Release Notes For GenBank Release 176

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2010

               NCBI-GenBank Flat File Release 176.0

                    Distribution Release Notes

 116461672 loci, 112326229652 bases, from 116461672 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 176.0
1.2 Cutoff Date
1.3 Important Changes in Release 176.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 176.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 176.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 176.0, incorporates data available to the collaborating
databases as of February 19, 2010 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 176.0

1.3.1 Organizational changes

The total number of sequence data files decreased by 619 with this release:

  - the BCT division is now composed of  52 files (+2)
  - the CON division is now composed of 134 files (+4)
  - the EST division is now composed of 410 files (-494)
  - the GSS division is now composed of 208 files (-148)
  - the MAM division is now composed of   6 files (+1)
  - the PAT division is now composed of 100 files (+12)
  - the TSA division is now composed of   4 files (+2)
  - the VRL division is now composed of  14 files (+1)
  - the VRT division is now composed of  21 files (+1)

  This is a planned decrease, see Section 1.3.2 for more information.

The total number of 'index' files increased by 3 with this release:

  - the AUT (author) index is now composed of 73 files (+2)
  - the JOU (journal) index is now composed of 8 files (+1)

1.3.2 Increase in the size of EST and GSS sequence files

  The average size of EST and GSS sequence files, uncompressed, was
approximately 222 MB prior to GenBank Release 176.0. But as of this
February 2010 GenBank release, we have increased the average 
uncompressed file size to about 500 MB. This has reduced the total
number of EST/GSS files by roughly 50% (from 1260 in Release 175.0 to
618 in Release 176.0).

  This change should make the FTP transfer of an entire release easier
to manage, because the number of files is reduced, and their compressed 
sizes remain fairly small (with a maximum of about 80MB). Although the
uncompressed files are larger than previously, 500MB should still be
tractable for most users, especially given the overall disk space needs
for an entire release.

1.3.3 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
eighty-seven of the GSS flatfiles in Release 176.0. Consider gbgss122.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2010

                NCBI-GenBank Flat File Release 176.0

                           GSS Sequences (Part 1)

   87169 loci,    64174921 bases, from    87169 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "122" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New /pseudogene and /non_functional qualifiers

  The GenBank 173.0 release notes described an anticipated conversion
of the /pseudo qualifer to /non_functional, based on the results of
the May 2009 INSDC annual meeting:

    "Because the term "pseudo" is often assumed to mean 'pseudogene',
     the /pseudo qualifier will be renamed as /non_functional, to
     better reflect its actual usage in the sequence databases."

  During follow-up discussions, the INSDC members decided that existing
uses of /pseudo can include both of the possible meanings of the term,
and that a more conservative course would be to introduce two new
qualifiers:

    /pseudogene
    /non_functional

  Sequence submission tools will be updated to utilize these, and
the ambiguous /pseudo qualifier will be deprecated. If it is 
possible, existing instances of /pseudo would then be converted
to one of the two new qualifiers.

  /pseudogene and /non_functional will become legal for the Feature
Table as of the April 2010 GenBank Release.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1369 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut8.idx - Index of the entries according to author name, part 8.
76. gbaut9.idx - Index of the entries according to author name, part 9.
77. gbbct1.seq - Bacterial sequence entries, part 1.
78. gbbct10.seq - Bacterial sequence entries, part 10.
79. gbbct11.seq - Bacterial sequence entries, part 11.
80. gbbct12.seq - Bacterial sequence entries, part 12.
81. gbbct13.seq - Bacterial sequence entries, part 13.
82. gbbct14.seq - Bacterial sequence entries, part 14.
83. gbbct15.seq - Bacterial sequence entries, part 15.
84. gbbct16.seq - Bacterial sequence entries, part 16.
85. gbbct17.seq - Bacterial sequence entries, part 17.
86. gbbct18.seq - Bacterial sequence entries, part 18.
87. gbbct19.seq - Bacterial sequence entries, part 19.
88. gbbct2.seq - Bacterial sequence entries, part 2.
89. gbbct20.seq - Bacterial sequence entries, part 20.
90. gbbct21.seq - Bacterial sequence entries, part 21.
91. gbbct22.seq - Bacterial sequence entries, part 22.
92. gbbct23.seq - Bacterial sequence entries, part 23.
93. gbbct24.seq - Bacterial sequence entries, part 24.
94. gbbct25.seq - Bacterial sequence entries, part 25.
95. gbbct26.seq - Bacterial sequence entries, part 26.
96. gbbct27.seq - Bacterial sequence entries, part 27.
97. gbbct28.seq - Bacterial sequence entries, part 28.
98. gbbct29.seq - Bacterial sequence entries, part 29.
99. gbbct3.seq - Bacterial sequence entries, part 3.
100. gbbct30.seq - Bacterial sequence entries, part 30.
101. gbbct31.seq - Bacterial sequence entries, part 31.
102. gbbct32.seq - Bacterial sequence entries, part 32.
103. gbbct33.seq - Bacterial sequence entries, part 33.
104. gbbct34.seq - Bacterial sequence entries, part 34.
105. gbbct35.seq - Bacterial sequence entries, part 35.
106. gbbct36.seq - Bacterial sequence entries, part 36.
107. gbbct37.seq - Bacterial sequence entries, part 37.
108. gbbct38.seq - Bacterial sequence entries, part 38.
109. gbbct39.seq - Bacterial sequence entries, part 39.
110. gbbct4.seq - Bacterial sequence entries, part 4.
111. gbbct40.seq - Bacterial sequence entries, part 40.
112. gbbct41.seq - Bacterial sequence entries, part 41.
113. gbbct42.seq - Bacterial sequence entries, part 42.
114. gbbct43.seq - Bacterial sequence entries, part 43.
115. gbbct44.seq - Bacterial sequence entries, part 44.
116. gbbct45.seq - Bacterial sequence entries, part 45.
117. gbbct46.seq - Bacterial sequence entries, part 46.
118. gbbct47.seq - Bacterial sequence entries, part 47.
119. gbbct48.seq - Bacterial sequence entries, part 48.
120. gbbct49.seq - Bacterial sequence entries, part 49.
121. gbbct5.seq - Bacterial sequence entries, part 5.
122. gbbct50.seq - Bacterial sequence entries, part 50.
123. gbbct51.seq - Bacterial sequence entries, part 51.
124. gbbct52.seq - Bacterial sequence entries, part 52.
125. gbbct6.seq - Bacterial sequence entries, part 6.
126. gbbct7.seq - Bacterial sequence entries, part 7.
127. gbbct8.seq - Bacterial sequence entries, part 8.
128. gbbct9.seq - Bacterial sequence entries, part 9.
129. gbchg.txt - Accession numbers of entries updated since the previous release.
130. gbcon1.seq - Constructed sequence entries, part 1.
131. gbcon10.seq - Constructed sequence entries, part 10.
132. gbcon100.seq - Constructed sequence entries, part 100.
133. gbcon101.seq - Constructed sequence entries, part 101.
134. gbcon102.seq - Constructed sequence entries, part 102.
135. gbcon103.seq - Constructed sequence entries, part 103.
136. gbcon104.seq - Constructed sequence entries, part 104.
137. gbcon105.seq - Constructed sequence entries, part 105.
138. gbcon106.seq - Constructed sequence entries, part 106.
139. gbcon107.seq - Constructed sequence entries, part 107.
140. gbcon108.seq - Constructed sequence entries, part 108.
141. gbcon109.seq - Constructed sequence entries, part 109.
142. gbcon11.seq - Constructed sequence entries, part 11.
143. gbcon110.seq - Constructed sequence entries, part 110.
144. gbcon111.seq - Constructed sequence entries, part 111.
145. gbcon112.seq - Constructed sequence entries, part 112.
146. gbcon113.seq - Constructed sequence entries, part 113.
147. gbcon114.seq - Constructed sequence entries, part 114.
148. gbcon115.seq - Constructed sequence entries, part 115.
149. gbcon116.seq - Constructed sequence entries, part 116.
150. gbcon117.seq - Constructed sequence entries, part 117.
151. gbcon118.seq - Constructed sequence entries, part 118.
152. gbcon119.seq - Constructed sequence entries, part 119.
153. gbcon12.seq - Constructed sequence entries, part 12.
154. gbcon120.seq - Constructed sequence entries, part 120.
155. gbcon121.seq - Constructed sequence entries, part 121.
156. gbcon122.seq - Constructed sequence entries, part 122.
157. gbcon123.seq - Constructed sequence entries, part 123.
158. gbcon124.seq - Constructed sequence entries, part 124.
159. gbcon125.seq - Constructed sequence entries, part 125.
160. gbcon126.seq - Constructed sequence entries, part 126.
161. gbcon127.seq - Constructed sequence entries, part 127.
162. gbcon128.seq - Constructed sequence entries, part 128.
163. gbcon129.seq - Constructed sequence entries, part 129.
164. gbcon13.seq - Constructed sequence entries, part 13.
165. gbcon130.seq - Constructed sequence entries, part 130.
166. gbcon131.seq - Constructed sequence entries, part 131.
167. gbcon132.seq - Constructed sequence entries, part 132.
168. gbcon133.seq - Constructed sequence entries, part 133.
169. gbcon134.seq - Constructed sequence entries, part 134.
170. gbcon14.seq - Constructed sequence entries, part 14.
171. gbcon15.seq - Constructed sequence entries, part 15.
172. gbcon16.seq - Constructed sequence entries, part 16.
173. gbcon17.seq - Constructed sequence entries, part 17.
174. gbcon18.seq - Constructed sequence entries, part 18.
175. gbcon19.seq - Constructed sequence entries, part 19.
176. gbcon2.seq - Constructed sequence entries, part 2.
177. gbcon20.seq - Constructed sequence entries, part 20.
178. gbcon21.seq - Constructed sequence entries, part 21.
179. gbcon22.seq - Constructed sequence entries, part 22.
180. gbcon23.seq - Constructed sequence entries, part 23.
181. gbcon24.seq - Constructed sequence entries, part 24.
182. gbcon25.seq - Constructed sequence entries, part 25.
183. gbcon26.seq - Constructed sequence entries, part 26.
184. gbcon27.seq - Constructed sequence entries, part 27.
185. gbcon28.seq - Constructed sequence entries, part 28.
186. gbcon29.seq - Constructed sequence entries, part 29.
187. gbcon3.seq - Constructed sequence entries, part 3.
188. gbcon30.seq - Constructed sequence entries, part 30.
189. gbcon31.seq - Constructed sequence entries, part 31.
190. gbcon32.seq - Constructed sequence entries, part 32.
191. gbcon33.seq - Constructed sequence entries, part 33.
192. gbcon34.seq - Constructed sequence entries, part 34.
193. gbcon35.seq - Constructed sequence entries, part 35.
194. gbcon36.seq - Constructed sequence entries, part 36.
195. gbcon37.seq - Constructed sequence entries, part 37.
196. gbcon38.seq - Constructed sequence entries, part 38.
197. gbcon39.seq - Constructed sequence entries, part 39.
198. gbcon4.seq - Constructed sequence entries, part 4.
199. gbcon40.seq - Constructed sequence entries, part 40.
200. gbcon41.seq - Constructed sequence entries, part 41.
201. gbcon42.seq - Constructed sequence entries, part 42.
202. gbcon43.seq - Constructed sequence entries, part 43.
203. gbcon44.seq - Constructed sequence entries, part 44.
204. gbcon45.seq - Constructed sequence entries, part 45.
205. gbcon46.seq - Constructed sequence entries, part 46.
206. gbcon47.seq - Constructed sequence entries, part 47.
207. gbcon48.seq - Constructed sequence entries, part 48.
208. gbcon49.seq - Constructed sequence entries, part 49.
209. gbcon5.seq - Constructed sequence entries, part 5.
210. gbcon50.seq - Constructed sequence entries, part 50.
211. gbcon51.seq - Constructed sequence entries, part 51.
212. gbcon52.seq - Constructed sequence entries, part 52.
213. gbcon53.seq - Constructed sequence entries, part 53.
214. gbcon54.seq - Constructed sequence entries, part 54.
215. gbcon55.seq - Constructed sequence entries, part 55.
216. gbcon56.seq - Constructed sequence entries, part 56.
217. gbcon57.seq - Constructed sequence entries, part 57.
218. gbcon58.seq - Constructed sequence entries, part 58.
219. gbcon59.seq - Constructed sequence entries, part 59.
220. gbcon6.seq - Constructed sequence entries, part 6.
221. gbcon60.seq - Constructed sequence entries, part 60.
222. gbcon61.seq - Constructed sequence entries, part 61.
223. gbcon62.seq - Constructed sequence entries, part 62.
224. gbcon63.seq - Constructed sequence entries, part 63.
225. gbcon64.seq - Constructed sequence entries, part 64.
226. gbcon65.seq - Constructed sequence entries, part 65.
227. gbcon66.seq - Constructed sequence entries, part 66.
228. gbcon67.seq - Constructed sequence entries, part 67.
229. gbcon68.seq - Constructed sequence entries, part 68.
230. gbcon69.seq - Constructed sequence entries, part 69.
231. gbcon7.seq - Constructed sequence entries, part 7.
232. gbcon70.seq - Constructed sequence entries, part 70.
233. gbcon71.seq - Constructed sequence entries, part 71.
234. gbcon72.seq - Constructed sequence entries, part 72.
235. gbcon73.seq - Constructed sequence entries, part 73.
236. gbcon74.seq - Constructed sequence entries, part 74.
237. gbcon75.seq - Constructed sequence entries, part 75.
238. gbcon76.seq - Constructed sequence entries, part 76.
239. gbcon77.seq - Constructed sequence entries, part 77.
240. gbcon78.seq - Constructed sequence entries, part 78.
241. gbcon79.seq - Constructed sequence entries, part 79.
242. gbcon8.seq - Constructed sequence entries, part 8.
243. gbcon80.seq - Constructed sequence entries, part 80.
244. gbcon81.seq - Constructed sequence entries, part 81.
245. gbcon82.seq - Constructed sequence entries, part 82.
246. gbcon83.seq - Constructed sequence entries, part 83.
247. gbcon84.seq - Constructed sequence entries, part 84.
248. gbcon85.seq - Constructed sequence entries, part 85.
249. gbcon86.seq - Constructed sequence entries, part 86.
250. gbcon87.seq - Constructed sequence entries, part 87.
251. gbcon88.seq - Constructed sequence entries, part 88.
252. gbcon89.seq - Constructed sequence entries, part 89.
253. gbcon9.seq - Constructed sequence entries, part 9.
254. gbcon90.seq - Constructed sequence entries, part 90.
255. gbcon91.seq - Constructed sequence entries, part 91.
256. gbcon92.seq - Constructed sequence entries, part 92.
257. gbcon93.seq - Constructed sequence entries, part 93.
258. gbcon94.seq - Constructed sequence entries, part 94.
259. gbcon95.seq - Constructed sequence entries, part 95.
260. gbcon96.seq - Constructed sequence entries, part 96.
261. gbcon97.seq - Constructed sequence entries, part 97.
262. gbcon98.seq - Constructed sequence entries, part 98.
263. gbcon99.seq - Constructed sequence entries, part 99.
264. gbdel.txt - Accession numbers of entries deleted since the previous release.
265. gbenv1.seq - Environmental sampling sequence entries, part 1.
266. gbenv10.seq - Environmental sampling sequence entries, part 10.
267. gbenv11.seq - Environmental sampling sequence entries, part 11.
268. gbenv12.seq - Environmental sampling sequence entries, part 12.
269. gbenv13.seq - Environmental sampling sequence entries, part 13.
270. gbenv14.seq - Environmental sampling sequence entries, part 14.
271. gbenv15.seq - Environmental sampling sequence entries, part 15.
272. gbenv16.seq - Environmental sampling sequence entries, part 16.
273. gbenv17.seq - Environmental sampling sequence entries, part 17.
274. gbenv18.seq - Environmental sampling sequence entries, part 18.
275. gbenv19.seq - Environmental sampling sequence entries, part 19.
276. gbenv2.seq - Environmental sampling sequence entries, part 2.
277. gbenv20.seq - Environmental sampling sequence entries, part 20.
278. gbenv21.seq - Environmental sampling sequence entries, part 21.
279. gbenv22.seq - Environmental sampling sequence entries, part 22.
280. gbenv23.seq - Environmental sampling sequence entries, part 23.
281. gbenv3.seq - Environmental sampling sequence entries, part 3.
282. gbenv4.seq - Environmental sampling sequence entries, part 4.
283. gbenv5.seq - Environmental sampling sequence entries, part 5.
284. gbenv6.seq - Environmental sampling sequence entries, part 6.
285. gbenv7.seq - Environmental sampling sequence entries, part 7.
286. gbenv8.seq - Environmental sampling sequence entries, part 8.
287. gbenv9.seq - Environmental sampling sequence entries, part 9.
288. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
289. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
290. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
291. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
292. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
293. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
294. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
295. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
296. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
297. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
298. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
299. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
300. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
301. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
302. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
303. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
304. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
305. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
306. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
307. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
308. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
309. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
310. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
311. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
312. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
313. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
314. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
315. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
316. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
317. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
318. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
319. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
320. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
321. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
322. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
323. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
324. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
325. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
326. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
327. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
328. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
329. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
330. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
331. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
332. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
333. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
334. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
335. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
336. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
337. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
338. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
339. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
340. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
341. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
342. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
343. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
344. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
345. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
346. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
347. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
348. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
349. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
350. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
351. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
352. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
353. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
354. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
355. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
356. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
357. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
358. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
359. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
360. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
361. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
362. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
363. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
364. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
365. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
366. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
367. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
368. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
369. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
370. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
371. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
372. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
373. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
374. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
375. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
376. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
377. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
378. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
379. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
380. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
381. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
382. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
383. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
384. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
385. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
386. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
387. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
388. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
389. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
390. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
391. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
392. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
393. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
394. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
395. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
396. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
397. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
398. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
399. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
400. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
401. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
402. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
403. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
404. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
405. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
406. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
407. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
408. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
409. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
410. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
411. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
412. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
413. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
414. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
415. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
416. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
417. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
418. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
419. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
420. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
421. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
422. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
423. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
424. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
425. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
426. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
427. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
428. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
429. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
430. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
431. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
432. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
433. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
434. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
435. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
436. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
437. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
438. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
439. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
440. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
441. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
442. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
443. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
444. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
445. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
446. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
447. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
448. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
449. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
450. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
451. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
452. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
453. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
454. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
455. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
456. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
457. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
458. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
459. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
460. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
461. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
462. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
463. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
464. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
465. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
466. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
467. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
468. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
469. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
470. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
471. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
472. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
473. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
474. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
475. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
476. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
477. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
478. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
479. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
480. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
481. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
482. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
483. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
484. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
485. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
486. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
487. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
488. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
489. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
490. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
491. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
492. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
493. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
494. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
495. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
496. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
497. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
498. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
499. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
500. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
501. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
502. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
503. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
504. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
505. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
506. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
507. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
508. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
509. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
510. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
511. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
512. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
513. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
514. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
515. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
516. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
517. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
518. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
519. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
520. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
521. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
522. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
523. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
524. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
525. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
526. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
527. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
528. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
529. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
530. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
531. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
532. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
533. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
534. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
535. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
536. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
537. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
538. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
539. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
540. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
541. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
542. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
543. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
544. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
545. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
546. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
547. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
548. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
549. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
550. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
551. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
552. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
553. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
554. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
555. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
556. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
557. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
558. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
559. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
560. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
561. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
562. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
563. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
564. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
565. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
566. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
567. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
568. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
569. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
570. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
571. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
572. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
573. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
574. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
575. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
576. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
577. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
578. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
579. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
580. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
581. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
582. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
583. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
584. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
585. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
586. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
587. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
588. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
589. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
590. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
591. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
592. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
593. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
594. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
595. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
596. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
597. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
598. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
599. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
600. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
601. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
602. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
603. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
604. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
605. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
606. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
607. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
608. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
609. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
610. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
611. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
612. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
613. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
614. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
615. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
616. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
617. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
618. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
619. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
620. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
621. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
622. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
623. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
624. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
625. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
626. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
627. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
628. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
629. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
630. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
631. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
632. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
633. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
634. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
635. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
636. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
637. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
638. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
639. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
640. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
641. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
642. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
643. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
644. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
645. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
646. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
647. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
648. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
649. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
650. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
651. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
652. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
653. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
654. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
655. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
656. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
657. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
658. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
659. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
660. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
661. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
662. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
663. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
664. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
665. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
666. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
667. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
668. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
669. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
670. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
671. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
672. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
673. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
674. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
675. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
676. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
677. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
678. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
679. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
680. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
681. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
682. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
683. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
684. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
685. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
686. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
687. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
688. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
689. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
690. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
691. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
692. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
693. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
694. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
695. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
696. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
697. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
698. gbgen.idx - Index of the entries according to gene symbols.
699. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
700. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
701. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
702. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
703. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
704. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
705. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
706. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
707. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
708. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
709. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
710. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
711. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
712. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
713. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
714. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
715. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
716. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
717. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
718. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
719. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
720. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
721. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
722. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
723. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
724. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
725. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
726. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
727. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
728. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
729. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
730. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
731. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
732. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
733. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
734. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
735. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
736. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
737. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
738. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
739. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
740. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
741. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
742. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
743. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
744. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
745. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
746. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
747. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
748. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
749. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
750. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
751. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
752. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
753. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
754. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
755. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
756. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
757. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
758. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
759. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
760. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
761. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
762. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
763. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
764. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
765. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
766. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
767. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
768. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
769. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
770. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
771. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
772. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
773. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
774. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
775. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
776. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
777. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
778. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
779. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
780. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
781. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
782. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
783. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
784. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
785. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
786. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
787. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
788. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
789. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
790. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
791. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
792. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
793. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
794. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
795. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
796. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
797. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
798. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
799. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
800. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
801. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
802. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
803. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
804. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
805. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
806. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
807. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
808. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
809. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
810. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
811. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
812. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
813. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
814. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
815. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
816. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
817. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
818. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
819. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
820. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
821. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
822. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
823. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
824. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
825. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
826. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
827. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
828. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
829. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
830. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
831. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
832. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
833. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
834. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
835. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
836. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
837. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
838. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
839. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
840. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
841. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
842. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
843. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
844. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
845. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
846. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
847. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
848. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
849. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
850. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
851. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
852. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
853. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
854. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
855. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
856. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
857. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
858. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
859. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
860. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
861. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
862. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
863. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
864. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
865. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
866. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
867. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
868. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
869. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
870. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
871. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
872. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
873. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
874. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
875. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
876. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
877. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
878. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
879. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
880. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
881. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
882. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
883. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
884. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
885. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
886. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
887. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
888. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
889. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
890. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
891. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
892. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
893. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
894. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
895. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
896. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
897. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
898. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
899. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
900. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
901. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
902. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
903. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
904. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
905. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
906. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
907. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
908. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
909. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
910. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
911. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
912. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
913. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
914. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
915. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
916. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
917. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
918. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
919. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
920. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
921. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
922. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
923. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
924. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
925. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
926. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
927. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
928. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
929. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
930. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
931. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
932. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
933. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
934. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
935. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
936. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
937. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
938. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
939. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
940. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
941. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
942. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
943. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
944. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
945. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
946. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
947. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
948. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
949. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
950. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
951. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
952. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
953. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
954. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
955. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
956. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
957. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
958. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
959. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
960. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
961. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
962. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
963. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
964. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
965. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
966. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
967. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
968. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
969. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
970. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
971. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
972. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
973. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
974. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
975. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
976. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
977. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
978. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
979. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
980. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
981. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
982. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
983. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
984. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
985. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
986. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
987. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
988. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
989. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
990. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
991. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
992. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
993. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
994. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
995. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
996. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
997. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
998. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
999. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1000. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1001. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1002. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1003. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1004. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1005. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1006. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1007. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1008. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1009. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1010. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1011. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1012. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1013. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1014. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1015. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1016. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1017. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1018. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1019. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1020. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1021. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1022. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1023. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1024. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1025. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1026. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1027. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1028. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1029. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1030. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1031. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1032. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1033. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1034. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1035. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1036. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1037. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1038. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1039. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1040. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1041. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1042. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1043. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1044. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1045. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1046. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1047. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1048. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1049. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1050. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1051. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1052. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1053. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1054. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1055. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1056. gbinv1.seq - Invertebrate sequence entries, part 1.
1057. gbinv10.seq - Invertebrate sequence entries, part 10.
1058. gbinv11.seq - Invertebrate sequence entries, part 11.
1059. gbinv12.seq - Invertebrate sequence entries, part 12.
1060. gbinv13.seq - Invertebrate sequence entries, part 13.
1061. gbinv14.seq - Invertebrate sequence entries, part 14.
1062. gbinv15.seq - Invertebrate sequence entries, part 15.
1063. gbinv16.seq - Invertebrate sequence entries, part 16.
1064. gbinv17.seq - Invertebrate sequence entries, part 17.
1065. gbinv18.seq - Invertebrate sequence entries, part 18.
1066. gbinv19.seq - Invertebrate sequence entries, part 19.
1067. gbinv2.seq - Invertebrate sequence entries, part 2.
1068. gbinv3.seq - Invertebrate sequence entries, part 3.
1069. gbinv4.seq - Invertebrate sequence entries, part 4.
1070. gbinv5.seq - Invertebrate sequence entries, part 5.
1071. gbinv6.seq - Invertebrate sequence entries, part 6.
1072. gbinv7.seq - Invertebrate sequence entries, part 7.
1073. gbinv8.seq - Invertebrate sequence entries, part 8.
1074. gbinv9.seq - Invertebrate sequence entries, part 9.
1075. gbjou1.idx - Index of the entries according to journal citation, part 1.
1076. gbjou2.idx - Index of the entries according to journal citation, part 2.
1077. gbjou3.idx - Index of the entries according to journal citation, part 3.
1078. gbjou4.idx - Index of the entries according to journal citation, part 4.
1079. gbjou5.idx - Index of the entries according to journal citation, part 5.
1080. gbjou6.idx - Index of the entries according to journal citation, part 6.
1081. gbjou7.idx - Index of the entries according to journal citation, part 7.
1082. gbjou8.idx - Index of the entries according to journal citation, part 8.
1083. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1084. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1085. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1086. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1087. gbmam1.seq - Other mammalian sequence entries, part 1.
1088. gbmam2.seq - Other mammalian sequence entries, part 2.
1089. gbmam3.seq - Other mammalian sequence entries, part 3.
1090. gbmam4.seq - Other mammalian sequence entries, part 4.
1091. gbmam5.seq - Other mammalian sequence entries, part 5.
1092. gbmam6.seq - Other mammalian sequence entries, part 6.
1093. gbnew.txt - Accession numbers of entries new since the previous release.
1094. gbpat1.seq - Patent sequence entries, part 1.
1095. gbpat10.seq - Patent sequence entries, part 10.
1096. gbpat100.seq - Patent sequence entries, part 100.
1097. gbpat11.seq - Patent sequence entries, part 11.
1098. gbpat12.seq - Patent sequence entries, part 12.
1099. gbpat13.seq - Patent sequence entries, part 13.
1100. gbpat14.seq - Patent sequence entries, part 14.
1101. gbpat15.seq - Patent sequence entries, part 15.
1102. gbpat16.seq - Patent sequence entries, part 16.
1103. gbpat17.seq - Patent sequence entries, part 17.
1104. gbpat18.seq - Patent sequence entries, part 18.
1105. gbpat19.seq - Patent sequence entries, part 19.
1106. gbpat2.seq - Patent sequence entries, part 2.
1107. gbpat20.seq - Patent sequence entries, part 20.
1108. gbpat21.seq - Patent sequence entries, part 21.
1109. gbpat22.seq - Patent sequence entries, part 22.
1110. gbpat23.seq - Patent sequence entries, part 23.
1111. gbpat24.seq - Patent sequence entries, part 24.
1112. gbpat25.seq - Patent sequence entries, part 25.
1113. gbpat26.seq - Patent sequence entries, part 26.
1114. gbpat27.seq - Patent sequence entries, part 27.
1115. gbpat28.seq - Patent sequence entries, part 28.
1116. gbpat29.seq - Patent sequence entries, part 29.
1117. gbpat3.seq - Patent sequence entries, part 3.
1118. gbpat30.seq - Patent sequence entries, part 30.
1119. gbpat31.seq - Patent sequence entries, part 31.
1120. gbpat32.seq - Patent sequence entries, part 32.
1121. gbpat33.seq - Patent sequence entries, part 33.
1122. gbpat34.seq - Patent sequence entries, part 34.
1123. gbpat35.seq - Patent sequence entries, part 35.
1124. gbpat36.seq - Patent sequence entries, part 36.
1125. gbpat37.seq - Patent sequence entries, part 37.
1126. gbpat38.seq - Patent sequence entries, part 38.
1127. gbpat39.seq - Patent sequence entries, part 39.
1128. gbpat4.seq - Patent sequence entries, part 4.
1129. gbpat40.seq - Patent sequence entries, part 40.
1130. gbpat41.seq - Patent sequence entries, part 41.
1131. gbpat42.seq - Patent sequence entries, part 42.
1132. gbpat43.seq - Patent sequence entries, part 43.
1133. gbpat44.seq - Patent sequence entries, part 44.
1134. gbpat45.seq - Patent sequence entries, part 45.
1135. gbpat46.seq - Patent sequence entries, part 46.
1136. gbpat47.seq - Patent sequence entries, part 47.
1137. gbpat48.seq - Patent sequence entries, part 48.
1138. gbpat49.seq - Patent sequence entries, part 49.
1139. gbpat5.seq - Patent sequence entries, part 5.
1140. gbpat50.seq - Patent sequence entries, part 50.
1141. gbpat51.seq - Patent sequence entries, part 51.
1142. gbpat52.seq - Patent sequence entries, part 52.
1143. gbpat53.seq - Patent sequence entries, part 53.
1144. gbpat54.seq - Patent sequence entries, part 54.
1145. gbpat55.seq - Patent sequence entries, part 55.
1146. gbpat56.seq - Patent sequence entries, part 56.
1147. gbpat57.seq - Patent sequence entries, part 57.
1148. gbpat58.seq - Patent sequence entries, part 58.
1149. gbpat59.seq - Patent sequence entries, part 59.
1150. gbpat6.seq - Patent sequence entries, part 6.
1151. gbpat60.seq - Patent sequence entries, part 60.
1152. gbpat61.seq - Patent sequence entries, part 61.
1153. gbpat62.seq - Patent sequence entries, part 62.
1154. gbpat63.seq - Patent sequence entries, part 63.
1155. gbpat64.seq - Patent sequence entries, part 64.
1156. gbpat65.seq - Patent sequence entries, part 65.
1157. gbpat66.seq - Patent sequence entries, part 66.
1158. gbpat67.seq - Patent sequence entries, part 67.
1159. gbpat68.seq - Patent sequence entries, part 68.
1160. gbpat69.seq - Patent sequence entries, part 69.
1161. gbpat7.seq - Patent sequence entries, part 7.
1162. gbpat70.seq - Patent sequence entries, part 70.
1163. gbpat71.seq - Patent sequence entries, part 71.
1164. gbpat72.seq - Patent sequence entries, part 72.
1165. gbpat73.seq - Patent sequence entries, part 73.
1166. gbpat74.seq - Patent sequence entries, part 74.
1167. gbpat75.seq - Patent sequence entries, part 75.
1168. gbpat76.seq - Patent sequence entries, part 76.
1169. gbpat77.seq - Patent sequence entries, part 77.
1170. gbpat78.seq - Patent sequence entries, part 78.
1171. gbpat79.seq - Patent sequence entries, part 79.
1172. gbpat8.seq - Patent sequence entries, part 8.
1173. gbpat80.seq - Patent sequence entries, part 80.
1174. gbpat81.seq - Patent sequence entries, part 81.
1175. gbpat82.seq - Patent sequence entries, part 82.
1176. gbpat83.seq - Patent sequence entries, part 83.
1177. gbpat84.seq - Patent sequence entries, part 84.
1178. gbpat85.seq - Patent sequence entries, part 85.
1179. gbpat86.seq - Patent sequence entries, part 86.
1180. gbpat87.seq - Patent sequence entries, part 87.
1181. gbpat88.seq - Patent sequence entries, part 88.
1182. gbpat89.seq - Patent sequence entries, part 89.
1183. gbpat9.seq - Patent sequence entries, part 9.
1184. gbpat90.seq - Patent sequence entries, part 90.
1185. gbpat91.seq - Patent sequence entries, part 91.
1186. gbpat92.seq - Patent sequence entries, part 92.
1187. gbpat93.seq - Patent sequence entries, part 93.
1188. gbpat94.seq - Patent sequence entries, part 94.
1189. gbpat95.seq - Patent sequence entries, part 95.
1190. gbpat96.seq - Patent sequence entries, part 96.
1191. gbpat97.seq - Patent sequence entries, part 97.
1192. gbpat98.seq - Patent sequence entries, part 98.
1193. gbpat99.seq - Patent sequence entries, part 99.
1194. gbphg1.seq - Phage sequence entries, part 1.
1195. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1196. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1197. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1198. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1199. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1200. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1201. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1202. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1203. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1204. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1205. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1206. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1207. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1208. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1209. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1210. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1211. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1212. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1213. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1214. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1215. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1216. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1217. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1218. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1219. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1220. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1221. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1222. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1223. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1224. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1225. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1226. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1227. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1228. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1229. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1230. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1231. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1232. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1233. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1234. gbpri1.seq - Primate sequence entries, part 1.
1235. gbpri10.seq - Primate sequence entries, part 10.
1236. gbpri11.seq - Primate sequence entries, part 11.
1237. gbpri12.seq - Primate sequence entries, part 12.
1238. gbpri13.seq - Primate sequence entries, part 13.
1239. gbpri14.seq - Primate sequence entries, part 14.
1240. gbpri15.seq - Primate sequence entries, part 15.
1241. gbpri16.seq - Primate sequence entries, part 16.
1242. gbpri17.seq - Primate sequence entries, part 17.
1243. gbpri18.seq - Primate sequence entries, part 18.
1244. gbpri19.seq - Primate sequence entries, part 19.
1245. gbpri2.seq - Primate sequence entries, part 2.
1246. gbpri20.seq - Primate sequence entries, part 20.
1247. gbpri21.seq - Primate sequence entries, part 21.
1248. gbpri22.seq - Primate sequence entries, part 22.
1249. gbpri23.seq - Primate sequence entries, part 23.
1250. gbpri24.seq - Primate sequence entries, part 24.
1251. gbpri25.seq - Primate sequence entries, part 25.
1252. gbpri26.seq - Primate sequence entries, part 26.
1253. gbpri27.seq - Primate sequence entries, part 27.
1254. gbpri28.seq - Primate sequence entries, part 28.
1255. gbpri29.seq - Primate sequence entries, part 29.
1256. gbpri3.seq - Primate sequence entries, part 3.
1257. gbpri30.seq - Primate sequence entries, part 30.
1258. gbpri31.seq - Primate sequence entries, part 31.
1259. gbpri32.seq - Primate sequence entries, part 32.
1260. gbpri33.seq - Primate sequence entries, part 33.
1261. gbpri34.seq - Primate sequence entries, part 34.
1262. gbpri35.seq - Primate sequence entries, part 35.
1263. gbpri36.seq - Primate sequence entries, part 36.
1264. gbpri37.seq - Primate sequence entries, part 37.
1265. gbpri38.seq - Primate sequence entries, part 38.
1266. gbpri39.seq - Primate sequence entries, part 39.
1267. gbpri4.seq - Primate sequence entries, part 4.
1268. gbpri40.seq - Primate sequence entries, part 40.
1269. gbpri41.seq - Primate sequence entries, part 41.
1270. gbpri5.seq - Primate sequence entries, part 5.
1271. gbpri6.seq - Primate sequence entries, part 6.
1272. gbpri7.seq - Primate sequence entries, part 7.
1273. gbpri8.seq - Primate sequence entries, part 8.
1274. gbpri9.seq - Primate sequence entries, part 9.
1275. gbrel.txt - Release notes (this document).
1276. gbrod1.seq - Rodent sequence entries, part 1.
1277. gbrod10.seq - Rodent sequence entries, part 10.
1278. gbrod11.seq - Rodent sequence entries, part 11.
1279. gbrod12.seq - Rodent sequence entries, part 12.
1280. gbrod13.seq - Rodent sequence entries, part 13.
1281. gbrod14.seq - Rodent sequence entries, part 14.
1282. gbrod15.seq - Rodent sequence entries, part 15.
1283. gbrod16.seq - Rodent sequence entries, part 16.
1284. gbrod17.seq - Rodent sequence entries, part 17.
1285. gbrod18.seq - Rodent sequence entries, part 18.
1286. gbrod19.seq - Rodent sequence entries, part 19.
1287. gbrod2.seq - Rodent sequence entries, part 2.
1288. gbrod20.seq - Rodent sequence entries, part 20.
1289. gbrod21.seq - Rodent sequence entries, part 21.
1290. gbrod22.seq - Rodent sequence entries, part 22.
1291. gbrod23.seq - Rodent sequence entries, part 23.
1292. gbrod24.seq - Rodent sequence entries, part 24.
1293. gbrod25.seq - Rodent sequence entries, part 25.
1294. gbrod26.seq - Rodent sequence entries, part 26.
1295. gbrod27.seq - Rodent sequence entries, part 27.
1296. gbrod28.seq - Rodent sequence entries, part 28.
1297. gbrod3.seq - Rodent sequence entries, part 3.
1298. gbrod4.seq - Rodent sequence entries, part 4.
1299. gbrod5.seq - Rodent sequence entries, part 5.
1300. gbrod6.seq - Rodent sequence entries, part 6.
1301. gbrod7.seq - Rodent sequence entries, part 7.
1302. gbrod8.seq - Rodent sequence entries, part 8.
1303. gbrod9.seq - Rodent sequence entries, part 9.
1304. gbsdr1.txt - Short directory of the data bank, part 1.
1305. gbsdr2.txt - Short directory of the data bank, part 2.
1306. gbsdr3.txt - Short directory of the data bank, part 3.
1307. gbsec.idx - Index of the entries according to secondary accession number.
1308. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1309. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1310. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1311. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1312. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1313. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1314. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1315. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1316. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1317. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1318. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1319. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1320. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1321. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1322. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1323. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1324. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1325. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1326. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1327. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1328. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1329. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1330. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1331. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1332. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1333. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1334. gbuna1.seq - Unannotated sequence entries, part 1.
1335. gbvrl1.seq - Viral sequence entries, part 1.
1336. gbvrl10.seq - Viral sequence entries, part 10.
1337. gbvrl11.seq - Viral sequence entries, part 11.
1338. gbvrl12.seq - Viral sequence entries, part 12.
1339. gbvrl13.seq - Viral sequence entries, part 13.
1340. gbvrl14.seq - Viral sequence entries, part 14.
1341. gbvrl2.seq - Viral sequence entries, part 2.
1342. gbvrl3.seq - Viral sequence entries, part 3.
1343. gbvrl4.seq - Viral sequence entries, part 4.
1344. gbvrl5.seq - Viral sequence entries, part 5.
1345. gbvrl6.seq - Viral sequence entries, part 6.
1346. gbvrl7.seq - Viral sequence entries, part 7.
1347. gbvrl8.seq - Viral sequence entries, part 8.
1348. gbvrl9.seq - Viral sequence entries, part 9.
1349. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1350. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1351. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1352. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1353. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1354. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1355. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1356. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1357. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1358. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1359. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1360. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1361. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1362. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1363. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1364. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1365. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1366. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1367. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1368. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1369. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 176.0 flatfiles require roughly 432 GB (sequence
files only) or 463 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1212039501     gbacc1.idx
2138374557     gbacc2.idx
 685074693     gbacc3.idx
 184716878     gbaut1.idx
 232152382     gbaut10.idx
 184783669     gbaut11.idx
 195926181     gbaut12.idx
 185037674     gbaut13.idx
 220384757     gbaut14.idx
 185445895     gbaut15.idx
 183999140     gbaut16.idx
 183790356     gbaut17.idx
 244753878     gbaut18.idx
 221356255     gbaut19.idx
 184246562     gbaut2.idx
 203683190     gbaut20.idx
 185313391     gbaut21.idx
 243438512     gbaut22.idx
 187481139     gbaut23.idx
 188269976     gbaut24.idx
 184180698     gbaut25.idx
 203347691     gbaut26.idx
 216262083     gbaut27.idx
 235808990     gbaut28.idx
 252912056     gbaut29.idx
 223092467     gbaut3.idx
 184609059     gbaut30.idx
 200686487     gbaut31.idx
 185070837     gbaut32.idx
 184288179     gbaut33.idx
 183946843     gbaut34.idx
 185299658     gbaut35.idx
 185591688     gbaut36.idx
 183827495     gbaut37.idx
 184056992     gbaut38.idx
 184117801     gbaut39.idx
 183801081     gbaut4.idx
 183724050     gbaut40.idx
 184449566     gbaut41.idx
 183704852     gbaut42.idx
 185644201     gbaut43.idx
 192969220     gbaut44.idx
 184993796     gbaut45.idx
 183592550     gbaut46.idx
 184430699     gbaut47.idx
 183911635     gbaut48.idx
 251460347     gbaut49.idx
 185496315     gbaut5.idx
 185431640     gbaut50.idx
 208513988     gbaut51.idx
 184227231     gbaut52.idx
 234051911     gbaut53.idx
 186831918     gbaut54.idx
 184847600     gbaut55.idx
 205511960     gbaut56.idx
 212313757     gbaut57.idx
 184327372     gbaut58.idx
 239228335     gbaut59.idx
 229903512     gbaut6.idx
 183850235     gbaut60.idx
 184406146     gbaut61.idx
 187922522     gbaut62.idx
 184155968     gbaut63.idx
 233224111     gbaut64.idx
 186243377     gbaut65.idx
 189067291     gbaut66.idx
 209886656     gbaut67.idx
 184232677     gbaut68.idx
 183967857     gbaut69.idx
 184187802     gbaut7.idx
 200843954     gbaut70.idx
 184050583     gbaut71.idx
 241365600     gbaut72.idx
  17967981     gbaut73.idx
 183933418     gbaut8.idx
 184700790     gbaut9.idx
 245670591     gbbct1.seq
 248123670     gbbct10.seq
 244750080     gbbct11.seq
 241977514     gbbct12.seq
 249771899     gbbct13.seq
 247999286     gbbct14.seq
 242198659     gbbct15.seq
 248740904     gbbct16.seq
 243881228     gbbct17.seq
 245715534     gbbct18.seq
 248488835     gbbct19.seq
 247484815     gbbct2.seq
 191119418     gbbct20.seq
 242657530     gbbct21.seq
 241399542     gbbct22.seq
 248563779     gbbct23.seq
 247789210     gbbct24.seq
 249346306     gbbct25.seq
 248639430     gbbct26.seq
 249065207     gbbct27.seq
 247524096     gbbct28.seq
 241329307     gbbct29.seq
 245603222     gbbct3.seq
 243888345     gbbct30.seq
 242633740     gbbct31.seq
 248968843     gbbct32.seq
 134089691     gbbct33.seq
 243063254     gbbct34.seq
 243966990     gbbct35.seq
 249684613     gbbct36.seq
 234899120     gbbct37.seq
 248443721     gbbct38.seq
 240816898     gbbct39.seq
 249997356     gbbct4.seq
 238041797     gbbct40.seq
   6879337     gbbct41.seq
  14080134     gbbct42.seq
  23146310     gbbct43.seq
  45015987     gbbct44.seq
  87581120     gbbct45.seq
 169879280     gbbct46.seq
 250000161     gbbct47.seq
 249710895     gbbct48.seq
 248546111     gbbct49.seq
 139185712     gbbct5.seq
 249999879     gbbct50.seq
 249996273     gbbct51.seq
  29021606     gbbct52.seq
 249970296     gbbct6.seq
 249683044     gbbct7.seq
 249947167     gbbct8.seq
 244413809     gbbct9.seq
  13797186     gbchg.txt
 249999108     gbcon1.seq
 249996809     gbcon10.seq
 249999100     gbcon100.seq
 249999520     gbcon101.seq
 249998411     gbcon102.seq
 249997075     gbcon103.seq
 155891156     gbcon104.seq
 249996638     gbcon105.seq
 249996958     gbcon106.seq
 249972536     gbcon107.seq
 249997665     gbcon108.seq
 171931188     gbcon109.seq
 249999912     gbcon11.seq
 249998061     gbcon110.seq
 249998923     gbcon111.seq
 232920966     gbcon112.seq
 249999612     gbcon113.seq
 249998231     gbcon114.seq
 249995786     gbcon115.seq
 249803909     gbcon116.seq
 159570146     gbcon117.seq
 249999431     gbcon118.seq
 161452708     gbcon119.seq
 249463543     gbcon12.seq
 249997137     gbcon120.seq
 249999295     gbcon121.seq
 249998694     gbcon122.seq
 213552174     gbcon123.seq
 249827639     gbcon124.seq
 249754165     gbcon125.seq
 249838418     gbcon126.seq
 249997980     gbcon127.seq
 249998793     gbcon128.seq
 249997952     gbcon129.seq
 244428576     gbcon13.seq
 249996395     gbcon130.seq
 249889369     gbcon131.seq
 249991024     gbcon132.seq
 210609774     gbcon133.seq
  21448773     gbcon134.seq
 249966154     gbcon14.seq
  10102741     gbcon15.seq
 248542697     gbcon16.seq
 249999916     gbcon17.seq
 133204833     gbcon18.seq
 249994929     gbcon19.seq
 248163547     gbcon2.seq
 249990984     gbcon20.seq
 107608268     gbcon21.seq
 249999025     gbcon22.seq
  86918240     gbcon23.seq
 249999233     gbcon24.seq
 249934985     gbcon25.seq
 249999433     gbcon26.seq
 250000254     gbcon27.seq
 229991779     gbcon28.seq
 249999538     gbcon29.seq
 249795687     gbcon3.seq
 249997411     gbcon30.seq
 249997078     gbcon31.seq
 249998450     gbcon32.seq
 249122679     gbcon33.seq
 155402969     gbcon34.seq
 249999242     gbcon35.seq
 249999877     gbcon36.seq
 249996021     gbcon37.seq
 249996176     gbcon38.seq
 249994385     gbcon39.seq
 249995768     gbcon4.seq
 249994875     gbcon40.seq
  60694182     gbcon41.seq
 249994823     gbcon42.seq
 249996670     gbcon43.seq
 249994771     gbcon44.seq
 249997476     gbcon45.seq
 249999646     gbcon46.seq
  42680484     gbcon47.seq
 249996840     gbcon48.seq
 249999181     gbcon49.seq
 249999265     gbcon5.seq
 249998673     gbcon50.seq
 249995483     gbcon51.seq
 249998214     gbcon52.seq
  35989951     gbcon53.seq
 249996602     gbcon54.seq
 249994877     gbcon55.seq
 249998850     gbcon56.seq
 249996087     gbcon57.seq
 249996119     gbcon58.seq
 152231870     gbcon59.seq
 249999243     gbcon6.seq
 249999222     gbcon60.seq
 249997773     gbcon61.seq
 249999490     gbcon62.seq
 249996614     gbcon63.seq
 183250056     gbcon64.seq
 249997380     gbcon65.seq
 249998571     gbcon66.seq
 250000027     gbcon67.seq
 249997824     gbcon68.seq
 245105048     gbcon69.seq
 249997968     gbcon7.seq
 249999617     gbcon70.seq
 250000161     gbcon71.seq
 249996007     gbcon72.seq
 249996901     gbcon73.seq
 249999372     gbcon74.seq
  96213867     gbcon75.seq
 249997855     gbcon76.seq
 249995058     gbcon77.seq
 249998739     gbcon78.seq
 249998960     gbcon79.seq
  50228775     gbcon8.seq
 249999030     gbcon80.seq
  62263749     gbcon81.seq
 249999554     gbcon82.seq
 249999004     gbcon83.seq
 249998188     gbcon84.seq
 249997952     gbcon85.seq
 249996309     gbcon86.seq
  21279195     gbcon87.seq
 249996512     gbcon88.seq
 249998457     gbcon89.seq
 249997328     gbcon9.seq
 249997420     gbcon90.seq
 249998172     gbcon91.seq
 197510298     gbcon92.seq
 249995742     gbcon93.seq
 249996706     gbcon94.seq
 249996588     gbcon95.seq
 249998180     gbcon96.seq
 249997251     gbcon97.seq
 132829813     gbcon98.seq
 249997306     gbcon99.seq
      9621     gbdel.txt
 249997574     gbenv1.seq
 249998090     gbenv10.seq
  51297682     gbenv11.seq
 249999962     gbenv12.seq
 249999319     gbenv13.seq
 249998136     gbenv14.seq
 250000224     gbenv15.seq
 249998935     gbenv16.seq
 119804009     gbenv17.seq
 249999199     gbenv18.seq
 249999809     gbenv19.seq
 249998328     gbenv2.seq
 249999468     gbenv20.seq
 249999032     gbenv21.seq
 249999964     gbenv22.seq
 133786599     gbenv23.seq
 249998574     gbenv3.seq
 249998728     gbenv4.seq
 249997829     gbenv5.seq
 105111490     gbenv6.seq
 249997444     gbenv7.seq
 249997509     gbenv8.seq
 249999528     gbenv9.seq
 524289938     gbest1.seq
 524289129     gbest10.seq
 524288827     gbest100.seq
 524289421     gbest101.seq
 524289999     gbest102.seq
 524289849     gbest103.seq
 204150169     gbest104.seq
 524288770     gbest105.seq
 524290759     gbest106.seq
 473042568     gbest107.seq
 386135878     gbest108.seq
 385846596     gbest109.seq
 524290137     gbest11.seq
 380621933     gbest110.seq
 381151606     gbest111.seq
 382129415     gbest112.seq
 378549441     gbest113.seq
 389933108     gbest114.seq
 385773183     gbest115.seq
 382306233     gbest116.seq
 381827520     gbest117.seq
 411811305     gbest118.seq
 524289133     gbest119.seq
 524288800     gbest12.seq
 524289047     gbest120.seq
 524290262     gbest121.seq
 524289249     gbest122.seq
 524289954     gbest123.seq
 372463900     gbest124.seq
 524290783     gbest125.seq
 524291690     gbest126.seq
 524289522     gbest127.seq
 524289883     gbest128.seq
 524290204     gbest129.seq
     22342     gbest13.seq
 524290218     gbest130.seq
 524291440     gbest131.seq
 524290513     gbest132.seq
 524289135     gbest133.seq
 524289790     gbest134.seq
 524289596     gbest135.seq
 524289264     gbest136.seq
 103081713     gbest137.seq
 524289559     gbest138.seq
 524289250     gbest139.seq
 524291113     gbest14.seq
 524289861     gbest140.seq
 524289260     gbest141.seq
 524291314     gbest142.seq
 524291603     gbest143.seq
 524290800     gbest144.seq
 524291067     gbest145.seq
 524292026     gbest146.seq
 524289260     gbest147.seq
 524290577     gbest148.seq
 524289860     gbest149.seq
 524291510     gbest15.seq
 524292652     gbest150.seq
 333490057     gbest151.seq
 524290269     gbest152.seq
 524291417     gbest153.seq
 524289916     gbest154.seq
 524289777     gbest155.seq
 524292203     gbest156.seq
 524288938     gbest157.seq
 524291396     gbest158.seq
 524291295     gbest159.seq
 524288867     gbest16.seq
 460674420     gbest160.seq
 524290580     gbest161.seq
 524288779     gbest162.seq
 524289055     gbest163.seq
 131230499     gbest164.seq
 524290067     gbest165.seq
 524289973     gbest166.seq
 524289568     gbest167.seq
 524289580     gbest168.seq
 524289245     gbest169.seq
 524291439     gbest17.seq
 524290272     gbest170.seq
 524290651     gbest171.seq
 524294976     gbest172.seq
 524290265     gbest173.seq
 524291296     gbest174.seq
 524292555     gbest175.seq
 524289113     gbest176.seq
 479914387     gbest177.seq
 524290804     gbest178.seq
 524289248     gbest179.seq
 524289818     gbest18.seq
 524289692     gbest180.seq
 524290645     gbest181.seq
 524291099     gbest182.seq
 524290040     gbest183.seq
 524288857     gbest184.seq
 524292376     gbest185.seq
 524291760     gbest186.seq
 524289759     gbest187.seq
 524290639     gbest188.seq
 524290593     gbest189.seq
 524290536     gbest19.seq
 309363375     gbest190.seq
 524288989     gbest191.seq
 524290812     gbest192.seq
 524291962     gbest193.seq
 524288906     gbest194.seq
 524290670     gbest195.seq
 524291049     gbest196.seq
 524288992     gbest197.seq
 524289365     gbest198.seq
 524290990     gbest199.seq
 524289670     gbest2.seq
 524289987     gbest20.seq
 524289574     gbest200.seq
 524291034     gbest201.seq
 524289180     gbest202.seq
 486699462     gbest203.seq
 524289793     gbest204.seq
 524291274     gbest205.seq
 524289858     gbest206.seq
 524288796     gbest207.seq
 524288816     gbest208.seq
 524290107     gbest209.seq
 524290109     gbest21.seq
 524290055     gbest210.seq
 524290290     gbest211.seq
 524289329     gbest212.seq
 524289593     gbest213.seq
 309654161     gbest214.seq
 524292552     gbest215.seq
 524289115     gbest216.seq
 524289485     gbest217.seq
 524289718     gbest218.seq
 524289046     gbest219.seq
 458586977     gbest22.seq
 524290722     gbest220.seq
 524292250     gbest221.seq
 524288956     gbest222.seq
 524290406     gbest223.seq
 524292074     gbest224.seq
 524291031     gbest225.seq
 524292710     gbest226.seq
 524289683     gbest227.seq
 273943063     gbest228.seq
 524289420     gbest229.seq
 508910479     gbest23.seq
 524292395     gbest230.seq
 524290417     gbest231.seq
 524289606     gbest232.seq
 524291439     gbest233.seq
 524292194     gbest234.seq
 524290755     gbest235.seq
 524289408     gbest236.seq
 524290262     gbest237.seq
 524289238     gbest238.seq
 524288906     gbest239.seq
 524289751     gbest24.seq
 524291006     gbest240.seq
 524292320     gbest241.seq
 352454711     gbest242.seq
 524288930     gbest243.seq
 524290806     gbest244.seq
 524289697     gbest245.seq
 524290137     gbest246.seq
 523701754     gbest247.seq
 524291099     gbest248.seq
 524291054     gbest249.seq
 172475236     gbest25.seq
 524290785     gbest250.seq
 524290321     gbest251.seq
 524289728     gbest252.seq
 524289410     gbest253.seq
  38021859     gbest254.seq
 524291118     gbest255.seq
 524290788     gbest256.seq
 524288828     gbest257.seq
 524289501     gbest258.seq
 524288946     gbest259.seq
 524289955     gbest26.seq
 524288770     gbest260.seq
 524289901     gbest261.seq
 524288896     gbest262.seq
 524291806     gbest263.seq
 524291367     gbest264.seq
 210148673     gbest265.seq
 524290786     gbest266.seq
 524291002     gbest267.seq
 524290466     gbest268.seq
 524290445     gbest269.seq
 524289615     gbest27.seq
 524290839     gbest270.seq
 524290399     gbest271.seq
 524289501     gbest272.seq
 524289079     gbest273.seq
 524290193     gbest274.seq
 524291161     gbest275.seq
 524293062     gbest276.seq
 209933305     gbest277.seq
 524288908     gbest278.seq
 524289456     gbest279.seq
 524289176     gbest28.seq
 524290231     gbest280.seq
 524290596     gbest281.seq
 524291100     gbest282.seq
 524291137     gbest283.seq
 524290469     gbest284.seq
 524290117     gbest285.seq
 524290638     gbest286.seq
 524293038     gbest287.seq
 389953891     gbest288.seq
 524289650     gbest289.seq
 524293000     gbest29.seq
 524288753     gbest290.seq
 524289360     gbest291.seq
 524290701     gbest292.seq
 524290517     gbest293.seq
 524291251     gbest294.seq
 524289277     gbest295.seq
 475288063     gbest296.seq
 481138862     gbest297.seq
 482707852     gbest298.seq
 480206237     gbest299.seq
 513078155     gbest3.seq
 524288998     gbest30.seq
 232417715     gbest300.seq
 524291195     gbest301.seq
 524289016     gbest302.seq
 524292882     gbest303.seq
 524288918     gbest304.seq
 524289094     gbest305.seq
 524289055     gbest306.seq
 524288937     gbest307.seq
 524289779     gbest308.seq
 524290894     gbest309.seq
 524290528     gbest31.seq
 524290366     gbest310.seq
 524289884     gbest311.seq
 524288790     gbest312.seq
 369697960     gbest313.seq
 524290108     gbest314.seq
 524291502     gbest315.seq
 524290823     gbest316.seq
 524289059     gbest317.seq
 524290647     gbest318.seq
 524289370     gbest319.seq
 524291595     gbest32.seq
 524289147     gbest320.seq
 524289169     gbest321.seq
 524289911     gbest322.seq
 524291582     gbest323.seq
 524289644     gbest324.seq
 524291690     gbest325.seq
 524289427     gbest326.seq
 177002900     gbest327.seq
 524289632     gbest328.seq
 524289775     gbest329.seq
 524291914     gbest33.seq
 524289023     gbest330.seq
 524289950     gbest331.seq
 524289080     gbest332.seq
 524292899     gbest333.seq
 524291008     gbest334.seq
 524288886     gbest335.seq
 524289740     gbest336.seq
 524290820     gbest337.seq
 524289202     gbest338.seq
 524292663     gbest339.seq
 489396485     gbest34.seq
 524289918     gbest340.seq
  75623983     gbest341.seq
 524289784     gbest342.seq
 524289839     gbest343.seq
 524291167     gbest344.seq
 524289860     gbest345.seq
 524293081     gbest346.seq
 524295399     gbest347.seq
 524289712     gbest348.seq
 524291557     gbest349.seq
 490148636     gbest35.seq
 524289020     gbest350.seq
 524291302     gbest351.seq
 524290454     gbest352.seq
 524290233     gbest353.seq
 524290387     gbest354.seq
  64960382     gbest355.seq
 524289865     gbest356.seq
 524289848     gbest357.seq
 524290574     gbest358.seq
 524289636     gbest359.seq
 492360986     gbest36.seq
 524291327     gbest360.seq
 524289040     gbest361.seq
 524289676     gbest362.seq
 524289088     gbest363.seq
 524288943     gbest364.seq
 524291268     gbest365.seq
 496423171     gbest366.seq
 524291476     gbest367.seq
 524289911     gbest368.seq
 524288920     gbest369.seq
 491776102     gbest37.seq
 524289748     gbest370.seq
 524290941     gbest371.seq
 524290253     gbest372.seq
 524289634     gbest373.seq
 524289188     gbest374.seq
 524290040     gbest375.seq
 524290024     gbest376.seq
 524288847     gbest377.seq
 524291221     gbest378.seq
 217956350     gbest379.seq
 484490978     gbest38.seq
 524290514     gbest380.seq
 524291566     gbest381.seq
 524292165     gbest382.seq
 524289143     gbest383.seq
 524289757     gbest384.seq
 524289162     gbest385.seq
 524290630     gbest386.seq
 524289556     gbest387.seq
 524292032     gbest388.seq
 524291323     gbest389.seq
 498677754     gbest39.seq
 524289780     gbest390.seq
 524290127     gbest391.seq
 404906929     gbest392.seq
 524290937     gbest393.seq
 524289635     gbest394.seq
 524290869     gbest395.seq
 524289536     gbest396.seq
 524289340     gbest397.seq
 524290578     gbest398.seq
 524290559     gbest399.seq
 524288825     gbest4.seq
  15069105     gbest40.seq
 524295881     gbest400.seq
 524294919     gbest401.seq
 524290208     gbest402.seq
 524288866     gbest403.seq
 524290124     gbest404.seq
 524290734     gbest405.seq
 524288756     gbest406.seq
   7754830     gbest407.seq
 524289114     gbest408.seq
 524290410     gbest409.seq
 524291909     gbest41.seq
 436698525     gbest410.seq
 524291574     gbest42.seq
 524290258     gbest43.seq
 524290672     gbest44.seq
 524289208     gbest45.seq
 524289552     gbest46.seq
 524290291     gbest47.seq
 524290961     gbest48.seq
 524291608     gbest49.seq
 524289349     gbest5.seq
 524290143     gbest50.seq
 524292621     gbest51.seq
 524288915     gbest52.seq
 524291314     gbest53.seq
 106783385     gbest54.seq
 524290432     gbest55.seq
 524291809     gbest56.seq
 524291769     gbest57.seq
 524291164     gbest58.seq
 524290726     gbest59.seq
 524290073     gbest6.seq
 524290390     gbest60.seq
 524290052     gbest61.seq
 524290540     gbest62.seq
 524291580     gbest63.seq
 524290677     gbest64.seq
 524291002     gbest65.seq
 524292449     gbest66.seq
 308965079     gbest67.seq
 524289299     gbest68.seq
 524290553     gbest69.seq
 524289659     gbest7.seq
 524289830     gbest70.seq
 524288795     gbest71.seq
 524290131     gbest72.seq
 524290042     gbest73.seq
 524292050     gbest74.seq
 524290960     gbest75.seq
 524289320     gbest76.seq
 524290963     gbest77.seq
 524291977     gbest78.seq
 524290847     gbest79.seq
 524289851     gbest8.seq
  57003414     gbest80.seq
 524289274     gbest81.seq
 524290057     gbest82.seq
 524289984     gbest83.seq
 524289713     gbest84.seq
 524288950     gbest85.seq
 524291145     gbest86.seq
 524289268     gbest87.seq
 524290307     gbest88.seq
 524291199     gbest89.seq
 524288743     gbest9.seq
 524291357     gbest90.seq
 524289824     gbest91.seq
 295200103     gbest92.seq
 524289874     gbest93.seq
 524291735     gbest94.seq
 524289514     gbest95.seq
 524292802     gbest96.seq
 524288740     gbest97.seq
 524289764     gbest98.seq
 524288854     gbest99.seq
 117705283     gbgen.idx
 524289318     gbgss1.seq
 524289829     gbgss10.seq
 232426352     gbgss100.seq
 524289633     gbgss101.seq
 524290841     gbgss102.seq
 524290586     gbgss103.seq
 524289874     gbgss104.seq
 524289868     gbgss105.seq
 524291007     gbgss106.seq
 524289679     gbgss107.seq
 524289938     gbgss108.seq
 524290450     gbgss109.seq
 524291447     gbgss11.seq
 524290926     gbgss110.seq
 454166716     gbgss111.seq
 524291536     gbgss112.seq
 524289236     gbgss113.seq
 524289672     gbgss114.seq
 524289546     gbgss115.seq
 524288806     gbgss116.seq
 524290577     gbgss117.seq
 524291239     gbgss118.seq
 524291059     gbgss119.seq
 524291952     gbgss12.seq
 524290020     gbgss120.seq
 117129703     gbgss121.seq
 249997645     gbgss122.seq
 249999908     gbgss123.seq
 250000029     gbgss124.seq
 250000145     gbgss125.seq
  27249884     gbgss126.seq
 249999305     gbgss127.seq
 249998059     gbgss128.seq
 249997528     gbgss129.seq
 524291338     gbgss13.seq
 249999266     gbgss130.seq
 223609630     gbgss131.seq
 249998415     gbgss132.seq
 249998761     gbgss133.seq
 249998880     gbgss134.seq
 250000102     gbgss135.seq
 171437117     gbgss136.seq
 249997088     gbgss137.seq
 249998903     gbgss138.seq
 249999973     gbgss139.seq
 524289955     gbgss14.seq
 249999609     gbgss140.seq
 249996931     gbgss141.seq
  76888892     gbgss142.seq
 250000188     gbgss143.seq
   2879209     gbgss144.seq
  79504033     gbgss145.seq
 249999490     gbgss146.seq
 249999462     gbgss147.seq
  78034667     gbgss148.seq
 249998484     gbgss149.seq
 524289002     gbgss15.seq
 249999450     gbgss150.seq
 249997767     gbgss151.seq
 114935056     gbgss152.seq
 249999232     gbgss153.seq
 249999334     gbgss154.seq
 249999609     gbgss155.seq
 246354232     gbgss156.seq
 249999268     gbgss157.seq
 249997406     gbgss158.seq
 249999513     gbgss159.seq
 524290847     gbgss16.seq
 243477113     gbgss160.seq
 249999336     gbgss161.seq
 249997687     gbgss162.seq
 249997948     gbgss163.seq
 249998567     gbgss164.seq
 116382755     gbgss165.seq
 249998013     gbgss166.seq
 250000031     gbgss167.seq
 249999974     gbgss168.seq
 249998152     gbgss169.seq
 524290352     gbgss17.seq
  94058788     gbgss170.seq
 249998892     gbgss171.seq
 249999850     gbgss172.seq
 249998239     gbgss173.seq
 249999582     gbgss174.seq
 162386018     gbgss175.seq
 249999236     gbgss176.seq
 249997993     gbgss177.seq
 249998006     gbgss178.seq
 249999353     gbgss179.seq
 524289873     gbgss18.seq
  95926739     gbgss180.seq
 249999461     gbgss181.seq
 249999350     gbgss182.seq
 249998406     gbgss183.seq
 249998619     gbgss184.seq
 102413401     gbgss185.seq
 249999853     gbgss186.seq
 249998411     gbgss187.seq
 249998272     gbgss188.seq
  42310440     gbgss189.seq
 150844342     gbgss19.seq
  52091543     gbgss190.seq
 249998242     gbgss191.seq
 249999494     gbgss192.seq
 249997995     gbgss193.seq
 249997330     gbgss194.seq
 249997758     gbgss195.seq
 102524929     gbgss196.seq
 249998520     gbgss197.seq
 249998861     gbgss198.seq
 250000017     gbgss199.seq
 524289346     gbgss2.seq
 524291095     gbgss20.seq
 249998774     gbgss200.seq
 249998008     gbgss201.seq
 118508169     gbgss202.seq
 249999561     gbgss203.seq
 249998751     gbgss204.seq
 249999599     gbgss205.seq
 249999028     gbgss206.seq
 249999713     gbgss207.seq
  16550600     gbgss208.seq
 524290032     gbgss21.seq
 524290163     gbgss22.seq
 524288857     gbgss23.seq
 524291258     gbgss24.seq
 524289556     gbgss25.seq
 524289145     gbgss26.seq
 524289442     gbgss27.seq
 524291007     gbgss28.seq
 524288897     gbgss29.seq
 524288877     gbgss3.seq
 427929738     gbgss30.seq
 524290679     gbgss31.seq
 524289719     gbgss32.seq
 524290073     gbgss33.seq
 524290035     gbgss34.seq
 524290617     gbgss35.seq
 524290519     gbgss36.seq
 524291111     gbgss37.seq
 468913984     gbgss38.seq
 524291365     gbgss39.seq
 524291607     gbgss4.seq
 524290157     gbgss40.seq
 451323994     gbgss41.seq
 524289132     gbgss42.seq
 524289503     gbgss43.seq
 524289913     gbgss44.seq
 524289025     gbgss45.seq
 156684744     gbgss46.seq
 524291699     gbgss47.seq
 524289024     gbgss48.seq
 524290162     gbgss49.seq
 115085286     gbgss5.seq
 524289623     gbgss50.seq
 524288948     gbgss51.seq
 524289795     gbgss52.seq
 524290040     gbgss53.seq
 524289429     gbgss54.seq
 524289348     gbgss55.seq
 524289100     gbgss56.seq
 403163907     gbgss57.seq
 524288884     gbgss58.seq
 524288774     gbgss59.seq
 524289571     gbgss6.seq
 524290996     gbgss60.seq
 415173955     gbgss61.seq
 524290837     gbgss62.seq
 524291167     gbgss63.seq
 524290183     gbgss64.seq
 524289232     gbgss65.seq
 524291124     gbgss66.seq
 524289384     gbgss67.seq
 524289855     gbgss68.seq
 524291301     gbgss69.seq
 524290775     gbgss7.seq
 524291174     gbgss70.seq
 524290481     gbgss71.seq
 524291345     gbgss72.seq
 411220153     gbgss73.seq
 524290382     gbgss74.seq
 524289713     gbgss75.seq
 524289948     gbgss76.seq
 524289654     gbgss77.seq
 524289210     gbgss78.seq
 524288753     gbgss79.seq
 524290111     gbgss8.seq
 524289236     gbgss80.seq
 524291317     gbgss81.seq
 524291578     gbgss82.seq
 524290104     gbgss83.seq
 524289027     gbgss84.seq
 228405899     gbgss85.seq
 524291900     gbgss86.seq
 524289498     gbgss87.seq
 524290597     gbgss88.seq
 524290444     gbgss89.seq
 524289011     gbgss9.seq
 524291387     gbgss90.seq
 524291827     gbgss91.seq
 524291391     gbgss92.seq
 524292075     gbgss93.seq
 524290593     gbgss94.seq
 524290404     gbgss95.seq
 524290950     gbgss96.seq
 524291640     gbgss97.seq
 524290861     gbgss98.seq
 524290859     gbgss99.seq
 249987886     gbhtc1.seq
 250000236     gbhtc10.seq
 249999429     gbhtc11.seq
  62041312     gbhtc12.seq
 249998738     gbhtc13.seq
 250000070     gbhtc14.seq
  45452470     gbhtc15.seq
 250000065     gbhtc2.seq
 249994635     gbhtc3.seq
 249991467     gbhtc4.seq
 249991812     gbhtc5.seq
 249986737     gbhtc6.seq
 249998746     gbhtc7.seq
  71970158     gbhtc8.seq
 249999112     gbhtc9.seq
 249955003     gbhtg1.seq
 249805779     gbhtg10.seq
 249822300     gbhtg100.seq
 249997530     gbhtg101.seq
 249708148     gbhtg102.seq
 249907507     gbhtg103.seq
   8546022     gbhtg104.seq
 249845479     gbhtg105.seq
 249901160     gbhtg106.seq
 249824476     gbhtg107.seq
 249802264     gbhtg108.seq
 249963805     gbhtg109.seq
   1643239     gbhtg11.seq
 249960019     gbhtg110.seq
 249885605     gbhtg111.seq
 249878947     gbhtg112.seq
  37217905     gbhtg113.seq
 249650832     gbhtg114.seq
 249841874     gbhtg115.seq
 249742094     gbhtg116.seq
 249789613     gbhtg117.seq
 249920125     gbhtg118.seq
  94350576     gbhtg119.seq
 249672647     gbhtg12.seq
 249781124     gbhtg120.seq
 249757442     gbhtg121.seq
 249916794     gbhtg122.seq
 249966194     gbhtg123.seq
 249934769     gbhtg124.seq
 179078157     gbhtg125.seq
 249841354     gbhtg126.seq
 249806237     gbhtg127.seq
 249761566     gbhtg128.seq
 249988758     gbhtg129.seq
 249784449     gbhtg13.seq
 249832439     gbhtg130.seq
 249931468     gbhtg131.seq
 249762414     gbhtg132.seq
 249986947     gbhtg133.seq
 224224334     gbhtg134.seq
 249745013     gbhtg14.seq
 249734004     gbhtg15.seq
 249827719     gbhtg16.seq
 249994801     gbhtg17.seq
 249729949     gbhtg18.seq
 249937791     gbhtg19.seq
 249980815     gbhtg2.seq
 249948717     gbhtg20.seq
 242641861     gbhtg21.seq
 249850438     gbhtg22.seq
 249856880     gbhtg23.seq
 249768370     gbhtg24.seq
 249893769     gbhtg25.seq
 249812036     gbhtg26.seq
 249795252     gbhtg27.seq
 249875918     gbhtg28.seq
 249712630     gbhtg29.seq
 249996540     gbhtg3.seq
 249951807     gbhtg30.seq
 228801790     gbhtg31.seq
 249774678     gbhtg32.seq
 249884086     gbhtg33.seq
 249784340     gbhtg34.seq
 249937825     gbhtg35.seq
 249968828     gbhtg36.seq
 249861011     gbhtg37.seq
 249830883     gbhtg38.seq
 249954288     gbhtg39.seq
 249897858     gbhtg4.seq
 249844429     gbhtg40.seq
 229615032     gbhtg41.seq
 249817421     gbhtg42.seq
 249802595     gbhtg43.seq
 249916541     gbhtg44.seq
 249943584     gbhtg45.seq
 249929616     gbhtg46.seq
 249093490     gbhtg47.seq
 249730060     gbhtg48.seq
 249736080     gbhtg49.seq
 249988734     gbhtg5.seq
 249953039     gbhtg50.seq
 237517017     gbhtg51.seq
 249907517     gbhtg52.seq
 249801609     gbhtg53.seq
 249806448     gbhtg54.seq
 249922873     gbhtg55.seq
 249982822     gbhtg56.seq
  20953212     gbhtg57.seq
 249812041     gbhtg58.seq
 249750409     gbhtg59.seq
 249769696     gbhtg6.seq
 249991093     gbhtg60.seq
 249987028     gbhtg61.seq
 228965169     gbhtg62.seq
 249982315     gbhtg63.seq
 249759657     gbhtg64.seq
 249955237     gbhtg65.seq
 249957388     gbhtg66.seq
 249870689     gbhtg67.seq
  17370772     gbhtg68.seq
 249960711     gbhtg69.seq
 249851846     gbhtg7.seq
 249973586     gbhtg70.seq
 249953795     gbhtg71.seq
 249734627     gbhtg72.seq
 228481278     gbhtg73.seq
 249706143     gbhtg74.seq
 249875367     gbhtg75.seq
 249952151     gbhtg76.seq
 249833953     gbhtg77.seq
 248594530     gbhtg78.seq
 249883648     gbhtg79.seq
 249791419     gbhtg8.seq
 249970880     gbhtg80.seq
 249969001     gbhtg81.seq
 249935794     gbhtg82.seq
 218843248     gbhtg83.seq
 249923525     gbhtg84.seq
 249839027     gbhtg85.seq
 249998852     gbhtg86.seq
 249818654     gbhtg87.seq
 228814963     gbhtg88.seq
 249861755     gbhtg89.seq
 249971598     gbhtg9.seq
 249912443     gbhtg90.seq
 249909501     gbhtg91.seq
 249763936     gbhtg92.seq
 226827115     gbhtg93.seq
 249743597     gbhtg94.seq
 249991173     gbhtg95.seq
 249787524     gbhtg96.seq
 249807405     gbhtg97.seq
 174594762     gbhtg98.seq
 249786185     gbhtg99.seq
 249997962     gbinv1.seq
 249996360     gbinv10.seq
 149432942     gbinv11.seq
 249997873     gbinv12.seq
 249995723     gbinv13.seq
 249998688     gbinv14.seq
 248931968     gbinv15.seq
 249859557     gbinv16.seq
 249997037     gbinv17.seq
 249998818     gbinv18.seq
 230033385     gbinv19.seq
 249948121     gbinv2.seq
 234976751     gbinv3.seq
 249977700     gbinv4.seq
 249998772     gbinv5.seq
 248438094     gbinv6.seq
 249999898     gbinv7.seq
 249998328     gbinv8.seq
 249999834     gbinv9.seq
 140511691     gbjou1.idx
 189792971     gbjou2.idx
 200114955     gbjou3.idx
 278360364     gbjou4.idx
 302400075     gbjou5.idx
 290498972     gbjou6.idx
 278323732     gbjou7.idx
  63022283     gbjou8.idx
 234186900     gbkey1.idx
 177515755     gbkey2.idx
 205024355     gbkey3.idx
  93654330     gbkey4.idx
 249762679     gbmam1.seq
 249999047     gbmam2.seq
 249992910     gbmam3.seq
 249982040     gbmam4.seq
 249998475     gbmam5.seq
  27338031     gbmam6.seq
  57086939     gbnew.txt
 249999607     gbpat1.seq
 249999823     gbpat10.seq
 121007762     gbpat100.seq
 178894637     gbpat11.seq
 249999672     gbpat12.seq
 249999538     gbpat13.seq
 249999424     gbpat14.seq
 249999886     gbpat15.seq
 249998683     gbpat16.seq
  65949086     gbpat17.seq
 249999229     gbpat18.seq
 249999331     gbpat19.seq
 249999577     gbpat2.seq
 249999934     gbpat20.seq
 249999820     gbpat21.seq
 185120412     gbpat22.seq
 249999216     gbpat23.seq
 249801003     gbpat24.seq
 249999212     gbpat25.seq
 249999415     gbpat26.seq
  71196419     gbpat27.seq
 249998718     gbpat28.seq
 249999268     gbpat29.seq
 249999257     gbpat3.seq
 250000223     gbpat30.seq
 249999115     gbpat31.seq
 249999447     gbpat32.seq
 180146081     gbpat33.seq
 249999629     gbpat34.seq
 249999186     gbpat35.seq
 249998629     gbpat36.seq
 249998668     gbpat37.seq
 133704201     gbpat38.seq
 249997426     gbpat39.seq
 249998049     gbpat4.seq
 249978230     gbpat40.seq
 249999855     gbpat41.seq
 249991829     gbpat42.seq
 249996158     gbpat43.seq
 249998922     gbpat44.seq
 249998898     gbpat45.seq
 249987712     gbpat46.seq
 173724157     gbpat47.seq
 249998836     gbpat48.seq
 249998527     gbpat49.seq
  71794649     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 249999501     gbpat55.seq
 164408612     gbpat56.seq
 249999861     gbpat57.seq
 249998453     gbpat58.seq
 250000087     gbpat59.seq
 249999527     gbpat6.seq
 249999934     gbpat60.seq
 134319183     gbpat61.seq
 249996200     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 194993779     gbpat67.seq
 249999879     gbpat68.seq
 249999564     gbpat69.seq
 249999610     gbpat7.seq
 249929730     gbpat70.seq
 249824878     gbpat71.seq
 249998855     gbpat72.seq
 192932886     gbpat73.seq
 249999533     gbpat74.seq
 249999632     gbpat75.seq
 249996399     gbpat76.seq
  80124350     gbpat77.seq
 249999760     gbpat78.seq
 249999532     gbpat79.seq
 249999950     gbpat8.seq
 249998866     gbpat80.seq
 250000101     gbpat81.seq
 249868821     gbpat82.seq
  66835451     gbpat83.seq
 249999440     gbpat84.seq
 249999844     gbpat85.seq
 249999887     gbpat86.seq
 249999094     gbpat87.seq
  53428721     gbpat88.seq
 250000217     gbpat89.seq
 249999812     gbpat9.seq
 249999792     gbpat90.seq
 250000111     gbpat91.seq
  89154176     gbpat92.seq
 250000237     gbpat93.seq
 249968113     gbpat94.seq
 249999171     gbpat95.seq
 250000135     gbpat96.seq
 249998788     gbpat97.seq
 249999223     gbpat98.seq
 249999916     gbpat99.seq
 100081275     gbphg1.seq
 249990458     gbpln1.seq
 249874841     gbpln10.seq
 249843986     gbpln11.seq
  86756412     gbpln12.seq
 249997942     gbpln13.seq
 249991131     gbpln14.seq
 249997558     gbpln15.seq
 247890135     gbpln16.seq
 249869217     gbpln17.seq
 248567866     gbpln18.seq
 249999374     gbpln19.seq
 249762109     gbpln2.seq
  23471291     gbpln20.seq
 249999395     gbpln21.seq
  94408891     gbpln22.seq
 249997930     gbpln23.seq
 249998469     gbpln24.seq
 249475243     gbpln25.seq
 249999227     gbpln26.seq
 249999241     gbpln27.seq
 249998489     gbpln28.seq
 250000053     gbpln29.seq
 249910471     gbpln3.seq
 113959754     gbpln30.seq
 249997660     gbpln31.seq
 249999167     gbpln32.seq
 249999983     gbpln33.seq
 249998098     gbpln34.seq
 250000160     gbpln35.seq
 249999295     gbpln36.seq
 249998093     gbpln37.seq
 249998091     gbpln38.seq
 189183663     gbpln39.seq
 249984146     gbpln4.seq
 249934646     gbpln5.seq
 249999910     gbpln6.seq
 207431353     gbpln7.seq
 249999059     gbpln8.seq
 250000149     gbpln9.seq
 148930929     gbpri1.seq
 249971272     gbpri10.seq
 122739633     gbpri11.seq
 249966221     gbpri12.seq
 249900325     gbpri13.seq
 249891160     gbpri14.seq
 249940560     gbpri15.seq
 249938249     gbpri16.seq
 249810264     gbpri17.seq
 249976417     gbpri18.seq
 249887769     gbpri19.seq
 249903752     gbpri2.seq
 249847140     gbpri20.seq
 250000019     gbpri21.seq
  40085445     gbpri22.seq
 180070843     gbpri23.seq
 249999615     gbpri24.seq
 204683615     gbpri25.seq
 249997366     gbpri26.seq
 249857977     gbpri27.seq
 249826325     gbpri28.seq
 249868667     gbpri29.seq
 249835727     gbpri3.seq
 249834770     gbpri30.seq
 249973214     gbpri31.seq
 249810577     gbpri32.seq
 249996477     gbpri33.seq
  84902435     gbpri34.seq
 249995363     gbpri35.seq
 249998838     gbpri36.seq
 249999938     gbpri37.seq
 249997977     gbpri38.seq
 249864036     gbpri39.seq
 249852603     gbpri4.seq
 249998424     gbpri40.seq
  83023515     gbpri41.seq
 249857147     gbpri5.seq
 249927876     gbpri6.seq
 249970365     gbpri7.seq
 249940127     gbpri8.seq
 249762812     gbpri9.seq
    266918     gbrel.txt
 249822986     gbrod1.seq
 249989786     gbrod10.seq
  46839377     gbrod11.seq
 249991565     gbrod12.seq
 249841479     gbrod13.seq
 249954260     gbrod14.seq
 249880505     gbrod15.seq
 249871577     gbrod16.seq
 249889843     gbrod17.seq
 249996632     gbrod18.seq
  73998904     gbrod19.seq
 249861907     gbrod2.seq
 249989891     gbrod20.seq
 249896347     gbrod21.seq
 226408925     gbrod22.seq
 249999205     gbrod23.seq
 249995212     gbrod24.seq
 249845828     gbrod25.seq
 249920451     gbrod26.seq
 249998976     gbrod27.seq
 232720809     gbrod28.seq
 249806731     gbrod3.seq
 249692718     gbrod4.seq
 249720980     gbrod5.seq
 249771141     gbrod6.seq
 249749088     gbrod7.seq
 249823470     gbrod8.seq
 249821141     gbrod9.seq
2392598170     gbsdr1.txt
5194003226     gbsdr2.txt
2215546092     gbsdr3.txt
 139396322     gbsec.idx
 249997067     gbsts1.seq
 249997362     gbsts10.seq
 212226966     gbsts11.seq
 249996524     gbsts12.seq
 249997606     gbsts13.seq
 249999051     gbsts14.seq
 249999111     gbsts15.seq
  26927942     gbsts16.seq
 249999803     gbsts17.seq
 249996731     gbsts18.seq
 249998395     gbsts19.seq
 249999395     gbsts2.seq
 118376647     gbsts20.seq
 249999978     gbsts3.seq
 249996919     gbsts4.seq
  35348302     gbsts5.seq
 249997222     gbsts6.seq
 249997899     gbsts7.seq
 249998458     gbsts8.seq
 249997188     gbsts9.seq
 249996107     gbsyn1.seq
 237996797     gbsyn2.seq
 249999667     gbtsa1.seq
 249999339     gbtsa2.seq
 249999490     gbtsa3.seq
  64796976     gbtsa4.seq
    447342     gbuna1.seq
 249995228     gbvrl1.seq
 249999567     gbvrl10.seq
 249998158     gbvrl11.seq
 249997328     gbvrl12.seq
 249994055     gbvrl13.seq
   8401225     gbvrl14.seq
 249998631     gbvrl2.seq
 249980621     gbvrl3.seq
 249995774     gbvrl4.seq
 129727401     gbvrl5.seq
 249999019     gbvrl6.seq
 249998617     gbvrl7.seq
 249998882     gbvrl8.seq
 249999352     gbvrl9.seq
 249946935     gbvrt1.seq
 249937966     gbvrt10.seq
 249901467     gbvrt11.seq
 176017506     gbvrt12.seq
 249996787     gbvrt13.seq
 249970943     gbvrt14.seq
 249968268     gbvrt15.seq
 249999207     gbvrt16.seq
 249936574     gbvrt17.seq
 249994705     gbvrt18.seq
 249996836     gbvrt19.seq
 249998299     gbvrt2.seq
 249998489     gbvrt20.seq
   5968191     gbvrt21.seq
 249732185     gbvrt3.seq
 250000033     gbvrt4.seq
  32198250     gbvrt5.seq
 249994506     gbvrt6.seq
 249996361     gbvrt7.seq
 249866392     gbvrt8.seq
 249935581     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         49148      92018229
BCT10        63         117808727
BCT11        16194      106586525
BCT12        53626      85214234
BCT13        94         110535707
BCT14        151        96466604
BCT15        60         109557523
BCT16        52         112042350
BCT17        46         111873353
BCT18        57         113989395
BCT19        67         112830215
BCT2         66         110398637
BCT20        33         84321683
BCT21        40         106881287
BCT22        58         105533856
BCT23        74         111675186
BCT24        55         110045255
BCT25        63         106845562
BCT26        55         111297421
BCT27        53         109574112
BCT28        46         109006305
BCT29        93         106054418
BCT3         52         110808721
BCT30        58         107600868
BCT31        65         108501758
BCT32        123        108842042
BCT33        33         58347023
BCT34        202        108966790
BCT35        44         107367804
BCT36        40         107342165
BCT37        63         101786877
BCT38        39         108180076
BCT39        240        99386121
BCT4         6962       107528604
BCT40        425        97248713
BCT41        1589       2511823
BCT42        3176       5212972
BCT43        6347       7901820
BCT44        12648      15076097
BCT45        25632      27763281
BCT46        50581      54060759
BCT47        76764      77537012
BCT48        69366      77953706
BCT49        6364       103159927
BCT5         31496      51172220
BCT50        41023      90327816
BCT51        66284      83511039
BCT52        5435       10048831
BCT6         39038      86911160
BCT7         6441       98374785
BCT8         14427      93307049
BCT9         5215       103446803
ENV1         94016      71993411
ENV10        83450      87086413
ENV11        18515      16329797
ENV12        85320      81225477
ENV13        121332     42815225
ENV14        90405      79077763
ENV15        99426      69095291
ENV16        74905      83850664
ENV17        30928      41718771
ENV18        71622      83926090
ENV19        104395     66885705
ENV2         89777      69742528
ENV20        134865     32298248
ENV21        134298     31619995
ENV22        129267     46145450
ENV23        57391      35265653
ENV3         82962      82501364
ENV4         89270      79380087
ENV5         89769      83784978
ENV6         49938      19527065
ENV7         131840     31330706
ENV8         87067      71137416
ENV9         94207      73643373
EST1         162724     63096884
EST10        171880     70582810
EST100       232935     143233718
EST101       220765     113977286
EST102       209234     102676423
EST103       159199     103542096
EST104       61130      52090083
EST105       169151     111428783
EST106       170796     113795521
EST107       109418     61171439
EST108       64275      23526839
EST109       64370      22877425
EST11        168409     73440432
EST110       64753      23939116
EST111       64658      27037633
EST112       64808      22296359
EST113       66147      26264658
EST114       64107      27879331
EST115       64719      26699610
EST116       64901      26779967
EST117       64712      25492255
EST118       61286      40301964
EST119       181963     87493399
EST12        196386     87636257
EST120       174469     83395774
EST121       155602     95802347
EST122       149844     94744934
EST123       158934     99786104
EST124       101087     55815533
EST125       208520     103371289
EST126       155574     79218396
EST127       162866     86222063
EST128       162039     92541442
EST129       159422     85142477
EST13        8          2589
EST130       179324     108505252
EST131       213508     115093820
EST132       168383     101583402
EST133       172644     77897866
EST134       149499     84303183
EST135       153316     92636649
EST136       161429     94379674
EST137       33350      16979897
EST138       194364     110939769
EST139       234802     103443444
EST14        223626     113057838
EST140       155572     91938632
EST141       172899     95671933
EST142       149697     86741438
EST143       137559     88808091
EST144       155888     92039940
EST145       150161     77228517
EST146       125342     65473926
EST147       124892     63621432
EST148       130482     55771823
EST149       130013     51510044
EST15        169699     108255181
EST150       131525     51650645
EST151       86798      34233673
EST152       176494     87013917
EST153       185617     86776780
EST154       161027     112271249
EST155       221075     132247582
EST156       217630     123305904
EST157       170099     92019292
EST158       144039     113985113
EST159       147554     91897663
EST16        187978     112299805
EST160       145741     82559434
EST161       146161     77506106
EST162       158841     94735352
EST163       164727     92366999
EST164       40964      24376962
EST165       160331     98864210
EST166       188323     105785005
EST167       154078     86591149
EST168       130942     68417922
EST169       181365     99804276
EST17        196187     121482986
EST170       173500     103578145
EST171       151560     91621255
EST172       172696     88022392
EST173       133867     86066443
EST174       193612     111475265
EST175       156174     90068939
EST176       116574     70160717
EST177       166921     95672830
EST178       172764     104574732
EST179       183343     131897037
EST18        194464     119197377
EST180       160611     114770076
EST181       190853     90873976
EST182       153009     117052612
EST183       150956     90657534
EST184       149553     78135957
EST185       173528     81158735
EST186       152455     84134040
EST187       160659     102517930
EST188       152409     90982675
EST189       163380     102620017
EST19        171013     115179520
EST190       116462     66325771
EST191       134084     90867492
EST192       135053     90288036
EST193       146439     90479029
EST194       134811     90482425
EST195       122871     86699536
EST196       186494     97659621
EST197       177646     98057967
EST198       177175     98301525
EST199       174402     97828338
EST2         164869     62097811
EST20        208076     108131322
EST200       172101     96114709
EST201       176279     98440418
EST202       177586     96643959
EST203       165052     90672426
EST204       196157     105673690
EST205       209868     113545409
EST206       181303     107563712
EST207       194026     111481621
EST208       199617     122166719
EST209       194817     119207671
EST21        226471     109685146
EST210       191297     119456375
EST211       186595     117646627
EST212       226356     143406159
EST213       235527     115249139
EST214       77274      54733308
EST215       149226     95358407
EST216       192773     105387941
EST217       185842     121352772
EST218       106932     90523954
EST219       139633     115137762
EST22        171445     47206817
EST220       166080     96122970
EST221       149224     107861059
EST222       223654     105167585
EST223       144609     103378888
EST224       140362     99265022
EST225       140901     100231612
EST226       123980     88773970
EST227       147304     92391975
EST228       69470      46155851
EST229       135166     98769079
EST23        126919     36585377
EST230       141148     100798514
EST231       125733     85875773
EST232       135055     88282775
EST233       161346     119072315
EST234       143522     120007707
EST235       137085     112303577
EST236       163548     99984765
EST237       179666     113725571
EST238       151967     100596033
EST239       182320     121375040
EST24        132478     44189561
EST240       162637     111385930
EST241       143822     108361226
EST242       116337     69867099
EST243       227901     96738507
EST244       171159     117840244
EST245       169062     77103339
EST246       225313     44746650
EST247       218223     83938514
EST248       174729     132827999
EST249       170089     103574233
EST25        71624      29878081
EST250       173916     111218178
EST251       167520     114037259
EST252       174608     118275329
EST253       193257     102871530
EST254       14218      6698772
EST255       183333     105293315
EST256       168840     122585166
EST257       217014     105411829
EST258       281368     123208671
EST259       212919     123684962
EST26        220618     102545937
EST260       186869     37229594
EST261       261962     126153156
EST262       163856     95515358
EST263       164632     107128921
EST264       165184     108572443
EST265       74022      50030641
EST266       202067     106078644
EST267       164646     110921978
EST268       195335     114085610
EST269       207006     44185618
EST27        225224     112771786
EST270       201972     53202487
EST271       189412     108052110
EST272       182001     120120639
EST273       178418     116826352
EST274       182523     104785194
EST275       144836     97967666
EST276       184000     82017238
EST277       47261      29278744
EST278       137868     89042970
EST279       167368     97070328
EST28        187117     84903358
EST280       275099     28790423
EST281       258415     39091372
EST282       154032     107891686
EST283       166889     116016158
EST284       158748     99140596
EST285       210088     70304220
EST286       236936     65207152
EST287       163961     106617916
EST288       149039     87974645
EST289       150760     83121902
EST29        161848     70576020
EST290       186069     123649376
EST291       189192     114628686
EST292       156855     112665748
EST293       196193     112488531
EST294       181447     102138609
EST295       184182     107578074
EST296       191803     65554788
EST297       190629     70751001
EST298       190467     72064844
EST299       192300     73103029
EST3         163315     58402707
EST30        176117     70912671
EST300       81416      46048239
EST301       185346     129585509
EST302       162529     95337421
EST303       160281     92398467
EST304       128773     102732254
EST305       154745     100683889
EST306       176938     99870162
EST307       160692     99580817
EST308       173565     100973793
EST309       162367     108383271
EST31        157659     67453539
EST310       146882     103700326
EST311       169480     107853533
EST312       166546     126883554
EST313       131527     111436281
EST314       177475     109761222
EST315       144105     83218921
EST316       145581     99566019
EST317       144373     97459873
EST318       140469     92412907
EST319       149380     103082636
EST32        170967     74872365
EST320       153757     103340172
EST321       185522     110215892
EST322       162711     93403037
EST323       164412     96216717
EST324       154528     110582598
EST325       164806     100077019
EST326       145894     92531277
EST327       46987      29931965
EST328       166053     102381561
EST329       201557     107414192
EST33        182061     75136237
EST330       125533     68471125
EST331       127852     84657971
EST332       138404     86996741
EST333       134287     85691819
EST334       154313     85250458
EST335       224172     87766513
EST336       176654     88784798
EST337       175037     106276807
EST338       167505     99952068
EST339       130844     86830439
EST34        97740      27684975
EST340       137429     91442518
EST341       19624      12781061
EST342       163271     103594800
EST343       182497     119943066
EST344       162705     84224999
EST345       188346     116844957
EST346       149617     109203416
EST347       73955      44616880
EST348       121901     66915696
EST349       135540     80875257
EST35        98478      30010703
EST350       145144     68762283
EST351       161710     33079570
EST352       161640     33193325
EST353       178931     90684657
EST354       221073     124889883
EST355       32072      14679450
EST356       258970     118376078
EST357       209544     107527949
EST358       150273     97014941
EST359       138604     88683334
EST36        98727      31262874
EST360       150125     88951039
EST361       190167     117787313
EST362       239565     75053012
EST363       193367     118416685
EST364       143300     67511130
EST365       209526     109264504
EST366       196361     108789886
EST367       165093     111080337
EST368       198166     114633492
EST369       174191     26686641
EST37        97557      29687431
EST370       164424     13709580
EST371       159838     24529022
EST372       161760     32916920
EST373       161922     32531807
EST374       153738     74522960
EST375       175266     102183224
EST376       175741     119895032
EST377       171242     100084053
EST378       162671     113281442
EST379       55948      39123566
EST38        99962      30242763
EST380       142839     100978595
EST381       151687     99485353
EST382       180406     130100131
EST383       152870     95302731
EST384       175114     68863910
EST385       171678     27876659
EST386       165969     110511003
EST387       155024     103372086
EST388       185367     119737585
EST389       140807     80697083
EST39        102684     30680740
EST390       201134     122042482
EST391       149890     104675948
EST392       105504     72084989
EST393       142198     92806154
EST394       158182     94630740
EST395       177307     97358452
EST396       161445     96838724
EST397       169767     100178208
EST398       177985     108934127
EST399       102099     73415199
EST4         174472     68804432
EST40        3241       853046
EST400       79931      61157469
EST401       111687     71848195
EST402       135131     81031413
EST403       130708     84091540
EST404       142200     86736468
EST405       159411     96558167
EST406       182439     96693741
EST407       2287       845415
EST408       164704     59654088
EST409       172142     60490789
EST41        101463     54476588
EST410       138588     54124424
EST42        124280     52815471
EST43        168983     87927303
EST44        171187     69831769
EST45        173311     94231578
EST46        174239     89773434
EST47        165746     82102543
EST48        167058     95687745
EST49        160140     88015306
EST5         172021     67418015
EST50        164161     95865841
EST51        163831     90879094
EST52        154657     75078753
EST53        156296     94312760
EST54        34648      13919149
EST55        171474     68769616
EST56        160402     78090935
EST57        176327     102561259
EST58        158202     98330629
EST59        162879     105529639
EST6         180188     70820522
EST60        168571     102650923
EST61        167710     108675254
EST62        177963     78077927
EST63        173737     101364576
EST64        151705     79450749
EST65        155781     89031190
EST66        159373     95541283
EST67        95875      56370410
EST68        148863     88192172
EST69        195742     108380735
EST7         170982     73718356
EST70        214859     113175075
EST71        201936     115385102
EST72        211262     125003777
EST73        195006     113276591
EST74        153897     78406177
EST75        138107     64991778
EST76        147499     78415053
EST77        159350     108708825
EST78        150262     79645118
EST79        147922     84723860
EST8         183704     73247753
EST80        15280      16563044
EST81        191116     95525522
EST82        219724     128954924
EST83        211874     112015068
EST84        221821     104262898
EST85        202543     89636177
EST86        151971     92674717
EST87        153409     80867317
EST88        169661     90334797
EST89        155689     87100202
EST9         171026     74513822
EST90        156482     97779503
EST91        155641     107030956
EST92        90016      46915370
EST93        156003     119442687
EST94        144315     106421285
EST95        149560     108869731
EST96        142347     85536394
EST97        165443     93218240
EST98        179711     113490281
EST99        259358     157485165
GSS1         205737     90151884
GSS10        136885     66983898
GSS100       85167      43034540
GSS101       195380     123718914
GSS102       171367     114186705
GSS103       201451     118373225
GSS104       207406     136080694
GSS105       215150     141912749
GSS106       213762     143292141
GSS107       209587     148457681
GSS108       210968     146704110
GSS109       209200     149200727
GSS11        139072     74912075
GSS110       206541     150947875
GSS111       157133     116817970
GSS112       135293     85662155
GSS113       173616     81341134
GSS114       192704     87081854
GSS115       176117     150096605
GSS116       183148     128728726
GSS117       188364     152081657
GSS118       193546     131442501
GSS119       192486     134670951
GSS12        150162     71374253
GSS120       199464     111167010
GSS121       34412      18165570
GSS122       87169      64174921
GSS123       83557      62796712
GSS124       103734     48638247
GSS125       68568      58500765
GSS126       7284       6736323
GSS127       68689      57997997
GSS128       69318      56731875
GSS129       69558      56262131
GSS13        147467     72169409
GSS130       71310      56073507
GSS131       68163      51560938
GSS132       75915      58209304
GSS133       87237      74898207
GSS134       81830      44609896
GSS135       93317      45114492
GSS136       56347      44171450
GSS137       77438      61353715
GSS138       69655      58699702
GSS139       67711      62707076
GSS14        180923     90785082
GSS140       61743      53255060
GSS141       95658      42987107
GSS142       21258      4959164
GSS143       112672     70634090
GSS144       1088       802743
GSS145       23226      28867035
GSS146       106621     69122590
GSS147       85469      35209982
GSS148       37301      23210969
GSS149       120690     73137800
GSS15        165652     96400095
GSS150       118608     75280747
GSS151       105255     63705478
GSS152       47447      23060733
GSS153       83102      54651503
GSS154       95630      61300959
GSS155       107319     78552403
GSS156       106422     76714273
GSS157       106058     79947480
GSS158       103996     80016519
GSS159       76376      51040365
GSS16        174865     93148028
GSS160       104570     63290945
GSS161       109868     66415305
GSS162       106323     59388992
GSS163       68303      37395892
GSS164       70149      39050322
GSS165       36527      17435683
GSS166       85481      46023427
GSS167       97119      55907586
GSS168       94982      49597190
GSS169       96286      55922591
GSS17        196831     125921881
GSS170       42132      23615490
GSS171       114638     43642267
GSS172       117085     39368203
GSS173       108676     55514545
GSS174       101471     78372335
GSS175       64751      40741499
GSS176       95891      36542252
GSS177       95417      37268709
GSS178       96671      35161518
GSS179       94285      39167432
GSS18        194793     105974188
GSS180       37736      17626556
GSS181       103939     66277823
GSS182       94551      61190929
GSS183       95128      60357048
GSS184       94773      60868501
GSS185       33134      33073975
GSS186       83875      28283031
GSS187       84362      27389237
GSS188       85085      25924821
GSS189       14410      4314220
GSS19        58045      24853934
GSS190       16547      7508221
GSS191       92719      59684106
GSS192       89364      47776813
GSS193       91531      63450540
GSS194       91165      63958093
GSS195       90953      64327876
GSS196       37422      26092587
GSS197       89852      65233772
GSS198       88611      68592611
GSS199       83719      79618297
GSS2         186321     94757946
GSS20        186922     105326832
GSS200       84139      79031087
GSS201       86536      72315437
GSS202       45040      27003629
GSS203       94787      57200301
GSS204       93517      59081345
GSS205       93900      58510429
GSS206       94714      57307691
GSS207       94279      58016121
GSS208       6701       3333254
GSS21        169127     115836885
GSS22        174106     99568504
GSS23        192369     138527305
GSS24        201031     123494695
GSS25        175471     104277105
GSS26        197043     119487367
GSS27        167868     161574100
GSS28        190632     134457391
GSS29        167162     120551392
GSS3         178459     89335065
GSS30        158800     105369328
GSS31        201674     130043762
GSS32        222403     119401032
GSS33        224622     116464431
GSS34        225847     114839942
GSS35        216729     131101779
GSS36        202761     159857212
GSS37        199140     148663094
GSS38        188814     55216002
GSS39        186759     106542424
GSS4         169841     86595170
GSS40        191190     139152629
GSS41        150052     134697697
GSS42        187635     102192144
GSS43        178165     125540299
GSS44        189664     127763132
GSS45        194848     125935406
GSS46        53376      50174995
GSS47        175399     104013141
GSS48        170991     105338684
GSS49        171834     105224139
GSS5         37544      23513994
GSS50        186393     124599840
GSS51        190586     117318760
GSS52        190213     125116072
GSS53        189040     119447859
GSS54        189612     132326093
GSS55        193162     112115566
GSS56        194518     124517461
GSS57        139558     107273760
GSS58        176476     141454714
GSS59        164986     113500649
GSS6         165210     86460572
GSS60        164779     113943857
GSS61        148738     100740798
GSS62        160469     131406651
GSS63        173051     144906954
GSS64        187621     121769642
GSS65        207367     129089824
GSS66        196667     113307985
GSS67        251745     131206229
GSS68        157528     105633382
GSS69        165274     126099813
GSS7         168976     80580102
GSS70        165920     126999039
GSS71        168036     126901294
GSS72        184858     114659919
GSS73        154005     113583665
GSS74        204050     129689291
GSS75        174727     115109534
GSS76        204933     135093898
GSS77        228102     77375903
GSS78        187368     115295212
GSS79        125986     93231840
GSS8         169076     90832874
GSS80        148425     119507303
GSS81        143035     118701477
GSS82        146611     118593717
GSS83        146502     121757582
GSS84        147311     120547377
GSS85        66440      55012182
GSS86        153116     125189617
GSS87        151211     119797798
GSS88        147162     116207624
GSS89        146029     118503255
GSS9         138817     67702797
GSS90        148214     123451695
GSS91        151860     123280019
GSS92        150921     121305940
GSS93        149487     124131451
GSS94        149686     123749265
GSS95        150354     122457806
GSS96        147975     115583377
GSS97        145074     117966648
GSS98        148906     124769077
GSS99        184838     128727291
HTC1         25164      27215418
HTC10        66366      67961839
HTC11        72870      78424760
HTC12        16675      24334708
HTC13        66997      61008541
HTC14        68364      69532114
HTC15        16464      11348270
HTC2         16164      36511526
HTC3         16149      36817210
HTC4         16389      35869962
HTC5         16090      40460616
HTC6         16183      37869996
HTC7         55417      33894056
HTC8         28886      15587525
HTC9         63034      76335598
HTG1         1318       188816333
HTG10        1297       186286287
HTG100       989        189369425
HTG101       999        189436314
HTG102       985        189268172
HTG103       1165       190534513
HTG104       45         6486254
HTG105       1104       189778741
HTG106       1050       189717830
HTG107       1398       191353958
HTG108       1322       190855228
HTG109       1617       191199847
HTG11        9          1245953
HTG110       1427       190989779
HTG111       1156       190064332
HTG112       1096       185358626
HTG113       181        28050854
HTG114       1626       188270914
HTG115       965        193198557
HTG116       744        168699171
HTG117       1086       193685337
HTG118       1104       193096002
HTG119       389        73095019
HTG12        1451       183812880
HTG120       1031       189752857
HTG121       1054       192606152
HTG122       1162       192088464
HTG123       1080       193006346
HTG124       1076       193046837
HTG125       790        138239998
HTG126       1123       192622328
HTG127       1100       192363970
HTG128       1081       192362656
HTG129       1104       192504106
HTG13        875        191643337
HTG130       1095       191833947
HTG131       1090       192385357
HTG132       1111       191988432
HTG133       1102       192429074
HTG134       1174       169889217
HTG14        749        192036027
HTG15        744        191917504
HTG16        783        191989084
HTG17        801        191954200
HTG18        770        191929668
HTG19        2068       170862462
HTG2         2464       186026155
HTG20        1090       187538943
HTG21        918        184004410
HTG22        785        191723345
HTG23        927        190139494
HTG24        905        190329607
HTG25        811        191303618
HTG26        783        191820779
HTG27        875        190997903
HTG28        894        190457192
HTG29        939        189851508
HTG3         2515       185243126
HTG30        909        190928838
HTG31        854        174101360
HTG32        874        191066131
HTG33        966        189474468
HTG34        884        190904567
HTG35        865        191312650
HTG36        827        191776650
HTG37        947        189899154
HTG38        947        190393059
HTG39        941        190296155
HTG4         2554       188374841
HTG40        1046       189090463
HTG41        1110       171512170
HTG42        1259       187973591
HTG43        1170       187963033
HTG44        1150       188040452
HTG45        1118       191360634
HTG46        1268       190655764
HTG47        1173       190417266
HTG48        1130       191136241
HTG49        1047       191184853
HTG5         1283       185543864
HTG50        1021       189706498
HTG51        1061       180599364
HTG52        970        190185455
HTG53        1106       190075891
HTG54        1045       190185372
HTG55        1014       189796669
HTG56        968        189203108
HTG57        91         15924971
HTG58        1010       189317741
HTG59        1030       189833096
HTG6         1273       185016781
HTG60        1068       187461057
HTG61        1129       188223655
HTG62        1007       173722493
HTG63        1086       189656608
HTG64        1065       189383724
HTG65        1169       188862683
HTG66        1177       187550196
HTG67        1284       184407283
HTG68        97         12761644
HTG69        1221       185314622
HTG7         1275       185326125
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1182       187515281
HTG73        1035       172736796
HTG74        1118       188209046
HTG75        1101       190799857
HTG76        1138       190891634
HTG77        1183       190789061
HTG78        1114       189327131
HTG79        1171       190202159
HTG8         1459       184483094
HTG80        1115       190051467
HTG81        1214       189986795
HTG82        1120       189732461
HTG83        968        166272508
HTG84        1228       188397022
HTG85        1255       187734415
HTG86        1142       190059532
HTG87        1149       189665619
HTG88        1013       173976713
HTG89        1180       189887411
HTG9         1200       186953640
HTG90        1111       190192844
HTG91        1145       190180515
HTG92        1100       190382070
HTG93        1048       173155450
HTG94        1056       190694692
HTG95        1156       191053520
HTG96        1042       189124502
HTG97        1069       189520674
HTG98        711        132601479
HTG99        1018       189690522
INV1         93989      48680980
INV10        84010      65519297
INV11        49954      39252276
INV12        85725      64914779
INV13        81342      66581538
INV14        78905      68311266
INV15        40078      110603167
INV16        194        155317154
INV17        14695      138643785
INV18        60867      82353597
INV19        33105      100531624
INV2         2565       183534304
INV3         943        156364409
INV4         27836      118546700
INV5         79419      70948815
INV6         33011      115130966
INV7         47101      98952619
INV8         80674      71868273
INV9         58199      88289429
MAM1         13623      164037144
MAM2         32259      138114822
MAM3         46733      104312667
MAM4         50184      124318168
MAM5         73658      85938910
MAM6         8325       8193543
PAT1         222542     70116699
PAT10        124682     102523661
PAT100       112152     27225046
PAT11        98153      63996194
PAT12        142114     62836086
PAT13        105848     59928277
PAT14        103676     50109932
PAT15        121036     53290601
PAT16        113148     61261981
PAT17        39214      16261019
PAT18        146866     52619866
PAT19        153883     78031245
PAT2         194544     84644913
PAT20        105042     118278487
PAT21        133347     95768472
PAT22        84481      78926117
PAT23        123527     103393927
PAT24        119451     105667859
PAT25        145592     86690945
PAT26        174983     64276296
PAT27        71447      1786175
PAT28        102177     77405969
PAT29        93964      87637529
PAT3         171983     95894231
PAT30        119942     61669438
PAT31        96656      78962764
PAT32        128375     55040494
PAT33        92196      51106640
PAT34        111301     78150375
PAT35        137080     29095092
PAT36        158181     23471538
PAT37        114369     49613938
PAT38        46523      54621373
PAT39        95733      83195520
PAT4         153734     106065135
PAT40        100231     70980964
PAT41        135176     39277514
PAT42        144261     34182437
PAT43        123895     64386570
PAT44        104278     81425449
PAT45        92446      75340640
PAT46        113547     66184235
PAT47        66387      55532785
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57197      23951583
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274454     6861350
PAT56        129252     31622558
PAT57        161341     77814723
PAT58        92879      89471453
PAT59        106732     74664021
PAT6         170642     91909261
PAT60        122357     64030175
PAT61        67061      30224535
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        112153     48285117
PAT68        342935     8573375
PAT69        188806     88519660
PAT7         154826     88273196
PAT70        111348     132068608
PAT71        3850       194703659
PAT72        131292     110979300
PAT73        158599     54826034
PAT74        224735     34113732
PAT75        250080     15844368
PAT76        180675     63676831
PAT77        51648      26046194
PAT78        114199     110462365
PAT79        137682     83273933
PAT8         131192     97055113
PAT80        164183     99340286
PAT81        158860     103334939
PAT82        137435     114993907
PAT83        42311      27994848
PAT84        193712     81686401
PAT85        150217     108404022
PAT86        356051     11379688
PAT87        257211     57607099
PAT88        40710      13964759
PAT89        202631     47409644
PAT9         129613     101122792
PAT90        275102     9861629
PAT91        220269     46461635
PAT92        110616     2978567
PAT93        268989     21637646
PAT94        187202     59837899
PAT95        108389     107019705
PAT96        117383     73116638
PAT97        77689      96311354
PAT98        118950     85202933
PAT99        163525     74527057
PHG1         5363       40452514
PLN1         59804      93364096
PLN10        37336      72681714
PLN11        14007      137402093
PLN12        7656       36828642
PLN13        17557      144703865
PLN14        17615      146179384
PLN15        17549      146270813
PLN16        24619      128984358
PLN17        5392       151426908
PLN18        1226       169562290
PLN19        16395      151239728
PLN2         16356      144412385
PLN20        4814       5823069
PLN21        67503      69912529
PLN22        28356      30620223
PLN23        77098      76452098
PLN24        65526      81580660
PLN25        39104      117764751
PLN26        18507      135742720
PLN27        19852      132636876
PLN28        77844      74956962
PLN29        97682      59824678
PLN3         1419       182604570
PLN30        34835      32387860
PLN31        81207      71185693
PLN32        78038      76122110
PLN33        79908      71302903
PLN34        81190      77289697
PLN35        115891     46478178
PLN36        79280      72807277
PLN37        55813      90080260
PLN38        77478      78062069
PLN39        40340      70428280
PLN4         2007       188599123
PLN5         1670       194708406
PLN6         35288      123006440
PLN7         63755      63638075
PLN8         73388      76167382
PLN9         37150      49271920
PRI1         23014      59643101
PRI10        1283       179502291
PRI11        732        88970773
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191746891
PRI17        1137       193610661
PRI18        1099       194297097
PRI19        1166       193629064
PRI2         17014      151274413
PRI20        1799       191861558
PRI21        15630      166427374
PRI22        6669       19206113
PRI23        32480      85310138
PRI24        61488      78329475
PRI25        30555      68504911
PRI26        6600       167095553
PRI27        2122       180829620
PRI28        1603       181698932
PRI29        2030       181862205
PRI3         1435       175593492
PRI30        1976       180732170
PRI31        13056      154652338
PRI32        1294       183076240
PRI33        43859      104099795
PRI34        21440      27298328
PRI35        32191      63614159
PRI36        20231      117529774
PRI37        18724      146977579
PRI38        67519      86984177
PRI39        50078      92096937
PRI4         1287       185811923
PRI40        68637      83792683
PRI41        13043      43967943
PRI5         1316       183668713
PRI6         1182       180380835
PRI7         1252       181244002
PRI8         1216       178011927
PRI9         1358       174572560
ROD1         30749      143039664
ROD10        982        181164585
ROD11        181        34081812
ROD12        1035       185585439
ROD13        940        182764372
ROD14        1040       189291758
ROD15        950        180424726
ROD16        967        181998130
ROD17        991        185852021
ROD18        1182       190536728
ROD19        16083      29970562
ROD2         912        175167648
ROD20        20161      149008857
ROD21        1137       182391172
ROD22        1061       165449321
ROD23        13731      162744731
ROD24        38681      69963859
ROD25        21915      104187136
ROD26        1515       187906430
ROD27        138199     36651240
ROD28        72023      68780277
ROD3         908        173314599
ROD4         901        173772469
ROD5         920        174094119
ROD6         975        178488779
ROD7         964        179278742
ROD8         981        181335837
ROD9         995        182023198
STS1         85094      36490082
STS10        57907      44419978
STS11        49213      37736560
STS12        57924      43637361
STS13        64506      42956287
STS14        93353      34059192
STS15        103301     26255390
STS16        11029      2984455
STS17        102990     27289864
STS18        87041      34345221
STS19        98875      33238671
STS2         84891      49890353
STS20        46296      15807224
STS3         67658      26336196
STS4         75516      36979982
STS5         7621       4471902
STS6         54177      31603126
STS7         54081      31788805
STS8         54235      31906296
STS9         55657      37682948
SYN1         45241      72328883
SYN2         46668      66953902
TSA1         124870     38005979
TSA2         119107     44240810
TSA3         116344     43365065
TSA4         28296      13180123
UNA1         222        120289
VRL1         71396      66599928
VRL10        58893      72707571
VRL11        58310      72491712
VRL12        60075      69864807
VRL13        65755      73213117
VRL14        3223       1630785
VRL2         72763      63972935
VRL3         71098      63786491
VRL4         69687      68947371
VRL5         31384      36343148
VRL6         48999      77926064
VRL7         63421      71626197
VRL8         68852      66783459
VRL9         61944      73088092
VRT1         30599      142049323
VRT10        1258       189459052
VRT11        8280       178040584
VRT12        3944       129551696
VRT13        13242      170744397
VRT14        5213       183187100
VRT15        3964       186226450
VRT16        41675      128352330
VRT17        79283      69726466
VRT18        78290      66474467
VRT19        78654      67013731
VRT2         20089      164703287
VRT20        68470      89206349
VRT21        1991       1502436
VRT3         53637      105512909
VRT4         28713      142313930
VRT5         10230      8775500
VRT6         73023      66849393
VRT7         31735      63526450
VRT8         30250      116886248
VRT9         1207       190097961

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 176.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:

Entries        Bases   Species

14085418 14602149313   Homo sapiens
7862188   8847002990   Mus musculus
1999711   6281285883   Rattus norvegicus
2179593   5352760300   Bos taurus
3889893   5033561304   Zea mays
3217154   4776701267   Sus scrofa
1696465   3054657865   Danio rerio
228209    1352880670   Strongylocentrotus purpuratus
1241595   1195506571   Oryza sativa Japonica Group
1753640   1185627167   Nicotiana tabacum
1423616   1146930228   Xenopus (Silurana) tropicalis
1205099   1042841876   Drosophila melanogaster
213529     999379905   Pan troglodytes
2284063    991848716   Arabidopsis thaliana
1435080    932160671   Canis lupus familiaris
655949     911073261   Vitis vinifera
808152     888087954   Gallus gallus
1840572    864854845   Glycine max
79205      813082013   Macaca mulatta
1216189    748184685   Ciona intestinalis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          February 15 2010

                NCBI-GenBank Flat File Release 176.0

                        Bacterial Sequences (Part 1)

   25389 loci,   102437874 bases, from    25389 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 176.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,	Gert Roosen,
	Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Wayne Matten, Scott McGinnis, Steve Pechous, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center