.seq
 249163625     gbpln20.seq
 249976432     gbpln21.seq
 112638632     gbpln22.seq
 249997699     gbpln23.seq
  94021047     gbpln24.seq
 250000199     gbpln25.seq
 249998565     gbpln26.seq
 249974607     gbpln27.seq
 249598215     gbpln28.seq
 249999822     gbpln29.seq
 249961718     gbpln3.seq
 249951947     gbpln30.seq
 210334553     gbpln31.seq
 249997035     gbpln32.seq
 249999427     gbpln33.seq
 249998833     gbpln34.seq
 250000053     gbpln35.seq
 249891548     gbpln36.seq
 249997171     gbpln37.seq
  55093015     gbpln38.seq
 249835787     gbpln4.seq
 248097866     gbpln5.seq
 249998214     gbpln6.seq
 115752655     gbpln7.seq
 249997386     gbpln8.seq
 249994125     gbpln9.seq
 148880648     gbpri1.seq
 249819332     gbpri10.seq
 113457682     gbpri11.seq
 249966221     gbpri12.seq
 249900325     gbpri13.seq
 249891160     gbpri14.seq
 249940560     gbpri15.seq
 249931410     gbpri16.seq
 249834302     gbpri17.seq
 249885559     gbpri18.seq
 249926304     gbpri19.seq
 249912923     gbpri2.seq
 249828716     gbpri20.seq
 194105072     gbpri21.seq
 179996318     gbpri22.seq
 249998858     gbpri23.seq
 204620345     gbpri24.seq
 249898260     gbpri25.seq
 249938742     gbpri26.seq
 249965246     gbpri27.seq
 249900509     gbpri28.seq
 249986882     gbpri29.seq
 249863790     gbpri3.seq
 249966994     gbpri30.seq
 249878919     gbpri31.seq
 249999441     gbpri32.seq
  80821335     gbpri33.seq
 249995687     gbpri34.seq
 249993621     gbpri35.seq
 249997182     gbpri36.seq
 249999840     gbpri37.seq
 249998015     gbpri38.seq
 203448968     gbpri39.seq
 249983127     gbpri4.seq
 249798743     gbpri5.seq
 249950426     gbpri6.seq
 249853211     gbpri7.seq
 249978606     gbpri8.seq
 249871979     gbpri9.seq
    337795     gbrel.txt
 249922501     gbrod1.seq
 249926461     gbrod10.seq
  11933851     gbrod11.seq
 249932781     gbrod12.seq
 249847965     gbrod13.seq
 249977548     gbrod14.seq
 249846993     gbrod15.seq
 249802987     gbrod16.seq
 249809663     gbrod17.seq
 249998503     gbrod18.seq
  48303860     gbrod19.seq
 249762419     gbrod2.seq
 249977153     gbrod20.seq
 249896181     gbrod21.seq
 226408693     gbrod22.seq
 249995487     gbrod23.seq
 249994849     gbrod24.seq
 249952945     gbrod25.seq
 249880775     gbrod26.seq
 249998990     gbrod27.seq
 215439860     gbrod28.seq
 249837735     gbrod3.seq
 249749785     gbrod4.seq
 249828684     gbrod5.seq
 249871088     gbrod6.seq
 249788210     gbrod7.seq
 249990695     gbrod8.seq
 249896208     gbrod9.seq
1882645928     gbsdr1.txt
4873959900     gbsdr2.txt
2032886678     gbsdr3.txt
 150677977     gbsec.idx
 249998508     gbsts1.seq
 249997362     gbsts10.seq
 212226966     gbsts11.seq
 249996524     gbsts12.seq
 249999103     gbsts13.seq
 249999627     gbsts14.seq
 249999617     gbsts15.seq
  26659799     gbsts16.seq
 249999841     gbsts17.seq
 249998651     gbsts18.seq
 249999310     gbsts19.seq
 249999954     gbsts2.seq
 112273004     gbsts20.seq
 249999853     gbsts3.seq
 249997843     gbsts4.seq
  29080345     gbsts5.seq
 249997222     gbsts6.seq
 249997899     gbsts7.seq
 249998458     gbsts8.seq
 249996448     gbsts9.seq
 249998667     gbsyn1.seq
 204464418     gbsyn2.seq
 109624061     gbtsa1.seq
    436898     gbuna1.seq
 249998144     gbvrl1.seq
 249999200     gbvrl10.seq
 167041568     gbvrl11.seq
 249999444     gbvrl2.seq
 249997310     gbvrl3.seq
 249991676     gbvrl4.seq
 108771656     gbvrl5.seq
 249996204     gbvrl6.seq
 249999879     gbvrl7.seq
 249999802     gbvrl8.seq
 249998233     gbvrl9.seq
 249892988     gbvrt1.seq
 249862544     gbvrt10.seq
 169668222     gbvrt11.seq
 249998367     gbvrt12.seq
 249906368     gbvrt13.seq
 249988305     gbvrt14.seq
 249999722     gbvrt15.seq
 249961147     gbvrt16.seq
 249997028     gbvrt17.seq
 130106030     gbvrt18.seq
 249999520     gbvrt2.seq
 249845759     gbvrt3.seq
 223190229     gbvrt4.seq
 249995543     gbvrt5.seq
 249999785     gbvrt6.seq
 249976595     gbvrt7.seq
 249996502     gbvrt8.seq
 249978806     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         41084      96196235
BCT10        7378       114352463
BCT11        8774       10645672
BCT12        53627      85124241
BCT13        94         110535707
BCT14        152        96252832
BCT15        58         108181341
BCT16        51         108348224
BCT17        46         110993195
BCT18        56         110572060
BCT19        66         108817610
BCT2         48         111664782
BCT20        36         96325907
BCT21        40         106881287
BCT22        58         105533856
BCT23        74         111675191
BCT24        55         110045255
BCT25        63         106845562
BCT26        55         109017085
BCT27        53         109614678
BCT28        49         109401607
BCT29        92         109698367
BCT3         53         110332697
BCT30        55         106078414
BCT31        119        111062788
BCT32        83         106376763
BCT33        363        97825104
BCT34        11516      94150428
BCT35        12644      14987546
BCT36        25165      27516431
BCT37        50395      53781494
BCT38        77452      79103104
BCT39        35961      94742236
BCT4         14914      106089164
BCT40        23258      49690157
BCT5         23538      37758120
BCT6         39039      87158000
BCT7         6975       95592396
BCT8         13964      92286217
BCT9         5010       105778395
ENV1         93758      71950615
ENV10        84876      88695007
ENV11        84982      82404876
ENV12        92149      77074080
ENV13        48511      35744661
ENV2         91203      70582076
ENV3         85197      80661060
ENV4         90241      84354455
ENV5         98536      69642555
ENV6         7659       790903
ENV7         130734     30792617
ENV8         87184      70742110
ENV9         94179      73860500
EST1         68133      26292391
EST10        76525      29835528
EST100       77562      44780114
EST101       75708      34663224
EST102       74755      43489510
EST103       70438      36396171
EST104       75737      34903039
EST105       72232      43514965
EST106       73905      35454436
EST107       72239      41280760
EST108       67973      36693785
EST109       73239      36061197
EST11        75178      28795344
EST110       72538      49331221
EST111       72348      42768952
EST112       69331      45243336
EST113       73591      33065869
EST114       70787      29721750
EST115       64909      33679998
EST116       67810      39277041
EST117       69887      39840651
EST118       71406      40409978
EST119       75371      34193975
EST12        77543      30738618
EST120       4978       1776265
EST121       74485      27368305
EST122       74005      32625533
EST123       73029      37035946
EST124       65479      35505413
EST125       79991      45739451
EST126       78301      43475011
EST127       68334      47822876
EST128       68723      39268676
EST129       74330      51196373
EST13        76994      29270762
EST130       69038      41455932
EST131       73697      45124849
EST132       74077      45495204
EST133       71300      48689559
EST134       73616      48192942
EST135       78242      45508035
EST136       75353      31498248
EST137       77914      32291694
EST138       79564      46963790
EST139       74525      42439888
EST14        78913      32001925
EST140       64982      35299807
EST141       71291      36841728
EST142       67104      36789989
EST143       66072      36087904
EST144       71212      44055942
EST145       72575      44750780
EST146       67662      39260364
EST147       67504      40068036
EST148       75970      45642259
EST149       68486      40563893
EST15        74548      31492027
EST150       3139       1409462
EST151       62857      35893747
EST152       96827      52671089
EST153       78766      45264610
EST154       81001      41997908
EST155       99813      53391946
EST156       103637     56022003
EST157       96290      53068099
EST158       71990      44214331
EST159       92170      53917584
EST16        75892      33360637
EST160       97117      58394811
EST161       88658      54746656
EST162       85079      45342531
EST163       71420      41806605
EST164       64793      31416928
EST165       63516      28970230
EST166       53569      25321066
EST167       67371      32011306
EST168       59504      30347131
EST169       70244      38483895
EST17        82054      33775928
EST170       69464      48900352
EST171       67200      46940269
EST172       79588      46219724
EST173       57819      29883781
EST174       62652      31887458
EST175       66810      39276051
EST176       64474      41189774
EST177       62332      39471630
EST178       65039      33043524
EST179       97974      46563710
EST18        80670      32407019
EST180       92609      54954613
EST181       104034     60225524
EST182       96758      53959099
EST183       93499      47238902
EST184       89903      38146439
EST185       97595      50183716
EST186       95707      41451804
EST187       95217      40821461
EST188       76199      37932606
EST189       66585      45042079
EST19        78695      31694668
EST190       68005      38772155
EST191       63109      42492480
EST192       67962      31556033
EST193       75179      29219176
EST194       70501      44985360
EST195       81662      40883528
EST196       63388      32498304
EST197       67404      44767494
EST198       68615      49365937
EST199       69890      36740451
EST2         74655      28649942
EST20        74621      30767053
EST200       66267      41045955
EST201       70297      57066459
EST202       67406      33840425
EST203       73090      37365660
EST204       68734      57730945
EST205       52411      40811840
EST206       63763      47240629
EST207       63666      46386479
EST208       64306      47075959
EST209       64121      45124023
EST21        74093      34379154
EST210       65739      49945809
EST211       62901      39666160
EST212       63736      35074589
EST213       63339      36407116
EST214       73182      41595657
EST215       91680      53649816
EST216       68386      46255114
EST217       96426      58170178
EST218       113645     70459442
EST219       115706     68012177
EST22        74861      29973418
EST220       101670     62943888
EST221       98692      63699733
EST222       118820     52670382
EST223       83229      45917935
EST224       87257      52540790
EST225       95206      41596949
EST226       85940      46145285
EST227       71972      46418715
EST228       67077      44813670
EST229       68946      59145144
EST23        77392      32716077
EST230       70100      57570666
EST231       79639      40064796
EST232       856        529441
EST233       79525      46958480
EST234       73715      52320738
EST235       70494      51423540
EST236       38689      18665964
EST237       28002      10667463
EST238       27774      10278085
EST239       26529      9747765
EST24        74749      32778850
EST240       26789      9013948
EST241       27872      10123634
EST242       27413      9965693
EST243       27400      9886073
EST244       27517      10525235
EST245       27325      12119183
EST246       27435      11238556
EST247       27544      10084234
EST248       27837      9335395
EST249       27130      9484903
EST25        74131      32016648
EST250       28018      11366295
EST251       27907      10972147
EST252       27118      11427458
EST253       26897      12103970
EST254       27290      11309856
EST255       27246      10920897
EST256       27233      11883638
EST257       27377      11624561
EST258       27480      10958983
EST259       27470      10956667
EST26        75149      30991116
EST260       27328      10492270
EST261       27085      12324588
EST262       24569      17199194
EST263       26197      17649561
EST264       53926      24950311
EST265       88821      40822530
EST266       68030      40517158
EST267       77637      34221506
EST268       89192      40000546
EST269       69690      44298747
EST27        74443      32425686
EST270       69256      44703098
EST271       69173      44235114
EST272       67082      41506103
EST273       74401      43385435
EST274       65468      38963667
EST275       70781      50233370
EST276       55590      27667577
EST277       97377      46051581
EST278       85371      41618395
EST279       71475      40358818
EST28        101445     47727853
EST280       61938      30264372
EST281       70694      36189126
EST282       70368      41078201
EST283       73768      34242215
EST284       70571      37903777
EST285       70789      45052403
EST286       65181      37663804
EST287       69138      34101916
EST288       86178      46097824
EST289       73587      41570349
EST29        97408      45558143
EST290       78729      55678094
EST291       87156      52206865
EST292       105536     47699883
EST293       78369      45340473
EST294       72313      42263627
EST295       73850      39815211
EST296       68702      33239067
EST297       70377      27806156
EST298       65568      39980842
EST299       62541      35865370
EST3         73735      29916627
EST30        98266      53440195
EST300       66026      42135694
EST301       69538      40034304
EST302       63970      44132274
EST303       66955      33593662
EST304       81812      44218979
EST305       80009      43185224
EST306       85762      51460369
EST307       38974      22184711
EST308       117917     49129604
EST309       92754      40774617
EST31        87350      51905440
EST310       64621      35515438
EST311       71005      43846861
EST312       80453      43457457
EST313       73140      38945063
EST314       70746      45034298
EST315       70174      39167290
EST316       61819      36051018
EST317       48008      25226258
EST318       71731      52022948
EST319       69108      38912650
EST32        67067      39620632
EST320       72993      46205905
EST321       64262      35632956
EST322       70812      36593350
EST323       56079      28331441
EST324       55452      28719403
EST325       54641      29058291
EST326       53989      28508033
EST327       54715      29797833
EST328       58176      24247842
EST329       57917      24790560
EST33        70356      59040843
EST330       56332      23119925
EST331       57640      22360239
EST332       57028      22814569
EST333       58565      23385360
EST334       57102      22162559
EST335       58341      20970475
EST336       64929      35999155
EST337       78362      36100673
EST338       76756      33898473
EST339       44433      17883668
EST34        84839      48800084
EST340       76192      32602700
EST341       85422      49891457
EST342       65549      49807518
EST343       71415      47448220
EST344       95918      59664727
EST345       96873      58492396
EST346       99419      55757233
EST347       97196      53181721
EST348       76965      40947998
EST349       70922      40279318
EST35        85799      42567813
EST350       77110      43314011
EST351       63533      55227328
EST352       63720      46215860
EST353       63512      41242658
EST354       60832      33537904
EST355       72885      51800493
EST356       51207      28612135
EST357       52803      26192096
EST358       69867      37987605
EST359       61257      33036003
EST36        88487      47564473
EST360       62892      31613863
EST361       63996      41091248
EST362       84274      43426499
EST363       70399      41699234
EST364       68280      43436633
EST365       67740      37692831
EST366       63119      41835406
EST367       86495      49958282
EST368       60207      36874088
EST369       88455      48061913
EST37        87435      62462748
EST370       61453      32241081
EST371       65502      40584862
EST372       75460      37881824
EST373       49975      27022700
EST374       60039      32738807
EST375       70817      41210242
EST376       89020      47061044
EST377       85250      42912367
EST378       70122      47042001
EST379       66433      46793160
EST38        77150      49323704
EST380       68942      38460393
EST381       61747      34974927
EST382       93307      38756066
EST383       59045      38511145
EST384       53547      39036595
EST385       61666      35390407
EST386       78880      50045551
EST387       97567      53976362
EST388       65174      38775990
EST389       82574      45632619
EST39        97229      57175262
EST390       57278      33975580
EST391       41091      23104291
EST392       56081      33562501
EST393       82483      48018604
EST394       78560      45288960
EST395       72432      43338309
EST396       78668      46919664
EST397       77052      48725810
EST398       51380      34415737
EST399       83083      65728715
EST4         74558      28387157
EST40        63898      49001100
EST400       42849      37791679
EST401       58047      43504537
EST402       94176      52146166
EST403       81895      37897229
EST404       79121      37580114
EST405       39171      35208152
EST406       66197      53148663
EST407       71927      40779875
EST408       59458      38472210
EST409       74685      40103310
EST41        78139      56178750
EST410       52885      32961401
EST411       76949      30743616
EST412       80325      27695910
EST413       70358      44865701
EST414       64349      36696693
EST415       68763      35774122
EST416       70760      42240878
EST417       70095      46347388
EST418       66251      44875594
EST419       75842      44343214
EST42        98675      46789822
EST420       58971      32922663
EST421       61248      37724291
EST422       80661      51649737
EST423       83414      48319047
EST424       77700      44069215
EST425       58775      40836137
EST426       56115      40637893
EST427       56772      39977687
EST428       60103      38443602
EST429       59037      37035876
EST43        75582      45361980
EST430       55181      32233422
EST431       53216      35133204
EST432       65009      41181005
EST433       58184      41095572
EST434       60151      41857575
EST435       50904      36120493
EST436       63599      40510694
EST437       88046      39929018
EST438       70515      38944186
EST439       70698      38598030
EST44        105717     45833818
EST440       70486      39354414
EST441       70573      38753160
EST442       70329      39417783
EST443       70179      38918993
EST444       69822      38897925
EST445       69679      39439915
EST446       69874      39137926
EST447       67978      38488243
EST448       69896      38279267
EST449       70286      39732617
EST45        91359      50923296
EST450       70297      39009988
EST451       70269      38213449
EST452       70705      38771064
EST453       70666      38863473
EST454       70560      38796211
EST455       70806      38449917
EST456       72119      37664706
EST457       90954      53107869
EST458       82656      37050056
EST459       96363      54380269
EST46        104784     47713623
EST460       88789      50134298
EST461       74652      44462637
EST462       83345      50847327
EST463       77102      40064720
EST464       90099      55095797
EST465       98399      60223948
EST466       80043      47147060
EST467       88165      48367077
EST468       88778      49803608
EST469       77359      59193457
EST47        70596      19689672
EST470       92875      53257773
EST471       77811      49465571
EST472       60149      42041195
EST473       102554     61933224
EST474       96667      65857299
EST475       98247      65987085
EST476       112123     45116066
EST477       99112      47207702
EST478       61958      42027028
EST479       51501      40316071
EST48        70444      18731483
EST480       72406      44296775
EST481       61578      37119417
EST482       73190      43290140
EST483       112915     56803176
EST484       76798      47376693
EST485       83813      57708640
EST486       50304      30089492
EST487       48058      43386999
EST488       46349      59042796
EST489       71767      55737559
EST49        74988      22145008
EST490       64992      37997824
EST491       72533      42773322
EST492       71477      42068797
EST493       67101      43706632
EST494       65521      47371215
EST495       72200      47047567
EST496       109293     47981001
EST497       91536      48691602
EST498       63909      46997762
EST499       58380      42358402
EST5         48196      15294344
EST50        44189      12188893
EST500       58259      39549465
EST501       65897      47608036
EST502       64927      45690360
EST503       62826      46156565
EST504       52185      37076678
EST505       51826      38198455
EST506       59691      42546120
EST507       61848      35509573
EST508       71290      45016136
EST509       57381      38197248
EST51        44051      12170187
EST510       57181      39693942
EST511       62406      46433514
EST512       60147      46258047
EST513       70514      45888925
EST514       49826      39782287
EST515       58132      39412432
EST516       53142      34830096
EST517       45280      31859520
EST518       54093      35488545
EST519       77498      43996661
EST52        43798      12008232
EST520       64826      54466433
EST521       71612      53069498
EST522       77325      48519675
EST523       46067      58560873
EST524       54323      49880099
EST525       67771      51750175
EST526       56477      38649041
EST527       75915      41588352
EST528       84260      54257359
EST529       81712      52993886
EST53        58006      21514727
EST530       72479      43535210
EST531       57722      38007932
EST532       74379      49820002
EST533       81585      49109488
EST534       78934      58675284
EST535       70532      49890700
EST536       71247      51290946
EST537       62297      43012251
EST538       65439      50647764
EST539       62799      45250834
EST54        97564      39495236
EST540       71410      44269543
EST541       77017      44574783
EST542       100239     43192488
EST543       121136     47185422
EST544       83471      51946503
EST545       55545      49884994
EST546       55981      47963988
EST547       25909      13865768
EST548       99124      11883647
EST549       99794      10976877
EST55        36804      15262018
EST550       98488      25759449
EST551       88188      36430008
EST552       86879      31668976
EST553       78740      44212666
EST554       66547      60072283
EST555       91024      55775795
EST556       80670      44172804
EST557       67495      44042089
EST558       71305      46962450
EST559       75202      49957939
EST56        97082      43767794
EST560       85488      50887326
EST561       73218      53538835
EST562       67489      46932135
EST563       72160      55064198
EST564       85673      50764382
EST565       83863      45818171
EST566       82575      45460737
EST567       84393      40418415
EST568       83366      45810967
EST569       76130      51624898
EST57        92586      47769506
EST570       72573      55429530
EST571       74541      51853981
EST572       81961      44377170
EST573       73113      35928932
EST574       112354     47287444
EST575       112186     48420010
EST576       130673     59103354
EST577       109434     53867365
EST578       77261      55237167
EST579       79528      32713645
EST58        91465      41641705
EST580       84291      8743373
EST581       89435      27013791
EST582       129591     63841743
EST583       108826     50513202
EST584       67417      44994364
EST585       69504      40532033
EST586       70587      48723625
EST587       76163      46284249
EST588       72472      44701183
EST589       73477      46621851
EST59        107973     56742409
EST590       69705      53470516
EST591       92595      54891240
EST592       97838      51349822
EST593       67043      35446939
EST594       64411      43836965
EST595       81388      54231898
EST596       101339     59934359
EST597       62481      36431580
EST598       77793      41179617
EST599       92141      14924949
EST6         54912      17441503
EST60        97571      47997676
EST600       96854      10393963
EST601       96832      10434816
EST602       79085      39421377
EST603       83646      46116883
EST604       87625      47731681
EST605       68148      50228983
EST606       81722      56088126
EST607       84972      49958821
EST608       77618      52349623
EST609       79939      48362972
EST61        76853      33012326
EST610       78491      42578224
EST611       81798      51147539
EST612       72883      52527376
EST613       61901      38876421
EST614       89250      25068760
EST615       78133      44620395
EST616       50367      33869060
EST617       51441      32221441
EST618       50523      35764815
EST619       73182      44770002
EST62        67493      29794798
EST620       65384      47795455
EST621       74172      42710553
EST622       122716     11143567
EST623       118298     14615211
EST624       24917      2215685
EST625       122629     11279246
EST626       122611     11303718
EST627       74038      41945678
EST628       64039      49471314
EST629       73228      47591377
EST63        72176      31558531
EST630       77974      50682986
EST631       68636      50720032
EST632       74363      44009267
EST633       66505      42993273
EST634       66550      42267233
EST635       93445      31867276
EST636       127308     11684247
EST637       109509     20575435
EST638       82547      46394010
EST639       68422      51247625
EST64        70516      29536077
EST640       74008      45764703
EST641       91291      49738197
EST642       83032      53176913
EST643       58982      33998586
EST644       69446      35981854
EST645       75716      63532464
EST646       77516      47558450
EST647       108772     49119351
EST648       77882      51588645
EST649       61446      48518572
EST65        81652      33240519
EST650       41430      32397674
EST651       74773      51169691
EST652       74483      36630194
EST653       91025      54803567
EST654       81252      49268485
EST655       84571      40864331
EST656       71547      46768968
EST657       69327      52069087
EST658       90486      44155982
EST659       77300      26706049
EST66        74849      29876966
EST660       77697      24142389
EST661       75726      29449116
EST662       76243      27231768
EST663       76576      28013076
EST664       75901      30311325
EST665       76076      28223885
EST666       76048      28200363
EST667       76847      28660513
EST668       76153      30090339
EST669       82225      43933984
EST67        68057      27832999
EST670       80729      50838484
EST671       81944      59859895
EST672       82970      58175442
EST673       71149      39221056
EST674       60725      36402462
EST675       75425      46234538
EST676       62150      30460591
EST677       40260      35022758
EST678       59103      43111244
EST679       1248       980447
EST68        67423      29710411
EST680       58855      45979338
EST681       64598      44685995
EST682       77736      42741002
EST683       66192      37954200
EST684       85760      51854496
EST685       80500      43666012
EST686       65572      41603012
EST687       72309      48029692
EST688       79901      46451060
EST689       66499      35445912
EST69        76444      36230601
EST690       70388      48491147
EST691       76683      50597007
EST692       58159      40240623
EST693       70045      50538211
EST694       73554      49804125
EST695       71689      45713969
EST696       70311      47342530
EST697       67896      48664189
EST698       81122      69387777
EST699       82150      69243419
EST7         74531      29351877
EST70        73802      32166186
EST700       82557      68891439
EST701       75106      38933527
EST702       77141      35010963
EST703       54271      30759560
EST704       65940      46233516
EST705       62760      41790655
EST706       65052      45091141
EST707       70958      48709008
EST708       58524      39735423
EST709       45859      30316650
EST71        74804      28050851
EST710       58619      39332066
EST711       68089      43233445
EST712       64152      44967923
EST713       66207      45278423
EST714       65760      46049001
EST715       69941      45245656
EST716       72535      51961418
EST717       74592      45666254
EST718       68288      38465826
EST719       66732      39687751
EST72        78283      29168333
EST720       67499      37709840
EST721       68960      39058771
EST722       66748      42157243
EST723       68421      53869707
EST724       66209      44232110
EST725       70974      43905934
EST726       77176      44327354
EST727       67702      46419271
EST728       59758      36991455
EST729       65246      40507260
EST73        79357      36432035
EST730       62079      37738251
EST731       68676      43020970
EST732       92158      53230911
EST733       101646     50130312
EST734       71561      42998550
EST735       56850      27699174
EST736       52342      30778623
EST737       51703      31794529
EST738       58640      40204457
EST739       61902      39894219
EST74        41010      11656695
EST740       57397      37838941
EST741       11438      6988944
EST742       66318      40811469
EST743       56996      37328919
EST744       54758      34025267
EST745       55865      35108200
EST746       80228      40732326
EST747       121239     32192593
EST748       81743      47431784
EST749       75333      30375480
EST75        40876      11275559
EST750       74926      30565693
EST751       66364      47188844
EST752       75519      44767035
EST753       81655      49497538
EST754       73370      46814426
EST755       74063      42816870
EST756       64226      39042973
EST757       57533      38320727
EST758       58904      39687281
EST759       60816      40297133
EST76        40925      12832516
EST760       59756      39274763
EST761       61519      39061291
EST762       71277      47271159
EST763       87417      60338928
EST764       81871      44758587
EST765       78479      50416475
EST766       67669      36264998
EST767       60002      29940427
EST768       70199      38025895
EST769       88522      56782567
EST77        41248      12540538
EST770       77993      59670776
EST771       14705      11313399
EST772       65237      46659836
EST773       32568      19505894
EST774       32612      19428349
EST775       32401      19806433
EST776       42022      22240133
EST777       76633      42080239
EST778       58633      34922980
EST779       58651      35435631
EST78        41356      12712137
EST780       58846      34944772
EST781       63931      31642326
EST782       70993      14741488
EST783       71072      14512653
EST784       71019      14621912
EST785       71243      14099892
EST786       70874      14962292
EST787       66252      27463476
EST788       87761      50604421
EST789       86475      58365212
EST79        41142      13065403
EST790       106409     52869446
EST791       113748     52325637
EST792       114038     51949667
EST793       113859     52209153
EST794       110147     54124924
EST795       72427      42903837
EST796       70074      44400440
EST797       60795      40687185
EST798       60061      39523841
EST799       61698      38337426
EST8         75815      30587752
EST80        41091      12798881
EST800       63274      37584031
EST801       36230      22761650
EST802       72913      42176589
EST803       81235      50929239
EST804       84962      55099343
EST805       93225      64983863
EST806       77721      39205289
EST807       65778      28034740
EST808       65394      39192251
EST809       99641      46608509
EST81        40909      12249799
EST810       77041      53326666
EST811       77531      13391528
EST812       75594      5868286
EST813       75773      5850614
EST814       70287      6075771
EST815       69081      6164538
EST816       70582      10923204
EST817       70852      15013447
EST818       71156      14304480
EST819       71114      14401699
EST82        40654      12394700
EST820       71019      14622773
EST821       71283      14003689
EST822       70809      15115169
EST823       66596      43208500
EST824       65146      40874125
EST825       79487      40311186
EST826       84467      56295265
EST827       75758      51958817
EST828       75194      51685742
EST829       70167      44106286
EST83        41649      12514840
EST830       78442      42417035
EST831       72564      54219969
EST832       68473      45905625
EST833       64058      44045467
EST834       62864      43493458
EST835       64491      45080818
EST836       63029      45256423
EST837       67450      41745005
EST838       65785      45772055
EST839       84015      64416211
EST84        41672      12396509
EST840       66148      47985058
EST841       56051      34799684
EST842       83041      51100739
EST843       76807      39687102
EST844       75382      11959378
EST845       75349      11978710
EST846       75597      11487036
EST847       74401      41947183
EST848       71194      48114000
EST849       67116      47571244
EST85        41548      13237207
EST850       68980      43327691
EST851       80332      52119380
EST852       75361      49088637
EST853       69432      24806839
EST854       73403      27586853
EST855       73726      25920083
EST856       78427      27187105
EST857       71935      25458460
EST858       69258      29444561
EST859       26853      10703778
EST86        41402      13144310
EST860       19121      5684282
EST87        44023      12574939
EST88        46831      22307128
EST89        25278      15661111
EST9         77566      29869904
EST90        42840      20371116
EST91        48323      19580464
EST92        51502      22860276
EST93        51921      22037197
EST94        80999      47507229
EST95        78621      38656286
EST96        72061      27901137
EST97        75974      29568862
EST98        74328      39313501
EST99        76687      41587850
GSS1         90362      38634399
GSS10        74798      43604453
GSS100       84096      57886858
GSS101       87756      51875429
GSS102       79678      69658798
GSS103       30491      19499456
GSS104       75187      41131086
GSS105       73921      44303907
GSS106       73487      45399028
GSS107       73577      45171207
GSS108       73233      45069658
GSS109       73601      43971022
GSS11        14401      7211408
GSS110       77774      51083758
GSS111       82908      56096537
GSS112       81447      53800742
GSS113       82539      51525717
GSS114       86563      51369994
GSS115       78708      64847132
GSS116       85333      47713033
GSS117       93938      54082575
GSS118       77420      48460305
GSS119       84623      58289029
GSS12        68793      36058629
GSS120       86168      68163463
GSS121       74927      38189244
GSS122       78209      53293164
GSS123       94235      50956236
GSS124       87340      55086809
GSS125       85383      54120665
GSS126       86025      54475086
GSS127       75378      65061512
GSS128       9714       8872437
GSS129       76020      67813816
GSS13        73177      38051744
GSS130       79823      58997829
GSS131       73424      50811733
GSS132       72361      50349671
GSS133       72822      49581379
GSS134       72640      49883871
GSS135       72388      50307409
GSS136       82602      57244647
GSS137       82672      57870421
GSS138       74608      58203440
GSS139       65904      55234222
GSS14        77207      38017781
GSS140       76262      64190837
GSS141       33454      30694781
GSS142       76321      59667076
GSS143       76736      51271847
GSS144       88955      56148947
GSS145       94951      57734592
GSS146       90517      58169657
GSS147       84506      54644021
GSS148       84239      54249535
GSS149       82562      56951639
GSS15        71534      32096192
GSS150       115062     59405945
GSS151       104139     57355506
GSS152       81927      57911623
GSS153       46868      28230257
GSS154       68852      49835421
GSS155       73003      55882486
GSS156       72979      55925187
GSS157       73002      55885497
GSS158       73010      55869735
GSS159       72978      55925863
GSS16        72919      36672338
GSS160       73010      55774453
GSS161       75659      57510178
GSS162       84535      39833109
GSS163       88698      60396605
GSS164       84607      66718790
GSS165       90497      57639977
GSS166       90361      56894876
GSS167       5040       3759172
GSS168       84794      58834915
GSS169       74214      46304247
GSS17        75700      44399512
GSS170       78873      51167537
GSS171       93254      58489534
GSS172       86752      60605156
GSS173       87009      61154593
GSS174       106724     17741417
GSS175       96255      35481706
GSS176       78133      47341295
GSS177       77936      51527855
GSS178       52224      38124004
GSS179       55994      44498007
GSS18        69981      32323984
GSS180       61344      50397563
GSS181       59668      45840024
GSS182       58114      49327011
GSS183       58135      49076679
GSS184       58876      46796232
GSS185       59070      46571524
GSS186       59457      49228244
GSS187       59499      49096786
GSS188       59327      49622737
GSS189       58625      48764616
GSS19        56980      28606663
GSS190       59218      46626758
GSS191       59920      50409336
GSS192       60866      50479223
GSS193       60916      50378393
GSS194       61090      49860782
GSS195       61065      49935670
GSS196       61339      49122352
GSS197       59818      47432854
GSS198       59765      45832514
GSS199       52205      42200063
GSS2         88995      39332101
GSS20        56918      28735950
GSS200       59618      46293726
GSS201       59296      47289491
GSS202       58923      48440394
GSS203       58866      48617001
GSS204       59289      49608851
GSS205       60644      50881444
GSS206       60532      51213272
GSS207       60941      47760729
GSS208       61533      45601987
GSS209       59963      50360294
GSS21        58055      25669052
GSS210       60214      49625982
GSS211       60047      50127235
GSS212       60172      49751145
GSS213       60033      50171171
GSS214       60303      49357315
GSS215       60183      49719551
GSS216       60300      49366125
GSS217       60352      49211212
GSS218       60100      47876064
GSS219       59759      45559643
GSS22        62582      34970544
GSS220       59169      47462849
GSS221       58759      48887656
GSS222       59178      47594673
GSS223       58759      47933487
GSS224       61180      50950929
GSS225       64821      54762562
GSS226       76224      56941376
GSS227       89329      55026784
GSS228       81454      48477764
GSS229       78492      57283391
GSS23        63336      32611804
GSS230       92357      52754642
GSS231       79349      50983225
GSS232       71266      47114597
GSS233       71255      47143602
GSS234       47339      31364139
GSS235       100492     51418803
GSS236       98230      66619521
GSS237       86661      55818382
GSS238       95899      62849411
GSS239       95546      63288431
GSS24        57586      26926199
GSS240       96236      62434525
GSS241       94762      64121357
GSS242       95252      63433981
GSS243       92447      66926235
GSS244       94169      64787793
GSS245       94965      63789542
GSS246       92313      67095199
GSS247       93162      66037407
GSS248       94166      64792868
GSS249       91739      68136272
GSS25        69372      44264284
GSS250       93877      63885191
GSS251       89986      70047792
GSS252       87145      67249781
GSS253       73741      51932072
GSS254       58197      34881310
GSS255       58840      38151779
GSS256       74561      38890339
GSS257       77289      37797123
GSS258       81466      33321902
GSS259       86116      27002217
GSS26        64854      25962847
GSS260       52731      35461332
GSS261       80719      62294888
GSS262       73401      72726198
GSS263       14605      9683326
GSS264       87206      64290178
GSS265       83558      62789495
GSS266       103479     48450628
GSS267       68581      58508010
GSS268       7322       6764176
GSS269       68689      57997997
GSS27        57893      26117806
GSS270       69318      56731875
GSS271       69558      56262131
GSS272       71310      56073507
GSS273       68163      51560938
GSS274       75915      58209304
GSS275       87237      74898207
GSS276       81830      44609896
GSS277       92719      44797633
GSS278       56945      44488309
GSS279       77438      61353715
GSS28        71502      32935892
GSS280       69655      58699702
GSS281       67711      62707076
GSS282       62114      53411022
GSS283       95388      42858252
GSS284       21157      4932057
GSS285       112598     70576666
GSS286       1162       860167
GSS287       23226      28867035
GSS288       106545     69076642
GSS289       84506      34579222
GSS29        59047      32171589
GSS290       38340      23887677
GSS291       120690     73137800
GSS292       118608     75280747
GSS293       107811     64309634
GSS294       44891      22456577
GSS295       83102      54651503
GSS296       95838      61461374
GSS297       107336     78533080
GSS298       106197     76573181
GSS299       106058     79947480
GSS3         87450      41840415
GSS30        83887      41504032
GSS300       104003     80020690
GSS301       76631      51210665
GSS302       104308     63116474
GSS303       109868     66415305
GSS304       106304     59376521
GSS305       68449      37485263
GSS306       70118      39030012
GSS307       36431      17060419
GSS308       85481      46023427
GSS309       97119      55907586
GSS31        79754      39406994
GSS310       94941      49578268
GSS311       96269      55917369
GSS312       42190      23639634
GSS313       114638     43642267
GSS314       117085     39368203
GSS315       103278     77900651
GSS316       81613      53566266
GSS317       95891      36542252
GSS318       95417      37268709
GSS319       96671      35161518
GSS32        74215      40369711
GSS320       94285      39167432
GSS321       37736      17626556
GSS322       103939     66277823
GSS323       94551      61190929
GSS324       95128      60357048
GSS325       94773      60868501
GSS326       33134      33073975
GSS327       83875      28283031
GSS328       84362      27389237
GSS329       85085      25924821
GSS33        70888      47279398
GSS330       14410      4314220
GSS331       16547      7508221
GSS332       83924      63444719
GSS333       83946      79298958
GSS334       83384      80088159
GSS335       15430      11778820
GSS34        79462      38800116
GSS35        75990      40126927
GSS36        76017      41408304
GSS37        87580      58196476
GSS38        87598      58171245
GSS39        85727      44630233
GSS4         79205      41150431
GSS40        83878      47691123
GSS41        89268      36598211
GSS42        65074      26431962
GSS43        81242      56942422
GSS44        80316      58337675
GSS45        72047      47458080
GSS46        72027      47447520
GSS47        77489      45795762
GSS48        77762      38350430
GSS49        82957      57798785
GSS5         78823      40567549
GSS50        86640      64209610
GSS51        81257      54983439
GSS52        93992      59115609
GSS53        88447      58681421
GSS54        77158      43152012
GSS55        72243      39626962
GSS56        86877      47811665
GSS57        87873      57859028
GSS58        76544      63450417
GSS59        70820      77978692
GSS6         78093      38850574
GSS60        84943      69284553
GSS61        90195      61034303
GSS62        63616      44552760
GSS63        65406      45117420
GSS64        89602      66956547
GSS65        85374      59122132
GSS66        85697      52555129
GSS67        85465      55722570
GSS68        4542       2840411
GSS69        93657      57711887
GSS7         77669      39170031
GSS70        97790      52626606
GSS71        97511      52996180
GSS72        98256      52009664
GSS73        99281      50651744
GSS74        99204      50753804
GSS75        99079      50919382
GSS76        99573      50265179
GSS77        97765      52660282
GSS78        91687      65095768
GSS79        89866      70739398
GSS8         75873      38135612
GSS80        88874      70081136
GSS81        87854      69638978
GSS82        87869      63563402
GSS83        87831      43964325
GSS84        78251      23336535
GSS85        78252      23499549
GSS86        83626      50250097
GSS87        77509      44793496
GSS88        88942      56350749
GSS89        84223      58529395
GSS9         72233      37178247
GSS90        75268      76042406
GSS91        78477      72396721
GSS92        84316      46609091
GSS93        84704      49289501
GSS94        20334      11085268
GSS95        77998      43833204
GSS96        74796      61775502
GSS97        82555      52899278
GSS98        80231      55974530
GSS99        85756      56938731
HTC1         25181      27238735
HTC10        72267      70147360
HTC11        61595      83247752
HTC12        66997      61008541
HTC13        68495      69600205
HTC14        14740      9433390
HTC2         16162      36527196
HTC3         16149      36808896
HTC4         16389      35873366
HTC5         16090      40456968
HTC6         16183      37872493
HTC7         55449      33942352
HTC8         28839      15506303
HTC9         68854      67588881
HTG1         1317       188816214
HTG10        1297       186286287
HTG100       769        143694601
HTG101       1021       189771862
HTG102       989        189371469
HTG103       997        189193459
HTG104       987        189371315
HTG105       1186       190676365
HTG106       91         12849693
HTG107       1136       190086488
HTG108       1058       189735851
HTG109       1417       191539505
HTG11        9          1245953
HTG110       1464       191084134
HTG111       1241       189721405
HTG112       1097       188968659
HTG113       426        66097505
HTG114       1622       188491764
HTG115       966        193079729
HTG116       744        168636155
HTG117       1089       193738342
HTG118       1103       193041119
HTG119       438        81553322
HTG12        1451       183812880
HTG120       1032       189660743
HTG121       1065       192236184
HTG122       1109       192083626
HTG123       1148       192576572
HTG124       1091       192796054
HTG125       917        157352416
HTG126       1139       192483930
HTG127       1117       192316694
HTG128       1125       191852101
HTG129       1173       191883738
HTG13        875        191808821
HTG130       1116       191372192
HTG131       1210       191669749
HTG132       1214       190936233
HTG133       482        58712426
HTG14        749        192176336
HTG15        744        192039369
HTG16        781        192055121
HTG17        803        191892637
HTG18        768        192064385
HTG19        2063       170794890
HTG2         2450       186032194
HTG20        1070       187739266
HTG21        963        189168006
HTG22        2          511099
HTG23        784        191793424
HTG24        924        190216203
HTG25        901        190471570
HTG26        811        191340972
HTG27        778        191781124
HTG28        866        191229903
HTG29        897        190482291
HTG3         2521       185182868
HTG30        938        190044981
HTG31        902        190854558
HTG32        919        188886453
HTG33        870        191230266
HTG34        964        189317279
HTG35        883        190992689
HTG36        862        191289417
HTG37        823        191624790
HTG38        945        190020593
HTG39        933        190574528
HTG4         2561       188413286
HTG40        934        190192902
HTG41        1040       189161202
HTG42        1201       186184138
HTG43        1260       188090390
HTG44        1173       187822667
HTG45        1149       187715494
HTG46        1118       191315832
HTG47        1270       190671376
HTG48        1176       191037392
HTG49        1132       191316159
HTG5         1284       185519279
HTG50        1048       191238016
HTG51        1018       189771439
HTG52        1068       181357542
HTG53        970        190185455
HTG54        1107       190147884
HTG55        1046       190305564
HTG56        1014       189756429
HTG57        968        189203108
HTG58        91         15924971
HTG59        1010       189317741
HTG6         1274       185170203
HTG60        1030       189823146
HTG61        1067       187387279
HTG62        1128       188164601
HTG63        1011       174017282
HTG64        1086       189591727
HTG65        1066       189417481
HTG66        1170       188754433
HTG67        1174       187601355
HTG68        1286       184374752
HTG69        104        13945637
HTG7         1275       185326125
HTG70        1221       185311372
HTG71        1239       184674446
HTG72        1244       184625496
HTG73        1183       187628459
HTG74        1040       173555944
HTG75        1118       188206860
HTG76        1100       190747992
HTG77        1137       190938517
HTG78        1186       190926620
HTG79        1119       190272149
HTG8         1459       184483094
HTG80        25         4422338
HTG81        1172       190227166
HTG82        1114       189969702
HTG83        1213       189950716
HTG84        1120       189773211
HTG85        1010       173171420
HTG86        1226       188478115
HTG87        1267       187565176
HTG88        1141       190053856
HTG89        1153       189701048
HTG9         1200       186953640
HTG90        1063       182647205
HTG91        1188       190029313
HTG92        1124       190229925
HTG93        1148       190228403
HTG94        1103       190549438
HTG95        1149       188799134
HTG96        1070       190938859
HTG97        1171       191162686
HTG98        1052       189248613
HTG99        1074       189543825
INV1         89513      56326022
INV10        83630      65966720
INV11        46051      35392827
INV12        85859      65197463
INV13        81484      66954861
INV14        57262      93307902
INV15        2720       35296987
INV2         1611       185019623
INV3         850        142732930
INV4         28705      119534737
INV5         79665      70640198
INV6         28469      121666449
INV7         46766      87798619
INV8         80842      71982220
INV9         60137      87517428
MAM1         12779      165366185
MAM2         44910      120657505
MAM3         33991      123424191
MAM4         78096      79564807
MAM5         12334      13175262
PAT1         222582     70118408
PAT10        124668     102612980
PAT11        98046      63881138
PAT12        141720     62597715
PAT13        105778     59939791
PAT14        103494     50220350
PAT15        121403     53120503
PAT16        112886     61312396
PAT17        39719      16496511
PAT18        146866     52619866
PAT19        153883     78031245
PAT2         194515     84658426
PAT20        105042     118278487
PAT21        133347     95768472
PAT22        84481      78257603
PAT23        123589     103415468
PAT24        119390     105822821
PAT25        145796     86554600
PAT26        175038     64242638
PAT27        71187      1779675
PAT28        102204     77408352
PAT29        93953      87654026
PAT3         171988     95892359
PAT30        119938     61664435
PAT31        96671      78978772
PAT32        128429     55051325
PAT33        92096      51065521
PAT34        111309     78153687
PAT35        138110     29117720
PAT36        158489     24095586
PAT37        114689     49005629
PAT38        88825      90728357
PAT39        107049     72510374
PAT4         153746     106059888
PAT40        100221     75424011
PAT41        160038     12232851
PAT42        119385     64955058
PAT43        8937       3702052
PAT44        135194     108002157
PAT45        167081     97033001
PAT46        116398     127555097
PAT47        196344     76721733
PAT48        80299      127990882
PAT49        27631      180872621
PAT5         57169      23943480
PAT50        185408     93066629
PAT51        274454     6861350
PAT52        202555     46302448
PAT53        132001     90719200
PAT54        82484      91355825
PAT55        57105      1516108
PAT56        342935     8573375
PAT57        188806     88519660
PAT58        111348     132068608
PAT59        3850       194703659
PAT6         170642     91909261
PAT60        131292     110979300
PAT61        154034     52782819
PAT62        227266     32431116
PAT63        250082     15843586
PAT64        171442     69418625
PAT65        140385     94573687
PAT66        166787     93017056
PAT67        22550      5844930
PAT7         154860     88277839
PAT8         131164     97078839
PAT9         129729     101121026
PHG1         4416       34127442
PLN1         59908      93378618
PLN10        36737      73762017
PLN11        14008      136969506
PLN12        7631       35262840
PLN13        17534      144460796
PLN14        17576      145981378
PLN15        17545      145998749
PLN16        23662      128562342
PLN17        4518       152885386
PLN18        1194       170143703
PLN19        497        136638024
PLN2         7346       156367197
PLN20        5          161804357
PLN21        410        169200287
PLN22        20256      50790377
PLN23        67582      69949694
PLN24        28256      30555269
PLN25        77096      76823908
PLN26        65587      81685468
PLN27        4024       132364915
PLN28        26382      134305123
PLN29        58130      99473487
PLN3         1527       183023957
PLN30        76661      77273333
PLN31        85503      44590359
PLN32        80387      72318857
PLN33        78457      75686425
PLN34        82386      70361209
PLN35        91676      70237517
PLN36        101177     58558403
PLN37        56351      93093222
PLN38        9712       21436410
PLN4         1993       190228201
PLN5         1597       184583295
PLN6         62689      91198295
PLN7         35719      33404879
PLN8         73558      76146949
PLN9         37037      49255368
PRI1         23000      59623243
PRI10        1292       179778440
PRI11        681        82148317
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191740321
PRI17        1137       193640100
PRI18        1099       194219809
PRI19        1167       193606712
PRI2         14338      155237362
PRI20        1924       191463911
PRI21        21193      112843338
PRI22        32471      85298120
PRI23        61494      78350420
PRI24        30548      68483369
PRI25        6602       166963736
PRI26        2120       180867001
PRI27        1605       181683384
PRI28        2030       181910753
PRI29        1985       180762229
PRI3         1443       175994434
PRI30        13083      154471150
PRI31        1290       183044875
PRI32        44655      103385463
PRI33        20626      25921198
PRI34        32191      63614159
PRI35        20238      117545086
PRI36        19184      145962111
PRI37        67420      87677546
PRI38        61433      84429447
PRI39        45659      84488919
PRI4         1290       186653484
PRI5         1304       182803857
PRI6         1187       180858138
PRI7         1244       180800387
PRI8         1230       177895186
PRI9         1347       174711261
ROD1         30090      144035465
ROD10        976        181251944
ROD11        49         8768500
ROD12        1036       185695241
ROD13        941        182821513
ROD14        1038       189314524
ROD15        950        180262138
ROD16        966        181908034
ROD17        994        185933619
ROD18        7018       180423992
ROD19        10128      20253791
ROD2         912        175018487
ROD20        20161      149008857
ROD21        1137       182391172
ROD22        1061       165449321
ROD23        13739      162794308
ROD24        38601      69936354
ROD25        21791      104752630
ROD26        1507       187903413
ROD27        136850     35458139
ROD28        67584      63229109
ROD3         911        173422066
ROD4         899        173809334
ROD5         929        174042877
ROD6         979        179073053
ROD7         958        179673416
ROD8         992        181727202
ROD9         996        182142407
STS1         85036      36492225
STS10        57907      44419978
STS11        49213      37736560
STS12        57924      43637361
STS13        64551      42980742
STS14        93384      34042737
STS15        103301     26255699
STS16        10919      2955077
STS17        102876     27254838
STS18        86922      34287148
STS19        98842      33245844
STS2         84905      49933495
STS20        44392      14756847
STS3         70281      26719347
STS4         73941      37193368
STS5         6267       3687203
STS6         54177      31603126
STS7         54081      31788805
STS8         54235      31906296
STS9         55657      37682948
SYN1         46969      71844981
SYN2         40630      55355078
TSA1         51696      23452423
UNA1         218        117659
VRL1         71631      66674407
VRL10        64043      73306563
VRL11        47636      47630408
VRL2         71733      64794163
VRL3         72359      63376354
VRL4         69870      68734312
VRL5         25136      31205086
VRL6         56927      73828223
VRL7         62755      72085237
VRL8         68483      67194272
VRL9         55377      74365819
VRT1         25727      150894596
VRT10        8284       177972854
VRT11        3906       124815262
VRT12        13268      170678994
VRT13        5188       183184397
VRT14        3997       186060947
VRT15        52439      111053323
VRT16        79195      70579830
VRT17        78969      64818252
VRT18        37854      43831365
VRT2         37666      137887505
VRT3         36073      131400878
VRT4         37964      108528610
VRT5         72999      66800740
VRT6         31727      63557757
VRT7         28851      119814722
VRT8         1210       190088020
VRT9         1257       189452753

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 171.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

12395520 13462545647   Homo sapiens
7341637   8441306598   Mus musculus
1989265   6278018444   Rattus norvegicus
2087588   5249672834   Bos taurus
3795331   4981402895   Zea mays
2550844   3975913813   Sus scrofa
1686301   3059654554   Danio rerio
1214069   1545449021   Oryza sativa Japonica Group
228122    1352807419   Strongylocentrotus purpuratus
1687134   1150205434   Nicotiana tabacum
1423025   1146708046   Xenopus (Silurana) tropicalis
1200543   1036108428   Drosophila melanogaster
213101     997333729   Pan troglodytes
2236613    942070398   Arabidopsis thaliana
1433358    928006348   Canis lupus familiaris
651352     906449580   Vitis vinifera
805967     879811010   Gallus gallus
77987      806618301   Macaca mulatta
1781274    780954026   Glycine max
1216104    748126646   Ciona intestinalis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          April 15 2009

                NCBI-GenBank Flat File Release 171.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 171.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
	Andrea Gocke, Anjanette Johnston, Mark Landree,	Richard McVeigh,
	Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
	Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev

User Support
	Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center