Release Notes For GenBank Release 179

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2010

               NCBI-GenBank Flat File Release 179.0

                    Distribution Release Notes

 122941883 loci, 117476523128 bases, from 122941883 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 179.0
1.2 Cutoff Date
1.3 Important Changes in Release 179.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 179.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 179.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 179.0, incorporates data available to the collaborating
databases as of August 16, 2010 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 179.0

1.3.1 Organizational changes

The total number of sequence data files increased by 15 with this release:

  - the BCT division is now composed of  59 files (+2)
  - the CON division is now composed of 140 files (+3)
  - the ENV division is now composed of  29 files (+2)
  - the EST division is now composed of 419 files (+6)
  - the GSS division is now composed of 215 files (+3)
  - the HTG division is now composed of 135 files (+1)
  - the INV division is now composed of  24 files (+3)
  - the PAT division is now composed of 121 files (+2)
  - the ROD division is now composed of  29 files (+1)
  - the TSA division is now composed of   8 files (+3)
  - the VRL division is now composed of  15 files (+1)

The total number of 'index' files increased by 1 with this release:

  - the AUT (author name) index is now composed of 75 files (+1)

1.3.2 Molecule type for non-coding RNAs on the LOCUS line

  The ncRNA feature was introduced in October 2007 (Release 162.) to
accomodate the growing number of regulatory non-coding RNAs that are
being discovered. 

  And as described in the October 2008 release notes for Release 168.0 ,
records that represent non-coding RNA molecules (as opposed to ncRNA
features annotated on genomic DNA), have these characteristics:

        an ncRNA feature, with an /ncRNA_class qualifier of the
	appropriate type, spanning the entire length of the sequence

        a source feature with /mol_type of "transcribed RNA"

  The domain of possible LOCUS-line molecule type values has now
been reduced to reflect our new approach to ncRNA annotation. Values
'snRNA', 'snoRNA', and 'scRNA' have all been replaced by 'RNA'.

  Although this is not a GenBank flatfile format change per-se, it
certainly could affect those who have been using the LOCUS line to
identify small nuclear RNAs, small nucleolar RNAs, and small cytoplasmic
RNAs. Please be aware that the discontinued LOCUS-line molecule types
are three of *many* possible non-coding RNA types, so an analysis of
ncRNA feature content is required if one is interested in ncRNAs.

1.3.3 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
ninety-three of the GSS flatfiles in Release 179.0. Consider gbgss123.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                          August 15 2010

                NCBI-GenBank Flat File Release 179.0

                           GSS Sequences (Part 1)

   87143 loci,    64110475 bases, from    87143 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "123" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

  A variety of changes affecting the GenBank flatfile format will be
implemented in October 2010, as a result of discussions among DDBJ, EBI,
and NCBI at the May 2010 International Nucleotide Sequence Database
Collaboration annual meeting. Full details of the changes will be made
available after the minutes have been finalized, but in the meantime
we can provide a brief summary:

* /artificial_location will become a controlled-vocabulary qualifier,
  with values of "heterogenous population sequenced" and
  "low-quality sequence region".

* The /codon qualifier will be discontinued, in favor of /transl_except .

* The /partial qualifier will be discontinued, given that 5' and 3'
  partiality can be indicated via a feature's location ('<' and '>').

* The /label qualifier will be discontinued.

* The conflict feature will be discontinued, with existing instances
  converted to to misc_difference features.

* A new mobile_element feature, with a /mobile_element_type qualifier,
  will be introduced for the annotation of gene cassettes, transposons,
  and insertion sequences.  Existing repeat_region features, with
  /mobile_element qualifiers, will be converted to mobile_element features.
  The /mobile_element qualifier will then be discontinued.

* A classification system will be introduced for the /inference and
  /experiment qualifiers, such that the inferential or experimental
  information can be associated with a feature's existence, location,
  or description.

* A /whole_replicon qualifier will be introduced, allowing records
  which represent the entirety of a replicon (a chromosome; an organelle;
  a mitochondrial plasmid) to be identified as such.
  
1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1443 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut8.idx - Index of the entries according to author name, part 8.
78. gbaut9.idx - Index of the entries according to author name, part 9.
79. gbbct1.seq - Bacterial sequence entries, part 1.
80. gbbct10.seq - Bacterial sequence entries, part 10.
81. gbbct11.seq - Bacterial sequence entries, part 11.
82. gbbct12.seq - Bacterial sequence entries, part 12.
83. gbbct13.seq - Bacterial sequence entries, part 13.
84. gbbct14.seq - Bacterial sequence entries, part 14.
85. gbbct15.seq - Bacterial sequence entries, part 15.
86. gbbct16.seq - Bacterial sequence entries, part 16.
87. gbbct17.seq - Bacterial sequence entries, part 17.
88. gbbct18.seq - Bacterial sequence entries, part 18.
89. gbbct19.seq - Bacterial sequence entries, part 19.
90. gbbct2.seq - Bacterial sequence entries, part 2.
91. gbbct20.seq - Bacterial sequence entries, part 20.
92. gbbct21.seq - Bacterial sequence entries, part 21.
93. gbbct22.seq - Bacterial sequence entries, part 22.
94. gbbct23.seq - Bacterial sequence entries, part 23.
95. gbbct24.seq - Bacterial sequence entries, part 24.
96. gbbct25.seq - Bacterial sequence entries, part 25.
97. gbbct26.seq - Bacterial sequence entries, part 26.
98. gbbct27.seq - Bacterial sequence entries, part 27.
99. gbbct28.seq - Bacterial sequence entries, part 28.
100. gbbct29.seq - Bacterial sequence entries, part 29.
101. gbbct3.seq - Bacterial sequence entries, part 3.
102. gbbct30.seq - Bacterial sequence entries, part 30.
103. gbbct31.seq - Bacterial sequence entries, part 31.
104. gbbct32.seq - Bacterial sequence entries, part 32.
105. gbbct33.seq - Bacterial sequence entries, part 33.
106. gbbct34.seq - Bacterial sequence entries, part 34.
107. gbbct35.seq - Bacterial sequence entries, part 35.
108. gbbct36.seq - Bacterial sequence entries, part 36.
109. gbbct37.seq - Bacterial sequence entries, part 37.
110. gbbct38.seq - Bacterial sequence entries, part 38.
111. gbbct39.seq - Bacterial sequence entries, part 39.
112. gbbct4.seq - Bacterial sequence entries, part 4.
113. gbbct40.seq - Bacterial sequence entries, part 40.
114. gbbct41.seq - Bacterial sequence entries, part 41.
115. gbbct42.seq - Bacterial sequence entries, part 42.
116. gbbct43.seq - Bacterial sequence entries, part 43.
117. gbbct44.seq - Bacterial sequence entries, part 44.
118. gbbct45.seq - Bacterial sequence entries, part 45.
119. gbbct46.seq - Bacterial sequence entries, part 46.
120. gbbct47.seq - Bacterial sequence entries, part 47.
121. gbbct48.seq - Bacterial sequence entries, part 48.
122. gbbct49.seq - Bacterial sequence entries, part 49.
123. gbbct5.seq - Bacterial sequence entries, part 5.
124. gbbct50.seq - Bacterial sequence entries, part 50.
125. gbbct51.seq - Bacterial sequence entries, part 51.
126. gbbct52.seq - Bacterial sequence entries, part 52.
127. gbbct53.seq - Bacterial sequence entries, part 53.
128. gbbct54.seq - Bacterial sequence entries, part 54.
129. gbbct55.seq - Bacterial sequence entries, part 55.
130. gbbct56.seq - Bacterial sequence entries, part 56.
131. gbbct57.seq - Bacterial sequence entries, part 57.
132. gbbct58.seq - Bacterial sequence entries, part 58.
133. gbbct59.seq - Bacterial sequence entries, part 59.
134. gbbct6.seq - Bacterial sequence entries, part 6.
135. gbbct7.seq - Bacterial sequence entries, part 7.
136. gbbct8.seq - Bacterial sequence entries, part 8.
137. gbbct9.seq - Bacterial sequence entries, part 9.
138. gbchg.txt - Accession numbers of entries updated since the previous release.
139. gbcon1.seq - Constructed sequence entries, part 1.
140. gbcon10.seq - Constructed sequence entries, part 10.
141. gbcon100.seq - Constructed sequence entries, part 100.
142. gbcon101.seq - Constructed sequence entries, part 101.
143. gbcon102.seq - Constructed sequence entries, part 102.
144. gbcon103.seq - Constructed sequence entries, part 103.
145. gbcon104.seq - Constructed sequence entries, part 104.
146. gbcon105.seq - Constructed sequence entries, part 105.
147. gbcon106.seq - Constructed sequence entries, part 106.
148. gbcon107.seq - Constructed sequence entries, part 107.
149. gbcon108.seq - Constructed sequence entries, part 108.
150. gbcon109.seq - Constructed sequence entries, part 109.
151. gbcon11.seq - Constructed sequence entries, part 11.
152. gbcon110.seq - Constructed sequence entries, part 110.
153. gbcon111.seq - Constructed sequence entries, part 111.
154. gbcon112.seq - Constructed sequence entries, part 112.
155. gbcon113.seq - Constructed sequence entries, part 113.
156. gbcon114.seq - Constructed sequence entries, part 114.
157. gbcon115.seq - Constructed sequence entries, part 115.
158. gbcon116.seq - Constructed sequence entries, part 116.
159. gbcon117.seq - Constructed sequence entries, part 117.
160. gbcon118.seq - Constructed sequence entries, part 118.
161. gbcon119.seq - Constructed sequence entries, part 119.
162. gbcon12.seq - Constructed sequence entries, part 12.
163. gbcon120.seq - Constructed sequence entries, part 120.
164. gbcon121.seq - Constructed sequence entries, part 121.
165. gbcon122.seq - Constructed sequence entries, part 122.
166. gbcon123.seq - Constructed sequence entries, part 123.
167. gbcon124.seq - Constructed sequence entries, part 124.
168. gbcon125.seq - Constructed sequence entries, part 125.
169. gbcon126.seq - Constructed sequence entries, part 126.
170. gbcon127.seq - Constructed sequence entries, part 127.
171. gbcon128.seq - Constructed sequence entries, part 128.
172. gbcon129.seq - Constructed sequence entries, part 129.
173. gbcon13.seq - Constructed sequence entries, part 13.
174. gbcon130.seq - Constructed sequence entries, part 130.
175. gbcon131.seq - Constructed sequence entries, part 131.
176. gbcon132.seq - Constructed sequence entries, part 132.
177. gbcon133.seq - Constructed sequence entries, part 133.
178. gbcon134.seq - Constructed sequence entries, part 134.
179. gbcon135.seq - Constructed sequence entries, part 135.
180. gbcon136.seq - Constructed sequence entries, part 136.
181. gbcon137.seq - Constructed sequence entries, part 137.
182. gbcon138.seq - Constructed sequence entries, part 138.
183. gbcon139.seq - Constructed sequence entries, part 139.
184. gbcon14.seq - Constructed sequence entries, part 14.
185. gbcon140.seq - Constructed sequence entries, part 140.
186. gbcon15.seq - Constructed sequence entries, part 15.
187. gbcon16.seq - Constructed sequence entries, part 16.
188. gbcon17.seq - Constructed sequence entries, part 17.
189. gbcon18.seq - Constructed sequence entries, part 18.
190. gbcon19.seq - Constructed sequence entries, part 19.
191. gbcon2.seq - Constructed sequence entries, part 2.
192. gbcon20.seq - Constructed sequence entries, part 20.
193. gbcon21.seq - Constructed sequence entries, part 21.
194. gbcon22.seq - Constructed sequence entries, part 22.
195. gbcon23.seq - Constructed sequence entries, part 23.
196. gbcon24.seq - Constructed sequence entries, part 24.
197. gbcon25.seq - Constructed sequence entries, part 25.
198. gbcon26.seq - Constructed sequence entries, part 26.
199. gbcon27.seq - Constructed sequence entries, part 27.
200. gbcon28.seq - Constructed sequence entries, part 28.
201. gbcon29.seq - Constructed sequence entries, part 29.
202. gbcon3.seq - Constructed sequence entries, part 3.
203. gbcon30.seq - Constructed sequence entries, part 30.
204. gbcon31.seq - Constructed sequence entries, part 31.
205. gbcon32.seq - Constructed sequence entries, part 32.
206. gbcon33.seq - Constructed sequence entries, part 33.
207. gbcon34.seq - Constructed sequence entries, part 34.
208. gbcon35.seq - Constructed sequence entries, part 35.
209. gbcon36.seq - Constructed sequence entries, part 36.
210. gbcon37.seq - Constructed sequence entries, part 37.
211. gbcon38.seq - Constructed sequence entries, part 38.
212. gbcon39.seq - Constructed sequence entries, part 39.
213. gbcon4.seq - Constructed sequence entries, part 4.
214. gbcon40.seq - Constructed sequence entries, part 40.
215. gbcon41.seq - Constructed sequence entries, part 41.
216. gbcon42.seq - Constructed sequence entries, part 42.
217. gbcon43.seq - Constructed sequence entries, part 43.
218. gbcon44.seq - Constructed sequence entries, part 44.
219. gbcon45.seq - Constructed sequence entries, part 45.
220. gbcon46.seq - Constructed sequence entries, part 46.
221. gbcon47.seq - Constructed sequence entries, part 47.
222. gbcon48.seq - Constructed sequence entries, part 48.
223. gbcon49.seq - Constructed sequence entries, part 49.
224. gbcon5.seq - Constructed sequence entries, part 5.
225. gbcon50.seq - Constructed sequence entries, part 50.
226. gbcon51.seq - Constructed sequence entries, part 51.
227. gbcon52.seq - Constructed sequence entries, part 52.
228. gbcon53.seq - Constructed sequence entries, part 53.
229. gbcon54.seq - Constructed sequence entries, part 54.
230. gbcon55.seq - Constructed sequence entries, part 55.
231. gbcon56.seq - Constructed sequence entries, part 56.
232. gbcon57.seq - Constructed sequence entries, part 57.
233. gbcon58.seq - Constructed sequence entries, part 58.
234. gbcon59.seq - Constructed sequence entries, part 59.
235. gbcon6.seq - Constructed sequence entries, part 6.
236. gbcon60.seq - Constructed sequence entries, part 60.
237. gbcon61.seq - Constructed sequence entries, part 61.
238. gbcon62.seq - Constructed sequence entries, part 62.
239. gbcon63.seq - Constructed sequence entries, part 63.
240. gbcon64.seq - Constructed sequence entries, part 64.
241. gbcon65.seq - Constructed sequence entries, part 65.
242. gbcon66.seq - Constructed sequence entries, part 66.
243. gbcon67.seq - Constructed sequence entries, part 67.
244. gbcon68.seq - Constructed sequence entries, part 68.
245. gbcon69.seq - Constructed sequence entries, part 69.
246. gbcon7.seq - Constructed sequence entries, part 7.
247. gbcon70.seq - Constructed sequence entries, part 70.
248. gbcon71.seq - Constructed sequence entries, part 71.
249. gbcon72.seq - Constructed sequence entries, part 72.
250. gbcon73.seq - Constructed sequence entries, part 73.
251. gbcon74.seq - Constructed sequence entries, part 74.
252. gbcon75.seq - Constructed sequence entries, part 75.
253. gbcon76.seq - Constructed sequence entries, part 76.
254. gbcon77.seq - Constructed sequence entries, part 77.
255. gbcon78.seq - Constructed sequence entries, part 78.
256. gbcon79.seq - Constructed sequence entries, part 79.
257. gbcon8.seq - Constructed sequence entries, part 8.
258. gbcon80.seq - Constructed sequence entries, part 80.
259. gbcon81.seq - Constructed sequence entries, part 81.
260. gbcon82.seq - Constructed sequence entries, part 82.
261. gbcon83.seq - Constructed sequence entries, part 83.
262. gbcon84.seq - Constructed sequence entries, part 84.
263. gbcon85.seq - Constructed sequence entries, part 85.
264. gbcon86.seq - Constructed sequence entries, part 86.
265. gbcon87.seq - Constructed sequence entries, part 87.
266. gbcon88.seq - Constructed sequence entries, part 88.
267. gbcon89.seq - Constructed sequence entries, part 89.
268. gbcon9.seq - Constructed sequence entries, part 9.
269. gbcon90.seq - Constructed sequence entries, part 90.
270. gbcon91.seq - Constructed sequence entries, part 91.
271. gbcon92.seq - Constructed sequence entries, part 92.
272. gbcon93.seq - Constructed sequence entries, part 93.
273. gbcon94.seq - Constructed sequence entries, part 94.
274. gbcon95.seq - Constructed sequence entries, part 95.
275. gbcon96.seq - Constructed sequence entries, part 96.
276. gbcon97.seq - Constructed sequence entries, part 97.
277. gbcon98.seq - Constructed sequence entries, part 98.
278. gbcon99.seq - Constructed sequence entries, part 99.
279. gbdel.txt - Accession numbers of entries deleted since the previous release.
280. gbenv1.seq - Environmental sampling sequence entries, part 1.
281. gbenv10.seq - Environmental sampling sequence entries, part 10.
282. gbenv11.seq - Environmental sampling sequence entries, part 11.
283. gbenv12.seq - Environmental sampling sequence entries, part 12.
284. gbenv13.seq - Environmental sampling sequence entries, part 13.
285. gbenv14.seq - Environmental sampling sequence entries, part 14.
286. gbenv15.seq - Environmental sampling sequence entries, part 15.
287. gbenv16.seq - Environmental sampling sequence entries, part 16.
288. gbenv17.seq - Environmental sampling sequence entries, part 17.
289. gbenv18.seq - Environmental sampling sequence entries, part 18.
290. gbenv19.seq - Environmental sampling sequence entries, part 19.
291. gbenv2.seq - Environmental sampling sequence entries, part 2.
292. gbenv20.seq - Environmental sampling sequence entries, part 20.
293. gbenv21.seq - Environmental sampling sequence entries, part 21.
294. gbenv22.seq - Environmental sampling sequence entries, part 22.
295. gbenv23.seq - Environmental sampling sequence entries, part 23.
296. gbenv24.seq - Environmental sampling sequence entries, part 24.
297. gbenv25.seq - Environmental sampling sequence entries, part 25.
298. gbenv26.seq - Environmental sampling sequence entries, part 26.
299. gbenv27.seq - Environmental sampling sequence entries, part 27.
300. gbenv28.seq - Environmental sampling sequence entries, part 28.
301. gbenv29.seq - Environmental sampling sequence entries, part 29.
302. gbenv3.seq - Environmental sampling sequence entries, part 3.
303. gbenv4.seq - Environmental sampling sequence entries, part 4.
304. gbenv5.seq - Environmental sampling sequence entries, part 5.
305. gbenv6.seq - Environmental sampling sequence entries, part 6.
306. gbenv7.seq - Environmental sampling sequence entries, part 7.
307. gbenv8.seq - Environmental sampling sequence entries, part 8.
308. gbenv9.seq - Environmental sampling sequence entries, part 9.
309. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
310. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
311. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
312. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
313. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
314. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
315. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
316. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
317. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
318. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
319. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
320. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
321. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
322. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
323. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
324. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
325. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
326. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
327. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
328. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
329. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
330. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
331. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
332. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
333. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
334. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
335. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
336. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
337. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
338. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
339. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
340. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
341. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
342. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
343. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
344. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
345. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
346. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
347. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
348. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
349. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
350. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
351. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
352. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
353. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
354. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
355. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
356. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
357. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
358. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
359. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
360. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
361. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
362. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
363. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
364. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
365. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
366. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
367. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
368. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
369. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
370. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
371. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
372. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
373. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
374. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
375. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
376. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
377. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
378. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
379. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
380. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
381. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
382. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
383. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
384. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
385. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
386. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
387. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
388. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
389. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
390. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
391. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
392. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
393. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
394. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
395. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
396. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
397. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
398. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
399. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
400. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
401. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
402. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
403. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
404. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
405. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
406. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
407. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
408. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
409. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
410. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
411. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
412. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
413. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
414. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
415. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
416. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
417. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
418. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
419. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
420. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
421. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
422. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
423. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
424. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
425. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
426. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
427. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
428. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
429. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
430. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
431. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
432. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
433. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
434. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
435. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
436. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
437. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
438. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
439. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
440. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
441. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
442. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
443. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
444. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
445. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
446. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
447. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
448. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
449. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
450. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
451. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
452. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
453. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
454. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
455. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
456. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
457. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
458. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
459. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
460. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
461. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
462. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
463. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
464. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
465. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
466. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
467. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
468. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
469. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
470. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
471. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
472. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
473. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
474. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
475. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
476. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
477. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
478. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
479. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
480. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
481. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
482. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
483. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
484. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
485. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
486. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
487. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
488. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
489. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
490. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
491. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
492. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
493. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
494. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
495. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
496. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
497. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
498. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
499. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
500. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
501. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
502. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
503. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
504. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
505. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
506. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
507. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
508. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
509. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
510. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
511. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
512. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
513. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
514. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
515. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
516. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
517. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
518. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
519. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
520. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
521. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
522. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
523. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
524. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
525. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
526. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
527. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
528. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
529. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
530. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
531. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
532. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
533. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
534. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
535. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
536. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
537. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
538. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
539. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
540. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
541. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
542. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
543. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
544. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
545. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
546. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
547. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
548. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
549. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
550. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
551. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
552. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
553. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
554. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
555. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
556. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
557. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
558. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
559. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
560. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
561. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
562. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
563. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
564. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
565. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
566. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
567. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
568. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
569. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
570. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
571. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
572. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
573. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
574. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
575. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
576. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
577. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
578. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
579. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
580. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
581. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
582. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
583. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
584. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
585. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
586. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
587. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
588. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
589. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
590. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
591. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
592. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
593. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
594. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
595. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
596. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
597. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
598. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
599. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
600. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
601. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
602. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
603. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
604. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
605. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
606. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
607. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
608. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
609. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
610. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
611. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
612. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
613. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
614. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
615. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
616. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
617. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
618. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
619. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
620. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
621. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
622. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
623. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
624. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
625. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
626. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
627. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
628. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
629. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
630. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
631. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
632. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
633. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
634. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
635. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
636. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
637. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
638. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
639. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
640. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
641. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
642. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
643. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
644. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
645. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
646. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
647. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
648. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
649. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
650. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
651. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
652. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
653. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
654. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
655. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
656. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
657. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
658. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
659. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
660. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
661. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
662. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
663. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
664. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
665. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
666. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
667. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
668. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
669. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
670. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
671. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
672. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
673. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
674. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
675. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
676. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
677. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
678. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
679. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
680. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
681. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
682. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
683. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
684. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
685. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
686. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
687. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
688. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
689. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
690. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
691. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
692. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
693. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
694. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
695. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
696. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
697. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
698. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
699. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
700. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
701. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
702. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
703. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
704. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
705. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
706. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
707. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
708. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
709. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
710. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
711. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
712. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
713. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
714. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
715. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
716. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
717. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
718. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
719. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
720. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
721. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
722. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
723. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
724. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
725. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
726. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
727. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
728. gbgen.idx - Index of the entries according to gene symbols.
729. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
730. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
731. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
732. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
733. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
734. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
735. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
736. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
737. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
738. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
739. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
740. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
741. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
742. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
743. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
744. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
745. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
746. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
747. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
748. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
749. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
750. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
751. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
752. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
753. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
754. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
755. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
756. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
757. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
758. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
759. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
760. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
761. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
762. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
763. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
764. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
765. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
766. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
767. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
768. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
769. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
770. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
771. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
772. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
773. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
774. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
775. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
776. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
777. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
778. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
779. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
780. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
781. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
782. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
783. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
784. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
785. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
786. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
787. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
788. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
789. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
790. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
791. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
792. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
793. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
794. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
795. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
796. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
797. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
798. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
799. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
800. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
801. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
802. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
803. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
804. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
805. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
806. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
807. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
808. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
809. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
810. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
811. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
812. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
813. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
814. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
815. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
816. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
817. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
818. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
819. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
820. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
821. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
822. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
823. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
824. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
825. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
826. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
827. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
828. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
829. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
830. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
831. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
832. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
833. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
834. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
835. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
836. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
837. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
838. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
839. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
840. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
841. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
842. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
843. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
844. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
845. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
846. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
847. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
848. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
849. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
850. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
851. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
852. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
853. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
854. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
855. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
856. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
857. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
858. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
859. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
860. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
861. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
862. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
863. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
864. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
865. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
866. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
867. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
868. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
869. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
870. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
871. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
872. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
873. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
874. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
875. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
876. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
877. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
878. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
879. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
880. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
881. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
882. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
883. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
884. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
885. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
886. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
887. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
888. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
889. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
890. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
891. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
892. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
893. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
894. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
895. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
896. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
897. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
898. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
899. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
900. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
901. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
902. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
903. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
904. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
905. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
906. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
907. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
908. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
909. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
910. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
911. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
912. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
913. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
914. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
915. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
916. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
917. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
918. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
919. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
920. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
921. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
922. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
923. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
924. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
925. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
926. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
927. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
928. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
929. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
930. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
931. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
932. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
933. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
934. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
935. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
936. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
937. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
938. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
939. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
940. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
941. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
942. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
943. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
944. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
945. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
946. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
947. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
948. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
949. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
950. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
951. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
952. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
953. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
954. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
955. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
956. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
957. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
958. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
959. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
960. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
961. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
962. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
963. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
964. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
965. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
966. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
967. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
968. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
969. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
970. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
971. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
972. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
973. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
974. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
975. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
976. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
977. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
978. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
979. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
980. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
981. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
982. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
983. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
984. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
985. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
986. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
987. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
988. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
989. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
990. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
991. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
992. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
993. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
994. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
995. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
996. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
997. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
998. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
999. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1000. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1001. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1002. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1003. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1004. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1005. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1006. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1007. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1008. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1009. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1010. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1011. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1012. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1013. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1014. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1015. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1016. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1017. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1018. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1019. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1020. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1021. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1022. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1023. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1024. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1025. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1026. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1027. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1028. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1029. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1030. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1031. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1032. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1033. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1034. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1035. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1036. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1037. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1038. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1039. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1040. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1041. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1042. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1043. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1044. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1045. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1046. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1047. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1048. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1049. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1050. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1051. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1052. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1053. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1054. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1055. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1056. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1057. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1058. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1059. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1060. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1061. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1062. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1063. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1064. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1065. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1066. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1067. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1068. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1069. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1070. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1071. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1072. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1073. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1074. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1075. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1076. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1077. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1078. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1079. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1080. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1081. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1082. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1083. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1084. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1085. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1086. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1087. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1088. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1089. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1090. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1091. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1092. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1093. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1094. gbinv1.seq - Invertebrate sequence entries, part 1.
1095. gbinv10.seq - Invertebrate sequence entries, part 10.
1096. gbinv11.seq - Invertebrate sequence entries, part 11.
1097. gbinv12.seq - Invertebrate sequence entries, part 12.
1098. gbinv13.seq - Invertebrate sequence entries, part 13.
1099. gbinv14.seq - Invertebrate sequence entries, part 14.
1100. gbinv15.seq - Invertebrate sequence entries, part 15.
1101. gbinv16.seq - Invertebrate sequence entries, part 16.
1102. gbinv17.seq - Invertebrate sequence entries, part 17.
1103. gbinv18.seq - Invertebrate sequence entries, part 18.
1104. gbinv19.seq - Invertebrate sequence entries, part 19.
1105. gbinv2.seq - Invertebrate sequence entries, part 2.
1106. gbinv20.seq - Invertebrate sequence entries, part 20.
1107. gbinv21.seq - Invertebrate sequence entries, part 21.
1108. gbinv22.seq - Invertebrate sequence entries, part 22.
1109. gbinv23.seq - Invertebrate sequence entries, part 23.
1110. gbinv24.seq - Invertebrate sequence entries, part 24.
1111. gbinv3.seq - Invertebrate sequence entries, part 3.
1112. gbinv4.seq - Invertebrate sequence entries, part 4.
1113. gbinv5.seq - Invertebrate sequence entries, part 5.
1114. gbinv6.seq - Invertebrate sequence entries, part 6.
1115. gbinv7.seq - Invertebrate sequence entries, part 7.
1116. gbinv8.seq - Invertebrate sequence entries, part 8.
1117. gbinv9.seq - Invertebrate sequence entries, part 9.
1118. gbjou1.idx - Index of the entries according to journal citation, part 1.
1119. gbjou2.idx - Index of the entries according to journal citation, part 2.
1120. gbjou3.idx - Index of the entries according to journal citation, part 3.
1121. gbjou4.idx - Index of the entries according to journal citation, part 4.
1122. gbjou5.idx - Index of the entries according to journal citation, part 5.
1123. gbjou6.idx - Index of the entries according to journal citation, part 6.
1124. gbjou7.idx - Index of the entries according to journal citation, part 7.
1125. gbjou8.idx - Index of the entries according to journal citation, part 8.
1126. gbjou9.idx - Index of the entries according to journal citation, part 9.
1127. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1128. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1129. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1130. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1131. gbmam1.seq - Other mammalian sequence entries, part 1.
1132. gbmam2.seq - Other mammalian sequence entries, part 2.
1133. gbmam3.seq - Other mammalian sequence entries, part 3.
1134. gbmam4.seq - Other mammalian sequence entries, part 4.
1135. gbmam5.seq - Other mammalian sequence entries, part 5.
1136. gbmam6.seq - Other mammalian sequence entries, part 6.
1137. gbnew.txt - Accession numbers of entries new since the previous release.
1138. gbpat1.seq - Patent sequence entries, part 1.
1139. gbpat10.seq - Patent sequence entries, part 10.
1140. gbpat100.seq - Patent sequence entries, part 100.
1141. gbpat101.seq - Patent sequence entries, part 101.
1142. gbpat102.seq - Patent sequence entries, part 102.
1143. gbpat103.seq - Patent sequence entries, part 103.
1144. gbpat104.seq - Patent sequence entries, part 104.
1145. gbpat105.seq - Patent sequence entries, part 105.
1146. gbpat106.seq - Patent sequence entries, part 106.
1147. gbpat107.seq - Patent sequence entries, part 107.
1148. gbpat108.seq - Patent sequence entries, part 108.
1149. gbpat109.seq - Patent sequence entries, part 109.
1150. gbpat11.seq - Patent sequence entries, part 11.
1151. gbpat110.seq - Patent sequence entries, part 110.
1152. gbpat111.seq - Patent sequence entries, part 111.
1153. gbpat112.seq - Patent sequence entries, part 112.
1154. gbpat113.seq - Patent sequence entries, part 113.
1155. gbpat114.seq - Patent sequence entries, part 114.
1156. gbpat115.seq - Patent sequence entries, part 115.
1157. gbpat116.seq - Patent sequence entries, part 116.
1158. gbpat117.seq - Patent sequence entries, part 117.
1159. gbpat118.seq - Patent sequence entries, part 118.
1160. gbpat119.seq - Patent sequence entries, part 119.
1161. gbpat12.seq - Patent sequence entries, part 12.
1162. gbpat120.seq - Patent sequence entries, part 120.
1163. gbpat121.seq - Patent sequence entries, part 121.
1164. gbpat13.seq - Patent sequence entries, part 13.
1165. gbpat14.seq - Patent sequence entries, part 14.
1166. gbpat15.seq - Patent sequence entries, part 15.
1167. gbpat16.seq - Patent sequence entries, part 16.
1168. gbpat17.seq - Patent sequence entries, part 17.
1169. gbpat18.seq - Patent sequence entries, part 18.
1170. gbpat19.seq - Patent sequence entries, part 19.
1171. gbpat2.seq - Patent sequence entries, part 2.
1172. gbpat20.seq - Patent sequence entries, part 20.
1173. gbpat21.seq - Patent sequence entries, part 21.
1174. gbpat22.seq - Patent sequence entries, part 22.
1175. gbpat23.seq - Patent sequence entries, part 23.
1176. gbpat24.seq - Patent sequence entries, part 24.
1177. gbpat25.seq - Patent sequence entries, part 25.
1178. gbpat26.seq - Patent sequence entries, part 26.
1179. gbpat27.seq - Patent sequence entries, part 27.
1180. gbpat28.seq - Patent sequence entries, part 28.
1181. gbpat29.seq - Patent sequence entries, part 29.
1182. gbpat3.seq - Patent sequence entries, part 3.
1183. gbpat30.seq - Patent sequence entries, part 30.
1184. gbpat31.seq - Patent sequence entries, part 31.
1185. gbpat32.seq - Patent sequence entries, part 32.
1186. gbpat33.seq - Patent sequence entries, part 33.
1187. gbpat34.seq - Patent sequence entries, part 34.
1188. gbpat35.seq - Patent sequence entries, part 35.
1189. gbpat36.seq - Patent sequence entries, part 36.
1190. gbpat37.seq - Patent sequence entries, part 37.
1191. gbpat38.seq - Patent sequence entries, part 38.
1192. gbpat39.seq - Patent sequence entries, part 39.
1193. gbpat4.seq - Patent sequence entries, part 4.
1194. gbpat40.seq - Patent sequence entries, part 40.
1195. gbpat41.seq - Patent sequence entries, part 41.
1196. gbpat42.seq - Patent sequence entries, part 42.
1197. gbpat43.seq - Patent sequence entries, part 43.
1198. gbpat44.seq - Patent sequence entries, part 44.
1199. gbpat45.seq - Patent sequence entries, part 45.
1200. gbpat46.seq - Patent sequence entries, part 46.
1201. gbpat47.seq - Patent sequence entries, part 47.
1202. gbpat48.seq - Patent sequence entries, part 48.
1203. gbpat49.seq - Patent sequence entries, part 49.
1204. gbpat5.seq - Patent sequence entries, part 5.
1205. gbpat50.seq - Patent sequence entries, part 50.
1206. gbpat51.seq - Patent sequence entries, part 51.
1207. gbpat52.seq - Patent sequence entries, part 52.
1208. gbpat53.seq - Patent sequence entries, part 53.
1209. gbpat54.seq - Patent sequence entries, part 54.
1210. gbpat55.seq - Patent sequence entries, part 55.
1211. gbpat56.seq - Patent sequence entries, part 56.
1212. gbpat57.seq - Patent sequence entries, part 57.
1213. gbpat58.seq - Patent sequence entries, part 58.
1214. gbpat59.seq - Patent sequence entries, part 59.
1215. gbpat6.seq - Patent sequence entries, part 6.
1216. gbpat60.seq - Patent sequence entries, part 60.
1217. gbpat61.seq - Patent sequence entries, part 61.
1218. gbpat62.seq - Patent sequence entries, part 62.
1219. gbpat63.seq - Patent sequence entries, part 63.
1220. gbpat64.seq - Patent sequence entries, part 64.
1221. gbpat65.seq - Patent sequence entries, part 65.
1222. gbpat66.seq - Patent sequence entries, part 66.
1223. gbpat67.seq - Patent sequence entries, part 67.
1224. gbpat68.seq - Patent sequence entries, part 68.
1225. gbpat69.seq - Patent sequence entries, part 69.
1226. gbpat7.seq - Patent sequence entries, part 7.
1227. gbpat70.seq - Patent sequence entries, part 70.
1228. gbpat71.seq - Patent sequence entries, part 71.
1229. gbpat72.seq - Patent sequence entries, part 72.
1230. gbpat73.seq - Patent sequence entries, part 73.
1231. gbpat74.seq - Patent sequence entries, part 74.
1232. gbpat75.seq - Patent sequence entries, part 75.
1233. gbpat76.seq - Patent sequence entries, part 76.
1234. gbpat77.seq - Patent sequence entries, part 77.
1235. gbpat78.seq - Patent sequence entries, part 78.
1236. gbpat79.seq - Patent sequence entries, part 79.
1237. gbpat8.seq - Patent sequence entries, part 8.
1238. gbpat80.seq - Patent sequence entries, part 80.
1239. gbpat81.seq - Patent sequence entries, part 81.
1240. gbpat82.seq - Patent sequence entries, part 82.
1241. gbpat83.seq - Patent sequence entries, part 83.
1242. gbpat84.seq - Patent sequence entries, part 84.
1243. gbpat85.seq - Patent sequence entries, part 85.
1244. gbpat86.seq - Patent sequence entries, part 86.
1245. gbpat87.seq - Patent sequence entries, part 87.
1246. gbpat88.seq - Patent sequence entries, part 88.
1247. gbpat89.seq - Patent sequence entries, part 89.
1248. gbpat9.seq - Patent sequence entries, part 9.
1249. gbpat90.seq - Patent sequence entries, part 90.
1250. gbpat91.seq - Patent sequence entries, part 91.
1251. gbpat92.seq - Patent sequence entries, part 92.
1252. gbpat93.seq - Patent sequence entries, part 93.
1253. gbpat94.seq - Patent sequence entries, part 94.
1254. gbpat95.seq - Patent sequence entries, part 95.
1255. gbpat96.seq - Patent sequence entries, part 96.
1256. gbpat97.seq - Patent sequence entries, part 97.
1257. gbpat98.seq - Patent sequence entries, part 98.
1258. gbpat99.seq - Patent sequence entries, part 99.
1259. gbphg1.seq - Phage sequence entries, part 1.
1260. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1261. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1262. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1263. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1264. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1265. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1266. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1267. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1268. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1269. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1270. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1271. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1272. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1273. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1274. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1275. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1276. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1277. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1278. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1279. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1280. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1281. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1282. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1283. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1284. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1285. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1286. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1287. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1288. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1289. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1290. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1291. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1292. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1293. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1294. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1295. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1296. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1297. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1298. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1299. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1300. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1301. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1302. gbpri1.seq - Primate sequence entries, part 1.
1303. gbpri10.seq - Primate sequence entries, part 10.
1304. gbpri11.seq - Primate sequence entries, part 11.
1305. gbpri12.seq - Primate sequence entries, part 12.
1306. gbpri13.seq - Primate sequence entries, part 13.
1307. gbpri14.seq - Primate sequence entries, part 14.
1308. gbpri15.seq - Primate sequence entries, part 15.
1309. gbpri16.seq - Primate sequence entries, part 16.
1310. gbpri17.seq - Primate sequence entries, part 17.
1311. gbpri18.seq - Primate sequence entries, part 18.
1312. gbpri19.seq - Primate sequence entries, part 19.
1313. gbpri2.seq - Primate sequence entries, part 2.
1314. gbpri20.seq - Primate sequence entries, part 20.
1315. gbpri21.seq - Primate sequence entries, part 21.
1316. gbpri22.seq - Primate sequence entries, part 22.
1317. gbpri23.seq - Primate sequence entries, part 23.
1318. gbpri24.seq - Primate sequence entries, part 24.
1319. gbpri25.seq - Primate sequence entries, part 25.
1320. gbpri26.seq - Primate sequence entries, part 26.
1321. gbpri27.seq - Primate sequence entries, part 27.
1322. gbpri28.seq - Primate sequence entries, part 28.
1323. gbpri29.seq - Primate sequence entries, part 29.
1324. gbpri3.seq - Primate sequence entries, part 3.
1325. gbpri30.seq - Primate sequence entries, part 30.
1326. gbpri31.seq - Primate sequence entries, part 31.
1327. gbpri32.seq - Primate sequence entries, part 32.
1328. gbpri33.seq - Primate sequence entries, part 33.
1329. gbpri34.seq - Primate sequence entries, part 34.
1330. gbpri35.seq - Primate sequence entries, part 35.
1331. gbpri36.seq - Primate sequence entries, part 36.
1332. gbpri37.seq - Primate sequence entries, part 37.
1333. gbpri38.seq - Primate sequence entries, part 38.
1334. gbpri39.seq - Primate sequence entries, part 39.
1335. gbpri4.seq - Primate sequence entries, part 4.
1336. gbpri40.seq - Primate sequence entries, part 40.
1337. gbpri41.seq - Primate sequence entries, part 41.
1338. gbpri5.seq - Primate sequence entries, part 5.
1339. gbpri6.seq - Primate sequence entries, part 6.
1340. gbpri7.seq - Primate sequence entries, part 7.
1341. gbpri8.seq - Primate sequence entries, part 8.
1342. gbpri9.seq - Primate sequence entries, part 9.
1343. gbrel.txt - Release notes (this document).
1344. gbrod1.seq - Rodent sequence entries, part 1.
1345. gbrod10.seq - Rodent sequence entries, part 10.
1346. gbrod11.seq - Rodent sequence entries, part 11.
1347. gbrod12.seq - Rodent sequence entries, part 12.
1348. gbrod13.seq - Rodent sequence entries, part 13.
1349. gbrod14.seq - Rodent sequence entries, part 14.
1350. gbrod15.seq - Rodent sequence entries, part 15.
1351. gbrod16.seq - Rodent sequence entries, part 16.
1352. gbrod17.seq - Rodent sequence entries, part 17.
1353. gbrod18.seq - Rodent sequence entries, part 18.
1354. gbrod19.seq - Rodent sequence entries, part 19.
1355. gbrod2.seq - Rodent sequence entries, part 2.
1356. gbrod20.seq - Rodent sequence entries, part 20.
1357. gbrod21.seq - Rodent sequence entries, part 21.
1358. gbrod22.seq - Rodent sequence entries, part 22.
1359. gbrod23.seq - Rodent sequence entries, part 23.
1360. gbrod24.seq - Rodent sequence entries, part 24.
1361. gbrod25.seq - Rodent sequence entries, part 25.
1362. gbrod26.seq - Rodent sequence entries, part 26.
1363. gbrod27.seq - Rodent sequence entries, part 27.
1364. gbrod28.seq - Rodent sequence entries, part 28.
1365. gbrod29.seq - Rodent sequence entries, part 29.
1366. gbrod3.seq - Rodent sequence entries, part 3.
1367. gbrod4.seq - Rodent sequence entries, part 4.
1368. gbrod5.seq - Rodent sequence entries, part 5.
1369. gbrod6.seq - Rodent sequence entries, part 6.
1370. gbrod7.seq - Rodent sequence entries, part 7.
1371. gbrod8.seq - Rodent sequence entries, part 8.
1372. gbrod9.seq - Rodent sequence entries, part 9.
1373. gbsdr1.txt - Short directory of the data bank, part 1.
1374. gbsdr2.txt - Short directory of the data bank, part 2.
1375. gbsdr3.txt - Short directory of the data bank, part 3.
1376. gbsec.idx - Index of the entries according to secondary accession number.
1377. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1378. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1379. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1380. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1381. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1382. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1383. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1384. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1385. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1386. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1387. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1388. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1389. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1390. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1391. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1392. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1393. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1394. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1395. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1396. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1397. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1398. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1399. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1400. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1401. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1402. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1403. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1404. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1405. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1406. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1407. gbuna1.seq - Unannotated sequence entries, part 1.
1408. gbvrl1.seq - Viral sequence entries, part 1.
1409. gbvrl10.seq - Viral sequence entries, part 10.
1410. gbvrl11.seq - Viral sequence entries, part 11.
1411. gbvrl12.seq - Viral sequence entries, part 12.
1412. gbvrl13.seq - Viral sequence entries, part 13.
1413. gbvrl14.seq - Viral sequence entries, part 14.
1414. gbvrl15.seq - Viral sequence entries, part 15.
1415. gbvrl2.seq - Viral sequence entries, part 2.
1416. gbvrl3.seq - Viral sequence entries, part 3.
1417. gbvrl4.seq - Viral sequence entries, part 4.
1418. gbvrl5.seq - Viral sequence entries, part 5.
1419. gbvrl6.seq - Viral sequence entries, part 6.
1420. gbvrl7.seq - Viral sequence entries, part 7.
1421. gbvrl8.seq - Viral sequence entries, part 8.
1422. gbvrl9.seq - Viral sequence entries, part 9.
1423. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1424. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1425. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1426. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1427. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1428. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1429. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1430. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1431. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1432. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1433. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1434. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1435. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1436. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1437. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1438. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1439. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1440. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1441. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1442. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1443. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 179.0 flatfiles require roughly 451 GB (sequence
files only) or 484 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1365946177     gbacc1.idx
2192068791     gbacc2.idx
 693394125     gbacc3.idx
 183880822     gbaut1.idx
 183817151     gbaut10.idx
 185818639     gbaut11.idx
 183634173     gbaut12.idx
 186090586     gbaut13.idx
 206393812     gbaut14.idx
 240438321     gbaut15.idx
 186557850     gbaut16.idx
 183936664     gbaut17.idx
 184570669     gbaut18.idx
 183931312     gbaut19.idx
 187044432     gbaut2.idx
 189995112     gbaut20.idx
 203752611     gbaut21.idx
 201083032     gbaut22.idx
 184664600     gbaut23.idx
 183914654     gbaut24.idx
 184009375     gbaut25.idx
 187867584     gbaut26.idx
 185577357     gbaut27.idx
 190479974     gbaut28.idx
 250926129     gbaut29.idx
 212157989     gbaut3.idx
 241691638     gbaut30.idx
 184636242     gbaut31.idx
 189903469     gbaut32.idx
 184848184     gbaut33.idx
 183928014     gbaut34.idx
 185824268     gbaut35.idx
 183733154     gbaut36.idx
 186353377     gbaut37.idx
 250869215     gbaut38.idx
 184068426     gbaut39.idx
 184130637     gbaut4.idx
 184962576     gbaut40.idx
 191016182     gbaut41.idx
 185478548     gbaut42.idx
 234821445     gbaut43.idx
 206251611     gbaut44.idx
 188195066     gbaut45.idx
 244909045     gbaut46.idx
 185065686     gbaut47.idx
 186185961     gbaut48.idx
 184781530     gbaut49.idx
 254862400     gbaut5.idx
 199009550     gbaut50.idx
 185281044     gbaut51.idx
 252860550     gbaut52.idx
 254708829     gbaut53.idx
 183962997     gbaut54.idx
 247387104     gbaut55.idx
 194631989     gbaut56.idx
 185472901     gbaut57.idx
 228087971     gbaut58.idx
 216367061     gbaut59.idx
 183794108     gbaut6.idx
 184235397     gbaut60.idx
 247762934     gbaut61.idx
 186245012     gbaut62.idx
 184070816     gbaut63.idx
 184871702     gbaut64.idx
 185643139     gbaut65.idx
 263704328     gbaut66.idx
 183772884     gbaut67.idx
 185974184     gbaut68.idx
 229197278     gbaut69.idx
 183870720     gbaut7.idx
 188160153     gbaut70.idx
 186067956     gbaut71.idx
 186626145     gbaut72.idx
 195642070     gbaut73.idx
 201266703     gbaut74.idx
  98902018     gbaut75.idx
 184510034     gbaut8.idx
 183764712     gbaut9.idx
 249064378     gbbct1.seq
 248124571     gbbct10.seq
 249999230     gbbct11.seq
  20194556     gbbct12.seq
 242758246     gbbct13.seq
 249771883     gbbct14.seq
 247999008     gbbct15.seq
 242200229     gbbct16.seq
 248742863     gbbct17.seq
 243881901     gbbct18.seq
 245715619     gbbct19.seq
 247508195     gbbct2.seq
 248477227     gbbct20.seq
 191119840     gbbct21.seq
 242657680     gbbct22.seq
 241401047     gbbct23.seq
 248564297     gbbct24.seq
 247789588     gbbct25.seq
 249349578     gbbct26.seq
 244148374     gbbct27.seq
 247095596     gbbct28.seq
 249959471     gbbct29.seq
 249682556     gbbct3.seq
 249716928     gbbct30.seq
 240140699     gbbct31.seq
 245726622     gbbct32.seq
 239366556     gbbct33.seq
 160027477     gbbct34.seq
 248858726     gbbct35.seq
 245682058     gbbct36.seq
 232255281     gbbct37.seq
 239250393     gbbct38.seq
 231739325     gbbct39.seq
 249957142     gbbct4.seq
 241911210     gbbct40.seq
 246459918     gbbct41.seq
 249609037     gbbct42.seq
 249420167     gbbct43.seq
 248725535     gbbct44.seq
 134850079     gbbct45.seq
   6878625     gbbct46.seq
  14196916     gbbct47.seq
  23150602     gbbct48.seq
  45029351     gbbct49.seq
 139069229     gbbct5.seq
  87548628     gbbct50.seq
 169852633     gbbct51.seq
 249999288     gbbct52.seq
 244076483     gbbct53.seq
 247002112     gbbct54.seq
 247984179     gbbct55.seq
 246113742     gbbct56.seq
 249998673     gbbct57.seq
 240758687     gbbct58.seq
 137087328     gbbct59.seq
 249966539     gbbct6.seq
 249738571     gbbct7.seq
 249873468     gbbct8.seq
 246457910     gbbct9.seq
  10899170     gbchg.txt
 249999768     gbcon1.seq
 249995074     gbcon10.seq
 249995445     gbcon100.seq
 249996667     gbcon101.seq
 249998797     gbcon102.seq
 249995641     gbcon103.seq
 156127743     gbcon104.seq
 249995214     gbcon105.seq
 249997693     gbcon106.seq
 249998761     gbcon107.seq
 249997855     gbcon108.seq
  71466271     gbcon109.seq
 249996792     gbcon11.seq
 250000221     gbcon110.seq
 249998182     gbcon111.seq
 233888569     gbcon112.seq
 250000256     gbcon113.seq
 250000098     gbcon114.seq
 249995503     gbcon115.seq
 249591827     gbcon116.seq
 162158485     gbcon117.seq
 249559946     gbcon118.seq
 250000249     gbcon119.seq
 249591998     gbcon12.seq
  14887221     gbcon120.seq
 249995963     gbcon121.seq
 249999409     gbcon122.seq
 250000251     gbcon123.seq
 249584101     gbcon124.seq
  11138979     gbcon125.seq
 249593241     gbcon126.seq
 249067631     gbcon127.seq
 249908773     gbcon128.seq
 249993296     gbcon129.seq
 244592436     gbcon13.seq
 250000115     gbcon130.seq
 161207559     gbcon131.seq
 249998975     gbcon132.seq
 249998724     gbcon133.seq
 249964120     gbcon134.seq
 249880147     gbcon135.seq
 249998681     gbcon136.seq
 247907371     gbcon137.seq
 249998876     gbcon138.seq
 145029931     gbcon139.seq
 249999702     gbcon14.seq
  21462624     gbcon140.seq
  31250344     gbcon15.seq
 249996943     gbcon16.seq
 249996780     gbcon17.seq
 209576848     gbcon18.seq
 249999422     gbcon19.seq
 248221595     gbcon2.seq
 249961432     gbcon20.seq
  96963659     gbcon21.seq
 250000057     gbcon22.seq
  61357058     gbcon23.seq
 249997576     gbcon24.seq
 249958950     gbcon25.seq
 249999765     gbcon26.seq
 249997102     gbcon27.seq
 213693665     gbcon28.seq
 249998460     gbcon29.seq
 249799378     gbcon3.seq
 250000050     gbcon30.seq
 249998405     gbcon31.seq
 249998847     gbcon32.seq
 249999309     gbcon33.seq
 195713346     gbcon34.seq
 249994638     gbcon35.seq
 249994355     gbcon36.seq
 249996557     gbcon37.seq
 249995872     gbcon38.seq
 249998504     gbcon39.seq
 249997644     gbcon4.seq
 249995403     gbcon40.seq
  60977708     gbcon41.seq
 249996893     gbcon42.seq
 249997617     gbcon43.seq
 249994634     gbcon44.seq
 249997569     gbcon45.seq
 249997343     gbcon46.seq
  42909814     gbcon47.seq
 249995915     gbcon48.seq
 249999280     gbcon49.seq
 249992178     gbcon5.seq
 249995710     gbcon50.seq
 249996631     gbcon51.seq
 249995091     gbcon52.seq
  36225425     gbcon53.seq
 249997103     gbcon54.seq
 249996724     gbcon55.seq
 249997253     gbcon56.seq
 249996527     gbcon57.seq
 249999884     gbcon58.seq
 152476914     gbcon59.seq
 249999377     gbcon6.seq
 249996992     gbcon60.seq
 249997178     gbcon61.seq
 249997201     gbcon62.seq
 249996856     gbcon63.seq
 183504539     gbcon64.seq
 249995931     gbcon65.seq
 249997041     gbcon66.seq
 249998416     gbcon67.seq
 249998317     gbcon68.seq
 245375145     gbcon69.seq
 249995163     gbcon7.seq
 249999551     gbcon70.seq
 249998271     gbcon71.seq
 249998133     gbcon72.seq
 249998704     gbcon73.seq
 249997871     gbcon74.seq
  96481205     gbcon75.seq
 250000212     gbcon76.seq
 249996110     gbcon77.seq
 249999860     gbcon78.seq
 249998416     gbcon79.seq
  50317902     gbcon8.seq
 250000165     gbcon80.seq
  62502628     gbcon81.seq
 249999807     gbcon82.seq
 249998139     gbcon83.seq
 249998956     gbcon84.seq
 249995391     gbcon85.seq
 249998511     gbcon86.seq
  21523692     gbcon87.seq
 249996875     gbcon88.seq
 249995114     gbcon89.seq
 249994769     gbcon9.seq
 249996256     gbcon90.seq
 249999714     gbcon91.seq
 197747900     gbcon92.seq
 249995224     gbcon93.seq
 249999439     gbcon94.seq
 249997468     gbcon95.seq
 249999950     gbcon96.seq
 249995004     gbcon97.seq
 133061783     gbcon98.seq
 249998329     gbcon99.seq
    720502     gbdel.txt
 249998247     gbenv1.seq
 250000115     gbenv10.seq
  52475415     gbenv11.seq
 249999158     gbenv12.seq
 249998753     gbenv13.seq
 249997591     gbenv14.seq
 249998321     gbenv15.seq
 249998294     gbenv16.seq
 249997137     gbenv17.seq
  78470425     gbenv18.seq
 249999076     gbenv19.seq
 249801174     gbenv2.seq
 249998609     gbenv20.seq
 249999526     gbenv21.seq
 249999722     gbenv22.seq
 120277205     gbenv23.seq
 249999382     gbenv24.seq
 249998938     gbenv25.seq
 249999701     gbenv26.seq
 249999747     gbenv27.seq
 249999201     gbenv28.seq
 159051715     gbenv29.seq
 249998623     gbenv3.seq
 249997364     gbenv4.seq
 249999591     gbenv5.seq
 116851982     gbenv6.seq
 249998888     gbenv7.seq
 249998336     gbenv8.seq
 249997677     gbenv9.seq
 524291627     gbest1.seq
 524291605     gbest10.seq
 524289449     gbest100.seq
 524288770     gbest101.seq
 524289187     gbest102.seq
 524289743     gbest103.seq
 210321140     gbest104.seq
 524288967     gbest105.seq
 524291457     gbest106.seq
 482426008     gbest107.seq
 386214270     gbest108.seq
 385741427     gbest109.seq
 524290509     gbest11.seq
 380693050     gbest110.seq
 381211840     gbest111.seq
 381812774     gbest112.seq
 379084839     gbest113.seq
 389877983     gbest114.seq
 385901866     gbest115.seq
 382531785     gbest116.seq
 381809207     gbest117.seq
 411444217     gbest118.seq
 524289936     gbest119.seq
 524289051     gbest12.seq
 524291500     gbest120.seq
 524289265     gbest121.seq
 524291682     gbest122.seq
 524291795     gbest123.seq
 361506373     gbest124.seq
 524289622     gbest125.seq
 524290376     gbest126.seq
 524290411     gbest127.seq
 524290074     gbest128.seq
 524289254     gbest129.seq
   2484457     gbest13.seq
 524290011     gbest130.seq
 524289764     gbest131.seq
 524292082     gbest132.seq
 524289150     gbest133.seq
 524290534     gbest134.seq
 524289052     gbest135.seq
 524288830     gbest136.seq
 126417540     gbest137.seq
 524289465     gbest138.seq
 524290895     gbest139.seq
 524290410     gbest14.seq
 524291307     gbest140.seq
 524291334     gbest141.seq
 524289374     gbest142.seq
 524290667     gbest143.seq
 524289600     gbest144.seq
 524291083     gbest145.seq
 524292301     gbest146.seq
 524292475     gbest147.seq
 524290903     gbest148.seq
 524289526     gbest149.seq
 524289049     gbest15.seq
 524288760     gbest150.seq
 327627809     gbest151.seq
 524291526     gbest152.seq
 524289841     gbest153.seq
 524289782     gbest154.seq
 524290291     gbest155.seq
 524289500     gbest156.seq
 524288817     gbest157.seq
 524291681     gbest158.seq
 524288764     gbest159.seq
 524288865     gbest16.seq
 464060332     gbest160.seq
 524290459     gbest161.seq
 524289385     gbest162.seq
 524289856     gbest163.seq
 128853867     gbest164.seq
 524288890     gbest165.seq
 524293046     gbest166.seq
 524290364     gbest167.seq
 524289310     gbest168.seq
 524291364     gbest169.seq
 524288958     gbest17.seq
 524291695     gbest170.seq
 524289699     gbest171.seq
 524290580     gbest172.seq
 524290175     gbest173.seq
 524290432     gbest174.seq
 524294216     gbest175.seq
 524289344     gbest176.seq
 480814635     gbest177.seq
 524291369     gbest178.seq
 524290052     gbest179.seq
 524289340     gbest18.seq
 524289471     gbest180.seq
 524291765     gbest181.seq
 524290380     gbest182.seq
 524289810     gbest183.seq
 524289549     gbest184.seq
 524288921     gbest185.seq
 524291049     gbest186.seq
 524288897     gbest187.seq
 524293272     gbest188.seq
 524291380     gbest189.seq
 524289151     gbest19.seq
 317792750     gbest190.seq
 524291185     gbest191.seq
 524290979     gbest192.seq
 524293735     gbest193.seq
 524290952     gbest194.seq
 524292770     gbest195.seq
 524290075     gbest196.seq
 524289040     gbest197.seq
 524289566     gbest198.seq
 524289627     gbest199.seq
 524290470     gbest2.seq
 524289450     gbest20.seq
 524289860     gbest200.seq
 524288772     gbest201.seq
 524291035     gbest202.seq
 485768234     gbest203.seq
 524289519     gbest204.seq
 524288927     gbest205.seq
 524289062     gbest206.seq
 524290268     gbest207.seq
 524289591     gbest208.seq
 524289155     gbest209.seq
 524289476     gbest21.seq
 524289072     gbest210.seq
 524290977     gbest211.seq
 524288754     gbest212.seq
 524290870     gbest213.seq
 303132625     gbest214.seq
 524289313     gbest215.seq
 524289163     gbest216.seq
 524291345     gbest217.seq
 524293021     gbest218.seq
 524294270     gbest219.seq
 461563634     gbest22.seq
 524292091     gbest220.seq
 524290923     gbest221.seq
 524290338     gbest222.seq
 524289497     gbest223.seq
 524291670     gbest224.seq
 524291632     gbest225.seq
 524291902     gbest226.seq
 524291889     gbest227.seq
 282926231     gbest228.seq
 524288800     gbest229.seq
 507980934     gbest23.seq
 524289413     gbest230.seq
 524288725     gbest231.seq
 524289390     gbest232.seq
 524290426     gbest233.seq
 524289781     gbest234.seq
 524289647     gbest235.seq
 524289691     gbest236.seq
 524289443     gbest237.seq
 524289816     gbest238.seq
 524292057     gbest239.seq
 524290393     gbest24.seq
 524289925     gbest240.seq
 524289748     gbest241.seq
 383506176     gbest242.seq
 524289431     gbest243.seq
 524291645     gbest244.seq
 524289946     gbest245.seq
 524289348     gbest246.seq
 524291587     gbest247.seq
 524289861     gbest248.seq
 524289373     gbest249.seq
 170464517     gbest25.seq
 524289142     gbest250.seq
 524288956     gbest251.seq
 524288832     gbest252.seq
 524290757     gbest253.seq
  36875966     gbest254.seq
 524290431     gbest255.seq
 524290942     gbest256.seq
 524290189     gbest257.seq
 524288925     gbest258.seq
 524288778     gbest259.seq
 524289962     gbest26.seq
 524289919     gbest260.seq
 524290592     gbest261.seq
 524289958     gbest262.seq
 524290971     gbest263.seq
 524289848     gbest264.seq
 213914179     gbest265.seq
 524290399     gbest266.seq
 524290992     gbest267.seq
 524291453     gbest268.seq
 524289392     gbest269.seq
 524290371     gbest27.seq
 524291074     gbest270.seq
 524289550     gbest271.seq
 524291171     gbest272.seq
 524289341     gbest273.seq
 524289220     gbest274.seq
 524293083     gbest275.seq
 524289297     gbest276.seq
 188740604     gbest277.seq
 524290964     gbest278.seq
 524289759     gbest279.seq
 524290837     gbest28.seq
 524290287     gbest280.seq
 524289658     gbest281.seq
 524289761     gbest282.seq
 524292204     gbest283.seq
 524292391     gbest284.seq
 524289372     gbest285.seq
 524291013     gbest286.seq
 524289788     gbest287.seq
 422691184     gbest288.seq
 524292811     gbest289.seq
 524289529     gbest29.seq
 524290471     gbest290.seq
 524291750     gbest291.seq
 524288935     gbest292.seq
 524290875     gbest293.seq
 524291023     gbest294.seq
 524289996     gbest295.seq
 473219869     gbest296.seq
 481725578     gbest297.seq
 483772985     gbest298.seq
 480578288     gbest299.seq
 512722041     gbest3.seq
 524289360     gbest30.seq
 218606289     gbest300.seq
 524291126     gbest301.seq
 524290770     gbest302.seq
 524290048     gbest303.seq
 524289170     gbest304.seq
 524288722     gbest305.seq
 524290068     gbest306.seq
 524289784     gbest307.seq
 524291531     gbest308.seq
 524289063     gbest309.seq
 524291143     gbest31.seq
 524290490     gbest310.seq
 524291373     gbest311.seq
 524291589     gbest312.seq
 373721504     gbest313.seq
 524289539     gbest314.seq
 524289757     gbest315.seq
 524288774     gbest316.seq
 524291851     gbest317.seq
 524291940     gbest318.seq
 524289967     gbest319.seq
 524290856     gbest32.seq
 524289404     gbest320.seq
 524291512     gbest321.seq
 524289446     gbest322.seq
 522451573     gbest323.seq
 524290986     gbest324.seq
 524290981     gbest325.seq
 524289183     gbest326.seq
 240383917     gbest327.seq
 524288749     gbest328.seq
 524289290     gbest329.seq
 524291193     gbest33.seq
 524288953     gbest330.seq
 524291070     gbest331.seq
 524292116     gbest332.seq
 524289105     gbest333.seq
 524291238     gbest334.seq
 524290159     gbest335.seq
 524290193     gbest336.seq
 524289099     gbest337.seq
 524288833     gbest338.seq
 524289204     gbest339.seq
 490719741     gbest34.seq
 524291168     gbest340.seq
  74557699     gbest341.seq
 524289625     gbest342.seq
 524290998     gbest343.seq
 524291040     gbest344.seq
 524291035     gbest345.seq
 524292260     gbest346.seq
 524294245     gbest347.seq
 524289978     gbest348.seq
 524289389     gbest349.seq
 490149711     gbest35.seq
 524290027     gbest350.seq
 524288820     gbest351.seq
 524291273     gbest352.seq
 524288962     gbest353.seq
 524290635     gbest354.seq
 114732561     gbest355.seq
 524289814     gbest356.seq
 524290073     gbest357.seq
 524290438     gbest358.seq
 524289693     gbest359.seq
 492419817     gbest36.seq
 524289917     gbest360.seq
 524289109     gbest361.seq
 524289196     gbest362.seq
 524289407     gbest363.seq
 524289973     gbest364.seq
 524289668     gbest365.seq
 445054498     gbest366.seq
 524291099     gbest367.seq
 524290596     gbest368.seq
 524291199     gbest369.seq
 491636431     gbest37.seq
 524292260     gbest370.seq
 524291323     gbest371.seq
 524288865     gbest372.seq
 524290699     gbest373.seq
 524290418     gbest374.seq
 524289220     gbest375.seq
 524289567     gbest376.seq
 524288970     gbest377.seq
 352743360     gbest378.seq
 524288746     gbest379.seq
 484900307     gbest38.seq
 524289898     gbest380.seq
 524290564     gbest381.seq
 524289337     gbest382.seq
 524289829     gbest383.seq
 524290178     gbest384.seq
 524289153     gbest385.seq
 524289517     gbest386.seq
 524289890     gbest387.seq
 524290521     gbest388.seq
 524288737     gbest389.seq
 497454548     gbest39.seq
 524291053     gbest390.seq
 378214035     gbest391.seq
 524290958     gbest392.seq
 524288810     gbest393.seq
 524290769     gbest394.seq
 524291470     gbest395.seq
 524290712     gbest396.seq
 524292416     gbest397.seq
 524291770     gbest398.seq
 524290498     gbest399.seq
 524289845     gbest4.seq
   6169240     gbest40.seq
 524289423     gbest400.seq
 524290229     gbest401.seq
 524289339     gbest402.seq
 524290701     gbest403.seq
 347827454     gbest404.seq
 524289966     gbest405.seq
 524294424     gbest406.seq
 524293770     gbest407.seq
 524291434     gbest408.seq
 524291878     gbest409.seq
 524289608     gbest41.seq
 524291164     gbest410.seq
 524291863     gbest411.seq
 524290824     gbest412.seq
 524289584     gbest413.seq
 524290742     gbest414.seq
 524288807     gbest415.seq
 524290670     gbest416.seq
 524288903     gbest417.seq
 462926364     gbest418.seq
  70688495     gbest419.seq
 524289777     gbest42.seq
 524289991     gbest43.seq
 524293399     gbest44.seq
 524290847     gbest45.seq
 524291510     gbest46.seq
 524289912     gbest47.seq
 524288813     gbest48.seq
 524289063     gbest49.seq
 524290729     gbest5.seq
 524289072     gbest50.seq
 524290864     gbest51.seq
 524292877     gbest52.seq
 524291183     gbest53.seq
 118745946     gbest54.seq
 524290039     gbest55.seq
 524291412     gbest56.seq
 524290011     gbest57.seq
 524290466     gbest58.seq
 524290464     gbest59.seq
 524290473     gbest6.seq
 524289082     gbest60.seq
 524291059     gbest61.seq
 524289652     gbest62.seq
 524290655     gbest63.seq
 524291370     gbest64.seq
 524289756     gbest65.seq
 524289794     gbest66.seq
 308321880     gbest67.seq
 524289083     gbest68.seq
 524288875     gbest69.seq
 524291599     gbest7.seq
 524289569     gbest70.seq
 524291356     gbest71.seq
 524289242     gbest72.seq
 524290562     gbest73.seq
 524290320     gbest74.seq
 524290487     gbest75.seq
 524290927     gbest76.seq
 524289929     gbest77.seq
 524289457     gbest78.seq
 524291201     gbest79.seq
 524289395     gbest8.seq
  56734303     gbest80.seq
 524291061     gbest81.seq
 524289510     gbest82.seq
 524289089     gbest83.seq
 524290941     gbest84.seq
 524291091     gbest85.seq
 524291211     gbest86.seq
 524290983     gbest87.seq
 524289557     gbest88.seq
 524288967     gbest89.seq
 524290298     gbest9.seq
 524294399     gbest90.seq
 524290552     gbest91.seq
 296262999     gbest92.seq
 524288871     gbest93.seq
 524290181     gbest94.seq
 524290417     gbest95.seq
 524292700     gbest96.seq
 524289015     gbest97.seq
 524289344     gbest98.seq
 524289158     gbest99.seq
 131988805     gbgen.idx
 524288809     gbgss1.seq
 524291172     gbgss10.seq
 232712335     gbgss100.seq
 524290576     gbgss101.seq
 524290542     gbgss102.seq
 524288732     gbgss103.seq
 524288934     gbgss104.seq
 524289060     gbgss105.seq
 524290550     gbgss106.seq
 524290747     gbgss107.seq
 524290705     gbgss108.seq
 524290603     gbgss109.seq
 524291753     gbgss11.seq
 524290458     gbgss110.seq
 454307918     gbgss111.seq
 524291509     gbgss112.seq
 524289156     gbgss113.seq
 524291552     gbgss114.seq
 524291105     gbgss115.seq
 524290574     gbgss116.seq
 524289998     gbgss117.seq
 524289615     gbgss118.seq
 524291257     gbgss119.seq
 524291819     gbgss12.seq
 524289637     gbgss120.seq
 524289391     gbgss121.seq
 329523323     gbgss122.seq
 249997664     gbgss123.seq
 249997712     gbgss124.seq
 249998060     gbgss125.seq
 249996887     gbgss126.seq
  27983956     gbgss127.seq
 249997137     gbgss128.seq
 250000033     gbgss129.seq
 524289826     gbgss13.seq
 249998542     gbgss130.seq
 249998333     gbgss131.seq
 224919493     gbgss132.seq
 249998415     gbgss133.seq
 249998761     gbgss134.seq
 249998880     gbgss135.seq
 249999110     gbgss136.seq
 172046561     gbgss137.seq
 249997088     gbgss138.seq
 249998903     gbgss139.seq
 524288798     gbgss14.seq
 249999973     gbgss140.seq
 249998936     gbgss141.seq
 250000057     gbgss142.seq
  76975350     gbgss143.seq
 250000188     gbgss144.seq
   2879209     gbgss145.seq
  79542258     gbgss146.seq
 249999490     gbgss147.seq
 249999950     gbgss148.seq
  78247334     gbgss149.seq
 524289531     gbgss15.seq
 249998378     gbgss150.seq
 249999331     gbgss151.seq
 249997693     gbgss152.seq
 116326140     gbgss153.seq
 249999232     gbgss154.seq
 249999334     gbgss155.seq
 249999609     gbgss156.seq
 246354232     gbgss157.seq
 249999268     gbgss158.seq
 249997406     gbgss159.seq
 524290901     gbgss16.seq
 249999513     gbgss160.seq
 243477113     gbgss161.seq
 249999336     gbgss162.seq
 249997687     gbgss163.seq
 249997948     gbgss164.seq
 249997418     gbgss165.seq
 116439238     gbgss166.seq
 249998013     gbgss167.seq
 250000031     gbgss168.seq
 249999974     gbgss169.seq
 524291327     gbgss17.seq
 249998152     gbgss170.seq
  94058788     gbgss171.seq
 249998892     gbgss172.seq
 249999850     gbgss173.seq
 249998239     gbgss174.seq
 249999582     gbgss175.seq
 162386018     gbgss176.seq
 249999236     gbgss177.seq
 249997993     gbgss178.seq
 249998006     gbgss179.seq
 524290590     gbgss18.seq
 249999353     gbgss180.seq
  95926739     gbgss181.seq
 249999461     gbgss182.seq
 249999350     gbgss183.seq
 249998406     gbgss184.seq
 249998619     gbgss185.seq
 249998550     gbgss186.seq
 249999411     gbgss187.seq
  18590121     gbgss188.seq
 249999424     gbgss189.seq
 155422817     gbgss19.seq
 249999963     gbgss190.seq
 249997369     gbgss191.seq
  43648880     gbgss192.seq
  52862187     gbgss193.seq
 249999919     gbgss194.seq
 249998169     gbgss195.seq
 249999797     gbgss196.seq
 249999336     gbgss197.seq
 249999560     gbgss198.seq
 249998181     gbgss199.seq
 524291245     gbgss2.seq
 524290226     gbgss20.seq
  20487269     gbgss200.seq
 249999684     gbgss201.seq
 249999919     gbgss202.seq
 249997944     gbgss203.seq
 249997093     gbgss204.seq
 250000122     gbgss205.seq
  38649143     gbgss206.seq
 249999812     gbgss207.seq
 249999035     gbgss208.seq
  47503560     gbgss209.seq
 524291157     gbgss21.seq
 249999561     gbgss210.seq
 249998751     gbgss211.seq
 249999599     gbgss212.seq
 249999028     gbgss213.seq
 249999713     gbgss214.seq
  16550600     gbgss215.seq
 524290562     gbgss22.seq
 524289087     gbgss23.seq
 524290375     gbgss24.seq
 524291573     gbgss25.seq
 524290409     gbgss26.seq
 524290935     gbgss27.seq
 524289587     gbgss28.seq
 524289547     gbgss29.seq
 524289099     gbgss3.seq
 427980787     gbgss30.seq
 524290372     gbgss31.seq
 524289473     gbgss32.seq
 524290353     gbgss33.seq
 524290058     gbgss34.seq
 524290137     gbgss35.seq
 524290624     gbgss36.seq
 524290508     gbgss37.seq
 469007750     gbgss38.seq
 524290067     gbgss39.seq
 524291430     gbgss4.seq
 524290489     gbgss40.seq
 453489608     gbgss41.seq
 524289796     gbgss42.seq
 524289041     gbgss43.seq
 524289564     gbgss44.seq
 524291591     gbgss45.seq
 156792534     gbgss46.seq
 524290791     gbgss47.seq
 524289036     gbgss48.seq
 524291372     gbgss49.seq
 115091837     gbgss5.seq
 524288728     gbgss50.seq
 524291549     gbgss51.seq
 524290735     gbgss52.seq
 524290143     gbgss53.seq
 524291463     gbgss54.seq
 524288809     gbgss55.seq
 524289877     gbgss56.seq
 403259060     gbgss57.seq
 524289172     gbgss58.seq
 524292027     gbgss59.seq
 524290509     gbgss6.seq
 524289083     gbgss60.seq
 415166904     gbgss61.seq
 524290796     gbgss62.seq
 524290139     gbgss63.seq
 524290505     gbgss64.seq
 524290711     gbgss65.seq
 524290280     gbgss66.seq
 524289371     gbgss67.seq
 524289030     gbgss68.seq
 524291377     gbgss69.seq
 524288725     gbgss7.seq
 524291331     gbgss70.seq
 524290474     gbgss71.seq
 524289204     gbgss72.seq
 411049101     gbgss73.seq
 524290854     gbgss74.seq
 524290834     gbgss75.seq
 524289053     gbgss76.seq
 524288861     gbgss77.seq
 524290865     gbgss78.seq
 524289024     gbgss79.seq
 524288772     gbgss8.seq
 524292151     gbgss80.seq
 524290197     gbgss81.seq
 524289471     gbgss82.seq
 524292250     gbgss83.seq
 524288847     gbgss84.seq
 230098561     gbgss85.seq
 524292132     gbgss86.seq
 524289296     gbgss87.seq
 524290639     gbgss88.seq
 524290493     gbgss89.seq
 524289101     gbgss9.seq
 524291310     gbgss90.seq
 524291780     gbgss91.seq
 524291338     gbgss92.seq
 524288829     gbgss93.seq
 524291050     gbgss94.seq
 524289791     gbgss95.seq
 524291194     gbgss96.seq
 524291029     gbgss97.seq
 524291498     gbgss98.seq
 524289701     gbgss99.seq
 249995386     gbhtc1.seq
 249999697     gbhtc10.seq
 249997425     gbhtc11.seq
  79149463     gbhtc12.seq
 249998738     gbhtc13.seq
 250000057     gbhtc14.seq
  49039656     gbhtc15.seq
 249990632     gbhtc2.seq
 249996658     gbhtc3.seq
 249997450     gbhtc4.seq
 249997653     gbhtc5.seq
 249992358     gbhtc6.seq
 250000040     gbhtc7.seq
  73434697     gbhtc8.seq
 249997813     gbhtc9.seq
 249955078     gbhtg1.seq
 249807404     gbhtg10.seq
 249946669     gbhtg100.seq
 249945600     gbhtg101.seq
 249902534     gbhtg102.seq
 249869354     gbhtg103.seq
   5713706     gbhtg104.seq
 249602147     gbhtg105.seq
 249884674     gbhtg106.seq
 249818605     gbhtg107.seq
 249845241     gbhtg108.seq
 249846223     gbhtg109.seq
   1643239     gbhtg11.seq
 249910458     gbhtg110.seq
 249762105     gbhtg111.seq
 249430921     gbhtg112.seq
 200734179     gbhtg113.seq
 249954707     gbhtg114.seq
 249810317     gbhtg115.seq
 249957735     gbhtg116.seq
 249794576     gbhtg117.seq
 249806604     gbhtg118.seq
 112075282     gbhtg119.seq
 249673592     gbhtg12.seq
 249943844     gbhtg120.seq
 249768453     gbhtg121.seq
 249963825     gbhtg122.seq
 249925235     gbhtg123.seq
 249976175     gbhtg124.seq
 166809974     gbhtg125.seq
 249856286     gbhtg126.seq
 249987080     gbhtg127.seq
 249862670     gbhtg128.seq
 249990959     gbhtg129.seq
 249692595     gbhtg13.seq
 249816138     gbhtg130.seq
 249797080     gbhtg131.seq
 249810154     gbhtg132.seq
 249881418     gbhtg133.seq
 249895993     gbhtg134.seq
  50365806     gbhtg135.seq
 249953103     gbhtg14.seq
 249948594     gbhtg15.seq
 249836513     gbhtg16.seq
 249629332     gbhtg17.seq
 249707429     gbhtg18.seq
 249838720     gbhtg19.seq
 249980855     gbhtg2.seq
 249892703     gbhtg20.seq
 240683110     gbhtg21.seq
 249801915     gbhtg22.seq
 249890597     gbhtg23.seq
 249851031     gbhtg24.seq
 249848775     gbhtg25.seq
 249775084     gbhtg26.seq
 249725817     gbhtg27.seq
 249775068     gbhtg28.seq
 249769014     gbhtg29.seq
 249996645     gbhtg3.seq
 249790865     gbhtg30.seq
 225520342     gbhtg31.seq
 249828553     gbhtg32.seq
 249685859     gbhtg33.seq
 249885495     gbhtg34.seq
 249771468     gbhtg35.seq
 249765828     gbhtg36.seq
 249862741     gbhtg37.seq
 249859942     gbhtg38.seq
 249650114     gbhtg39.seq
 249931999     gbhtg4.seq
 249809235     gbhtg40.seq
 227918837     gbhtg41.seq
 249788679     gbhtg42.seq
 249821463     gbhtg43.seq
 249813092     gbhtg44.seq
 249573697     gbhtg45.seq
 249929826     gbhtg46.seq
 249930109     gbhtg47.seq
 249947867     gbhtg48.seq
 249737557     gbhtg49.seq
 249989064     gbhtg5.seq
 249972074     gbhtg50.seq
 236200995     gbhtg51.seq
 249784719     gbhtg52.seq
 249802174     gbhtg53.seq
 249806870     gbhtg54.seq
 249951638     gbhtg55.seq
 249986938     gbhtg56.seq
  20462141     gbhtg57.seq
 249887011     gbhtg58.seq
 249779648     gbhtg59.seq
 249770181     gbhtg6.seq
 249855853     gbhtg60.seq
 249916577     gbhtg61.seq
 228386635     gbhtg62.seq
 249829957     gbhtg63.seq
 249878331     gbhtg64.seq
 249966072     gbhtg65.seq
 249821787     gbhtg66.seq
 249714955     gbhtg67.seq
  17370772     gbhtg68.seq
 249960711     gbhtg69.seq
 249852171     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249977849     gbhtg72.seq
 227734328     gbhtg73.seq
 249814172     gbhtg74.seq
 249863384     gbhtg75.seq
 249873209     gbhtg76.seq
 249781424     gbhtg77.seq
 246284875     gbhtg78.seq
 249883714     gbhtg79.seq
 249791784     gbhtg8.seq
 249988658     gbhtg80.seq
 249802010     gbhtg81.seq
 249822687     gbhtg82.seq
 216989390     gbhtg83.seq
 249912353     gbhtg84.seq
 249916892     gbhtg85.seq
 249979814     gbhtg86.seq
 249783886     gbhtg87.seq
 224890233     gbhtg88.seq
 249976769     gbhtg89.seq
 249972988     gbhtg9.seq
 249876064     gbhtg90.seq
 249819892     gbhtg91.seq
 249856859     gbhtg92.seq
 218843351     gbhtg93.seq
 249803502     gbhtg94.seq
 249897093     gbhtg95.seq
 249869299     gbhtg96.seq
 249796753     gbhtg97.seq
 171212722     gbhtg98.seq
 249859724     gbhtg99.seq
 249999933     gbinv1.seq
 249999911     gbinv10.seq
 250000009     gbinv11.seq
 158641591     gbinv12.seq
 249997910     gbinv13.seq
 249998926     gbinv14.seq
 249999626     gbinv15.seq
 125096799     gbinv16.seq
 247210029     gbinv17.seq
 249051369     gbinv18.seq
 249995682     gbinv19.seq
 249851240     gbinv2.seq
 249999064     gbinv20.seq
 249997029     gbinv21.seq
 249999856     gbinv22.seq
 249997056     gbinv23.seq
 172575749     gbinv24.seq
 249064733     gbinv3.seq
 249999007     gbinv4.seq
 249997037     gbinv5.seq
 248826360     gbinv6.seq
 249998486     gbinv7.seq
   4083137     gbinv8.seq
 249997851     gbinv9.seq
 140254945     gbjou1.idx
 138845146     gbjou2.idx
 142011534     gbjou3.idx
 276512228     gbjou4.idx
 274621136     gbjou5.idx
 290136076     gbjou6.idx
 301968661     gbjou7.idx
 272901216     gbjou8.idx
 163313363     gbjou9.idx
 260191343     gbkey1.idx
 178837840     gbkey2.idx
 302736020     gbkey3.idx
  94249361     gbkey4.idx
 249762201     gbmam1.seq
 249991460     gbmam2.seq
 249857328     gbmam3.seq
 249999955     gbmam4.seq
 249946279     gbmam5.seq
 133593181     gbmam6.seq
  36711068     gbnew.txt
 249999769     gbpat1.seq
 249999846     gbpat10.seq
 249999441     gbpat100.seq
 249999845     gbpat101.seq
 249999888     gbpat102.seq
 249999095     gbpat103.seq
 250000223     gbpat104.seq
 249999486     gbpat105.seq
 169767065     gbpat106.seq
 249999734     gbpat107.seq
 250000165     gbpat108.seq
 250000182     gbpat109.seq
 178970604     gbpat11.seq
  89171821     gbpat110.seq
 250000238     gbpat111.seq
 249981652     gbpat112.seq
 249999947     gbpat113.seq
  66701017     gbpat114.seq
 249998905     gbpat115.seq
 249996847     gbpat116.seq
 249999789     gbpat117.seq
 249992150     gbpat118.seq
 249999194     gbpat119.seq
 249999341     gbpat12.seq
 249999213     gbpat120.seq
 212264518     gbpat121.seq
 250000122     gbpat13.seq
 249999318     gbpat14.seq
 249998239     gbpat15.seq
 249998941     gbpat16.seq
  66007373     gbpat17.seq
 249999229     gbpat18.seq
 249999331     gbpat19.seq
 249999577     gbpat2.seq
 249999952     gbpat20.seq
 249996699     gbpat21.seq
 185178309     gbpat22.seq
 250000184     gbpat23.seq
 249809243     gbpat24.seq
 250000159     gbpat25.seq
 250000096     gbpat26.seq
  71199421     gbpat27.seq
 249998303     gbpat28.seq
 249998785     gbpat29.seq
 249999257     gbpat3.seq
 249999401     gbpat30.seq
 250000261     gbpat31.seq
 249993790     gbpat32.seq
 180185016     gbpat33.seq
 249998342     gbpat34.seq
 249999557     gbpat35.seq
 249999285     gbpat36.seq
 249999371     gbpat37.seq
 133714576     gbpat38.seq
 249998993     gbpat39.seq
 249998049     gbpat4.seq
 249999148     gbpat40.seq
 249998845     gbpat41.seq
 249979440     gbpat42.seq
 249998408     gbpat43.seq
 249998695     gbpat44.seq
 249999001     gbpat45.seq
 250000144     gbpat46.seq
 174307916     gbpat47.seq
 249999604     gbpat48.seq
 249998527     gbpat49.seq
  71794649     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 249999501     gbpat55.seq
 164409243     gbpat56.seq
 249874569     gbpat57.seq
 249998327     gbpat58.seq
 249998716     gbpat59.seq
 249999527     gbpat6.seq
 249998873     gbpat60.seq
 134579893     gbpat61.seq
 249996898     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 250000099     gbpat67.seq
 147170840     gbpat68.seq
 250000111     gbpat69.seq
 249999591     gbpat7.seq
 249999587     gbpat70.seq
 249998992     gbpat71.seq
 245252723     gbpat72.seq
 248968678     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249998827     gbpat76.seq
 160626113     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249990186     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249998543     gbpat82.seq
  60949593     gbpat83.seq
 249999879     gbpat84.seq
 249999564     gbpat85.seq
 249929730     gbpat86.seq
 249824878     gbpat87.seq
 249998855     gbpat88.seq
 192933422     gbpat89.seq
 250000081     gbpat9.seq
 249999500     gbpat90.seq
 249999631     gbpat91.seq
 249998446     gbpat92.seq
  80124395     gbpat93.seq
 249999129     gbpat94.seq
 249999388     gbpat95.seq
 249948808     gbpat96.seq
 249999448     gbpat97.seq
 249935710     gbpat98.seq
  66835451     gbpat99.seq
 107582517     gbphg1.seq
 249998830     gbpln1.seq
 249992405     gbpln10.seq
 249940064     gbpln11.seq
 249967890     gbpln12.seq
  87017682     gbpln13.seq
 249992985     gbpln14.seq
 249936362     gbpln15.seq
 249970582     gbpln16.seq
 248085672     gbpln17.seq
 249987320     gbpln18.seq
 248470008     gbpln19.seq
 249944045     gbpln2.seq
 249995442     gbpln20.seq
  26015281     gbpln21.seq
 249995409     gbpln22.seq
  95114273     gbpln23.seq
 249999313     gbpln24.seq
 249999812     gbpln25.seq
 249999749     gbpln26.seq
 249999091     gbpln27.seq
 249999342     gbpln28.seq
 249999214     gbpln29.seq
 249806230     gbpln3.seq
 250000115     gbpln30.seq
 129685004     gbpln31.seq
 249998121     gbpln32.seq
 249998073     gbpln33.seq
 249997634     gbpln34.seq
 249997581     gbpln35.seq
 105266052     gbpln36.seq
 249997777     gbpln37.seq
 250000104     gbpln38.seq
 249999436     gbpln39.seq
 249949646     gbpln4.seq
 249997733     gbpln40.seq
 249999393     gbpln41.seq
 215655403     gbpln42.seq
 249799523     gbpln5.seq
 249999482     gbpln6.seq
 249992820     gbpln7.seq
  17645199     gbpln8.seq
 249999337     gbpln9.seq
 148932773     gbpri1.seq
 249963322     gbpri10.seq
 124673756     gbpri11.seq
 249966221     gbpri12.seq
 249900325     gbpri13.seq
 249891160     gbpri14.seq
 249940560     gbpri15.seq
 249904554     gbpri16.seq
 249900566     gbpri17.seq
 249992154     gbpri18.seq
 249910550     gbpri19.seq
 249902126     gbpri2.seq
 249979103     gbpri20.seq
 249806477     gbpri21.seq
 114629817     gbpri22.seq
 180125314     gbpri23.seq
 249992574     gbpri24.seq
 204692644     gbpri25.seq
 249899000     gbpri26.seq
 249845736     gbpri27.seq
 249838560     gbpri28.seq
 249827420     gbpri29.seq
 249870719     gbpri3.seq
 249875745     gbpri30.seq
 249875878     gbpri31.seq
 249962808     gbpri32.seq
 249988970     gbpri33.seq
  84916500     gbpri34.seq
 249995363     gbpri35.seq
 249998838     gbpri36.seq
 249922800     gbpri37.seq
 249998596     gbpri38.seq
 249952744     gbpri39.seq
 249806875     gbpri4.seq
 249999130     gbpri40.seq
 201569832     gbpri41.seq
 249914221     gbpri5.seq
 249815862     gbpri6.seq
 249901780     gbpri7.seq
 249859577     gbpri8.seq
 249907030     gbpri9.seq
    277579     gbrel.txt
 249697147     gbrod1.seq
 249924286     gbrod10.seq
  53664781     gbrod11.seq
 249878684     gbrod12.seq
 249787794     gbrod13.seq
 249998681     gbrod14.seq
 249654187     gbrod15.seq
 249795636     gbrod16.seq
 249893309     gbrod17.seq
 249860758     gbrod18.seq
 118247388     gbrod19.seq
 249741922     gbrod2.seq
 249831480     gbrod20.seq
 249887334     gbrod21.seq
 226629375     gbrod22.seq
 249998050     gbrod23.seq
 249993768     gbrod24.seq
 249968171     gbrod25.seq
 249906944     gbrod26.seq
 249999245     gbrod27.seq
 249999982     gbrod28.seq
  91135244     gbrod29.seq
 249820696     gbrod3.seq
 249819841     gbrod4.seq
 249929825     gbrod5.seq
 249836639     gbrod6.seq
 249819169     gbrod7.seq
 249863250     gbrod8.seq
 249774732     gbrod9.seq
2733746497     gbsdr1.txt
5324171667     gbsdr2.txt
2267542399     gbsdr3.txt
 140265809     gbsec.idx
 249997830     gbsts1.seq
 249997362     gbsts10.seq
 212226966     gbsts11.seq
 249996524     gbsts12.seq
 249999647     gbsts13.seq
 249999279     gbsts14.seq
 249998816     gbsts15.seq
  27202671     gbsts16.seq
 249999776     gbsts17.seq
 249996039     gbsts18.seq
 250000037     gbsts19.seq
 249996491     gbsts2.seq
 145889771     gbsts20.seq
 249999014     gbsts3.seq
 249996049     gbsts4.seq
  36359470     gbsts5.seq
 249997222     gbsts6.seq
 249997899     gbsts7.seq
 249998458     gbsts8.seq
 249997742     gbsts9.seq
 249995841     gbsyn1.seq
 245603652     gbsyn2.seq
 250000157     gbtsa1.seq
 250000239     gbtsa2.seq
 249999458     gbtsa3.seq
 249998750     gbtsa4.seq
 249998140     gbtsa5.seq
 249997913     gbtsa6.seq
 249999645     gbtsa7.seq
 200927168     gbtsa8.seq
    447342     gbuna1.seq
 249996033     gbvrl1.seq
 249998236     gbvrl10.seq
 249996001     gbvrl11.seq
 249999323     gbvrl12.seq
 249999293     gbvrl13.seq
 249999858     gbvrl14.seq
  61756910     gbvrl15.seq
 249996929     gbvrl2.seq
 249997551     gbvrl3.seq
 249999235     gbvrl4.seq
 143011544     gbvrl5.seq
 249996894     gbvrl6.seq
 249641226     gbvrl7.seq
 249999049     gbvrl8.seq
 249992221     gbvrl9.seq
 249926289     gbvrt1.seq
 249912130     gbvrt10.seq
 249925637     gbvrt11.seq
 178623653     gbvrt12.seq
 249996597     gbvrt13.seq
 249809328     gbvrt14.seq
 249898118     gbvrt15.seq
 249998954     gbvrt16.seq
 249999338     gbvrt17.seq
 249999589     gbvrt18.seq
 249997891     gbvrt19.seq
 250000182     gbvrt2.seq
 249999027     gbvrt20.seq
 209265618     gbvrt21.seq
 249942330     gbvrt3.seq
 249999301     gbvrt4.seq
  53882745     gbvrt5.seq
 249993856     gbvrt6.seq
 249999716     gbvrt7.seq
 249759737     gbvrt8.seq
 249799975     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         51396      92682287
BCT10        63         117808727
BCT11        10868      111824820
BCT12        5334       6690886
BCT13        53942      85298414
BCT14        94         110535707
BCT15        151        96466604
BCT16        60         109557523
BCT17        52         112042350
BCT18        46         111873353
BCT19        57         113989395
BCT2         67         110496886
BCT20        67         112830215
BCT21        33         84321683
BCT22        40         106881287
BCT23        58         105533856
BCT24        74         111675186
BCT25        55         110045255
BCT26        63         106845562
BCT27        55         109391288
BCT28        52         108559385
BCT29        46         110496749
BCT3         53         112990171
BCT30        95         109522868
BCT31        58         106314881
BCT32        67         109486091
BCT33        123        105387189
BCT34        36         69419425
BCT35        205        111675451
BCT36        47         108478600
BCT37        41         101120280
BCT38        47         103394552
BCT39        57         101734644
BCT4         6961       107520768
BCT40        46         105858637
BCT41        69         107138126
BCT42        40         110112547
BCT43        61         106747949
BCT44        238        102524287
BCT45        388        53794732
BCT46        1589       2511823
BCT47        3177       5272446
BCT48        6347       7901828
BCT49        12648      15076611
BCT5         31491      51115577
BCT50        25628      27746631
BCT51        50513      53995753
BCT52        76625      77506514
BCT53        70442      75561477
BCT54        7571       100705218
BCT55        5150       114044138
BCT56        44         118145339
BCT57        44368      98724633
BCT58        80147      73863945
BCT59        23258      49685963
BCT6         39037      86917880
BCT7         6441       98377809
BCT8         14420      92819770
BCT9         5256       103968414
ENV1         93965      72054389
ENV10        83271      87142122
ENV11        18957      16614661
ENV12        85072      81012901
ENV13        120915     43285656
ENV14        91357      77400526
ENV15        97572      67240003
ENV16        107407     54321750
ENV17        68156      85900023
ENV18        20252      27316746
ENV19        69648      85531120
ENV2         89517      69532062
ENV20        98239      71031698
ENV21        126676     30669363
ENV22        121003     28954075
ENV23        58755      13058878
ENV24        123428     50053540
ENV25        113335     62894371
ENV26        135169     53914403
ENV27        84657      80384701
ENV28        76946      91839565
ENV29        80860      29071164
ENV3         83912      81408449
ENV4         88062      79573661
ENV5         90239      83613988
ENV6         53791      23680131
ENV7         131791     31268854
ENV8         86995      71081936
ENV9         94096      73435692
EST1         162618     63052492
EST10        171870     70626537
EST100       232608     144878530
EST101       222606     112987104
EST102       209188     103308824
EST103       161344     102925939
EST104       62843      53259033
EST105       168736     112745551
EST106       171261     112987315
EST107       113225     64499980
EST108       64234      23580670
EST109       64383      22860336
EST11        168733     73576895
EST110       64712      23769272
EST111       64630      27205326
EST112       64788      22266607
EST113       66048      26115561
EST114       64086      27885914
EST115       64671      26640292
EST116       64867      26841637
EST117       64658      25425559
EST118       61274      39721662
EST119       178185     85737653
EST12        196053     87520005
EST120       176372     84422340
EST121       155724     95546649
EST122       150427     94922057
EST123       158381     98575146
EST124       99338      56331451
EST125       207433     101508987
EST126       155194     80527028
EST127       162664     86293634
EST128       157518     90415916
EST129       157597     83172398
EST13        864        395815
EST130       177785     108103469
EST131       217230     116886743
EST132       169799     99715386
EST133       170251     80088041
EST134       153016     85823215
EST135       151904     90434842
EST136       163589     95316405
EST137       35894      19673461
EST138       194541     111000041
EST139       236065     104090250
EST14        223614     113018317
EST140       155833     92165982
EST141       172858     95028875
EST142       150062     86772234
EST143       136753     88854523
EST144       157481     93003023
EST145       149986     77235696
EST146       125308     65548772
EST147       124872     63642635
EST148       130510     55985735
EST149       129879     51457070
EST15        169723     108237769
EST150       131536     51830182
EST151       84310      31814360
EST152       175716     87978603
EST153       184611     84877453
EST154       160096     112138502
EST155       220919     132182745
EST156       220453     124703307
EST157       169935     91015945
EST158       144467     114110331
EST159       147866     93077511
EST16        187955     112359325
EST160       147266     83816747
EST161       146763     78040016
EST162       154981     92485145
EST163       165696     91865081
EST164       41200      25207713
EST165       158587     98248551
EST166       189637     106425591
EST167       152462     85082692
EST168       131426     68418606
EST169       180882     100060400
EST17        196184     121440315
EST170       175313     103687930
EST171       152610     92947898
EST172       173666     89170990
EST173       130739     83011431
EST174       194392     113834575
EST175       159106     90916345
EST176       114051     67435854
EST177       167072     97123191
EST178       172577     103545276
EST179       184765     132133246
EST18        194494     119206025
EST180       156935     112044631
EST181       191771     94122433
EST182       154400     117302340
EST183       150963     90310498
EST184       148635     79523940
EST185       174881     79800034
EST186       153097     85049444
EST187       160528     101835816
EST188       150321     90261739
EST189       164651     102196261
EST19        170919     115172746
EST190       118374     68093743
EST191       135800     91495812
EST192       133536     89649752
EST193       149196     91717390
EST194       133752     89632824
EST195       122888     86809964
EST196       184947     97602845
EST197       177680     98022956
EST198       177190     98321815
EST199       174402     97778693
EST2         164795     62096425
EST20        209060     109216912
EST200       172096     96258814
EST201       176297     98373334
EST202       177506     96673767
EST203       164703     90600433
EST204       195714     105959467
EST205       205983     109417946
EST206       179492     107964813
EST207       191828     109252188
EST208       201224     120921976
EST209       196087     120573551
EST21        226252     109993608
EST210       186711     120759981
EST211       187321     115357190
EST212       224413     146309193
EST213       237150     112793024
EST214       86914      57512572
EST215       147236     96209259
EST216       179413     99774044
EST217       196070     121681578
EST218       113180     89722431
EST219       134419     119381525
EST22        172538     48306895
EST220       166033     96623839
EST221       150910     102335050
EST222       211781     108256641
EST223       156392     104805208
EST224       138627     96813956
EST225       144209     104515887
EST226       122625     86843561
EST227       144886     90821334
EST228       74209      50523645
EST229       134805     97215322
EST23        128134     36975001
EST230       142310     101392776
EST231       122388     86601733
EST232       130760     86355766
EST233       163087     117438287
EST234       150473     118582029
EST235       134209     117825924
EST236       156249     96052083
EST237       182399     115391288
EST238       150069     95207260
EST239       183325     118998814
EST24        129581     42856291
EST240       164730     118280803
EST241       144340     108563974
EST242       120208     73792135
EST243       221274     99977732
EST244       183955     115381211
EST245       162651     82168637
EST246       226365     38631384
EST247       220371     88242358
EST248       173222     129588633
EST249       171473     102485685
EST25        71260      29598379
EST250       170903     112332254
EST251       171372     113797425
EST252       169232     119698625
EST253       195055     102832578
EST254       14099      5989091
EST255       185767     106820287
EST256       168584     119879699
EST257       210458     104966362
EST258       278664     121150170
EST259       220482     125972587
EST26        220412     101238376
EST260       186639     43361472
EST261       254490     117681380
EST262       167919     97248153
EST263       171070     108660488
EST264       163506     107266741
EST265       72420      50510182
EST266       206382     107298504
EST267       159461     108754477
EST268       199042     116830350
EST269       204068     48383479
EST27        225389     113326291
EST270       207065     48703909
EST271       188093     105871652
EST272       179205     120736526
EST273       176382     115689735
EST274       184923     105999441
EST275       150409     101200498
EST276       182188     81116680
EST277       42259      26741058
EST278       129022     85366686
EST279       158303     105457574
EST28        189024     86129600
EST280       275078     28819675
EST281       272463     30136968
EST282       149595     108325496
EST283       169333     115054712
EST284       164066     101475423
EST285       186146     81428976
EST286       247243     48038217
EST287       168302     113969192
EST288       158892     88117710
EST289       152062     86613633
EST29        162501     71117430
EST290       180731     125119333
EST291       201287     112946827
EST292       152621     114575243
EST293       196551     109387384
EST294       181989     102839498
EST295       180595     111288675
EST296       192201     64165244
EST297       190319     70612552
EST298       190643     73817074
EST299       192033     73024430
EST3         163201     58345239
EST30        174535     70158832
EST300       80281      40323489
EST301       184044     125534416
EST302       168476     102232832
EST303       158974     93623105
EST304       130769     98371879
EST305       151113     101060086
EST306       170031     103682133
EST307       168770     95040798
EST308       174666     104350935
EST309       156092     103750036
EST31        157353     67274287
EST310       151011     103363663
EST311       167914     109991482
EST312       164643     120184160
EST313       133128     112461466
EST314       179222     119567450
EST315       146255     79017768
EST316       145641     99362633
EST317       146819     100553743
EST318       135377     91232482
EST319       152590     101902668
EST32        171181     75333610
EST320       153680     103579595
EST321       182192     110004903
EST322       152903     88719187
EST323       154295     87588577
EST324       157072     114492930
EST325       163370     96904911
EST326       144316     92229032
EST327       66268      42110978
EST328       155072     96452433
EST329       210987     109677611
EST33        182202     75437352
EST330       131112     73542523
EST331       125077     81812064
EST332       136342     88033852
EST333       139140     87416638
EST334       140697     84609199
EST335       224959     88631038
EST336       182973     83117061
EST337       168325     104623053
EST338       169596     104119149
EST339       139282     87914351
EST34        99546      28172764
EST340       136347     91245179
EST341       19355      12591296
EST342       151492     97889956
EST343       188481     120765236
EST344       164750     90215313
EST345       183390     106229415
EST346       170396     127641265
EST347       74149      44229140
EST348       106586     58018965
EST349       139031     82789456
EST35        98358      30041810
EST350       139506     78171334
EST351       161748     33017450
EST352       161736     32969068
EST353       168108     73298424
EST354       212900     125136179
EST355       56129      26577175
EST356       259030     118298847
EST357       221263     109820491
EST358       151255     97507013
EST359       138193     88835571
EST36        98643      31221152
EST360       144065     87464811
EST361       184877     115467721
EST362       239585     85742205
EST363       188887     101129497
EST364       219479     127801941
EST365       145814     69797023
EST366       183560     112208379
EST367       142176     101323242
EST368       173487     133930510
EST369       176229     99320731
EST37        97479      29576059
EST370       187008     109208226
EST371       213435     132626049
EST372       195562     126744978
EST373       197260     108330462
EST374       193025     96121384
EST375       171964     13455737
EST376       159899     13902288
EST377       161032     30528271
EST378       108922     21937439
EST379       161979     32397676
EST38        99796      30272424
EST380       154443     72745226
EST381       173446     100920802
EST382       177052     120314618
EST383       170755     99595635
EST384       158367     110797714
EST385       141156     98495198
EST386       150078     102642549
EST387       163601     106435903
EST388       153669     110043731
EST389       172281     104544657
EST39        102282     30725330
EST390       177080     43572978
EST391       124462     27670328
EST392       161869     109135017
EST393       160551     105336637
EST394       180037     116389682
EST395       143178     83609155
EST396       198870     118855054
EST397       154654     108281087
EST398       136238     93175082
EST399       147569     92941619
EST4         174333     68723677
EST40        1299       333607
EST400       162090     97400583
EST401       177426     96428373
EST402       164419     97260014
EST403       168313     97871714
EST404       119345     76401214
EST405       145747     91077339
EST406       99289      71841914
EST407       98683      65546905
EST408       114984     72820295
EST409       130000     79362537
EST41        102104     53647249
EST410       138928     92008372
EST411       144444     85040848
EST412       165939     97904115
EST413       194164     116006961
EST414       129096     83066563
EST415       180598     88533353
EST416       178607     82879902
EST417       173583     60400532
EST418       141292     56193891
EST419       27524      8865774
EST42        122377     52117012
EST43        168953     87979778
EST44        170180     68560435
EST45        171847     92529934
EST46        175213     91717221
EST47        164833     81919324
EST48        166722     92410910
EST49        160106     90947988
EST5         171922     67392496
EST50        165558     94281306
EST51        163899     93617042
EST52        155054     75150970
EST53        154710     93385799
EST54        38444      16316608
EST55        171535     68638079
EST56        161978     77970060
EST57        174748     100029752
EST58        159329     99391908
EST59        162352     105846565
EST6         180145     70796163
EST60        168293     101691476
EST61        167054     108591187
EST62        177544     78403011
EST63        174778     102893094
EST64        152503     79638139
EST65        154419     88203811
EST66        159950     96389771
EST67        95516      55684075
EST68        146233     86436856
EST69        198982     110618345
EST7         170944     73677596
EST70        210850     110660302
EST71        206220     117289052
EST72        208006     122799746
EST73        197000     113880896
EST74        154224     80244985
EST75        137153     64353277
EST76        147484     76013735
EST77        158637     110121709
EST78        151771     81100204
EST79        148074     81376934
EST8         183640     73247547
EST80        15351      16856616
EST81        187557     96541480
EST82        219468     128509607
EST83        211917     113443481
EST84        222522     104755012
EST85        205236     90319005
EST86        152577     92374491
EST87        151540     81467594
EST88        169859     88970303
EST89        156598     85469767
EST9         170866     74309877
EST90        156111     100177518
EST91        155942     106483669
EST92        90620      47744669
EST93        155638     117824032
EST94        144443     106439975
EST95        149184     109591251
EST96        143276     86272832
EST97        164186     91357935
EST98        176033     111594519
EST99        258651     157872944
GSS1         205734     90150649
GSS10        136695     66629924
GSS100       85231      43057555
GSS101       195369     123709625
GSS102       171362     114185150
GSS103       201445     118370114
GSS104       207382     136061073
GSS105       215149     141913409
GSS106       213762     143291904
GSS107       209588     148457199
GSS108       210963     146711085
GSS109       209203     149196867
GSS11        138935     74785156
GSS110       206543     150945174
GSS111       157179     116851245
GSS112       135296     85656970
GSS113       173613     81339328
GSS114       192348     86762429
GSS115       176157     150349958
GSS116       183025     128347770
GSS117       188345     152145718
GSS118       195882     129459133
GSS119       192307     135651286
GSS12        150054     71654227
GSS120       200616     111543233
GSS121       178656     133105573
GSS122       105298     87382649
GSS123       87143      64110475
GSS124       83557      62797658
GSS125       103715     48631106
GSS126       68507      58445253
GSS127       7483       6882934
GSS128       68591      57924394
GSS129       69224      56650935
GSS13        147333     72027538
GSS130       69460      56187403
GSS131       71202      55998401
GSS132       68561      51865315
GSS133       75915      58209304
GSS134       87237      74898207
GSS135       81830      44609896
GSS136       93337      45141095
GSS137       56585      44297323
GSS138       77438      61353715
GSS139       69655      58699702
GSS14        180569     90576409
GSS140       67711      62707076
GSS141       61708      53240691
GSS142       95669      42996195
GSS143       21282      4964445
GSS144       112672     70634090
GSS145       1088       802743
GSS146       23226      28867035
GSS147       106621     69122590
GSS148       85457      35201726
GSS149       37313      23219225
GSS15        165382     96622869
GSS150       120402     72958896
GSS151       118337     75092514
GSS152       105426     63990802
GSS153       47835      23142546
GSS154       83102      54651503
GSS155       95630      61300959
GSS156       107319     78552403
GSS157       106422     76714273
GSS158       106058     79947480
GSS159       103996     80016519
GSS16        175067     92835151
GSS160       76376      51040365
GSS161       104570     63290945
GSS162       109868     66415305
GSS163       106323     59388992
GSS164       68303      37395892
GSS165       70143      39046688
GSS166       36533      17439317
GSS167       85481      46023427
GSS168       97119      55907586
GSS169       94982      49597190
GSS17        196513     125600575
GSS170       96286      55922591
GSS171       42132      23615490
GSS172       114638     43642267
GSS173       117085     39368203
GSS174       108676     55514545
GSS175       101471     78372335
GSS176       64751      40741499
GSS177       95891      36542252
GSS178       95417      37268709
GSS179       96671      35161518
GSS18        194707     106490747
GSS180       94285      39167432
GSS181       37736      17626556
GSS182       103939     66277823
GSS183       94551      61190929
GSS184       95128      60357048
GSS185       94773      60868501
GSS186       75456      69806637
GSS187       74978      73998303
GSS188       4831       7669769
GSS189       83736      28233267
GSS19        59868      25499423
GSS190       84219      27346468
GSS191       84926      25909272
GSS192       14851      4422302
GSS193       16547      7508221
GSS194       92689      59664938
GSS195       91830      47918099
GSS196       96591      58918705
GSS197       91409      63214368
GSS198       90320      64894337
GSS199       91055      63762453
GSS2         186322     94757793
GSS20        186916     105322671
GSS200       7388       5282976
GSS201       89694      65112997
GSS202       88507      68468390
GSS203       83716      79620870
GSS204       84143      79024203
GSS205       91362      77138736
GSS206       15143      11535858
GSS207       117650     64297121
GSS208       96973      62004430
GSS209       17943      10969369
GSS21        169128     115837914
GSS210       94787      57200301
GSS211       93517      59081345
GSS212       93900      58510429
GSS213       94714      57307691
GSS214       94279      58016121
GSS215       6701       3333254
GSS22        174105     99570598
GSS23        192370     138522209
GSS24        201028     123494489
GSS25        175473     104280524
GSS26        197040     119488100
GSS27        167864     161562680
GSS28        190630     134463101
GSS29        167157     120545269
GSS3         178459     89335772
GSS30        158820     105383349
GSS31        201673     130043244
GSS32        222403     119400836
GSS33        224622     116464658
GSS34        225847     114839954
GSS35        216729     131101319
GSS36        202761     159857338
GSS37        199139     148662682
GSS38        188477     55109967
GSS39        186238     106181369
GSS4         169841     86594903
GSS40        191342     138908239
GSS41        150760     135410398
GSS42        187622     102184708
GSS43        178149     125527365
GSS44        189653     127759858
GSS45        194850     125925807
GSS46        53414      50208238
GSS47        175398     104012483
GSS48        170991     105338695
GSS49        171834     105223965
GSS5         37546      23514942
GSS50        186392     124599449
GSS51        190585     117318545
GSS52        190206     125111512
GSS53        189027     119436089
GSS54        189615     132340201
GSS55        193150     112102497
GSS56        194517     124511688
GSS57        139591     107296251
GSS58        176473     141452510
GSS59        164987     113501389
GSS6         165168     86440527
GSS60        164771     113957518
GSS61        148748     100755802
GSS62        160481     131381765
GSS63        173038     144912671
GSS64        187480     121672582
GSS65        207363     129090534
GSS66        196671     113303674
GSS67        251735     131206010
GSS68        157515     105625559
GSS69        165278     126105180
GSS7         168811     80515106
GSS70        165920     126999175
GSS71        168047     126904498
GSS72        184852     114660920
GSS73        153962     113516805
GSS74        203898     129581823
GSS75        174122     114725440
GSS76        204934     135120851
GSS77        227902     77732994
GSS78        187536     114901615
GSS79        126182     93249278
GSS8         168972     90770583
GSS80        148474     119533273
GSS81        143019     118733147
GSS82        146599     118573830
GSS83        146520     121760115
GSS84        147284     120521132
GSS85        66930      55424194
GSS86        153116     125189801
GSS87        151211     119797782
GSS88        147162     116207653
GSS89        146029     118503290
GSS9         138700     67650953
GSS90        148214     123451508
GSS91        151860     123280024
GSS92        150921     121305900
GSS93        149486     124130828
GSS94        149686     123749626
GSS95        150354     122457322
GSS96        147975     115583746
GSS97        145074     117966230
GSS98        148906     124769101
GSS99        184775     128705163
HTC1         25159      27208661
HTC10        64076      67373886
HTC11        74795      76397922
HTC12        21268      31050416
HTC13        66997      61008541
HTC14        68361      69531096
HTC15        17522      12404805
HTC2         16159      36489828
HTC3         16143      36815637
HTC4         16384      35852120
HTC5         16085      40460286
HTC6         16179      37849495
HTC7         55285      33675773
HTC8         29048      15874509
HTC9         62293      77362082
HTG1         1318       188816333
HTG10        1297       186286287
HTG100       990        189460897
HTG101       997        189394206
HTG102       985        189419172
HTG103       1163       190488306
HTG104       31         4345532
HTG105       1091       189603529
HTG106       1041       189737553
HTG107       1399       191369786
HTG108       1313       190854948
HTG109       1622       191092546
HTG11        9          1245953
HTG110       1390       191743650
HTG111       1364       190196278
HTG112       1093       190038828
HTG113       919        147520837
HTG114       1515       182294205
HTG115       988        192222616
HTG116       739        168801207
HTG117       1087       193647321
HTG118       1100       193039310
HTG119       467        86828533
HTG12        1451       183812880
HTG120       1031       189886143
HTG121       1054       192607813
HTG122       1162       192127610
HTG123       1085       192943284
HTG124       1072       193159976
HTG125       736        128731707
HTG126       1120       192631869
HTG127       1088       192526314
HTG128       1080       192442112
HTG129       1089       192426857
HTG13        875        191570328
HTG130       1087       191928100
HTG131       1075       192189464
HTG132       1081       192240424
HTG133       1115       192065451
HTG134       827        190705526
HTG135       388        38318201
HTG14        750        192192484
HTG15        745        192079551
HTG16        784        191991252
HTG17        800        191673948
HTG18        770        191911891
HTG19        2068       170761948
HTG2         2464       186026155
HTG20        1091       187494615
HTG21        912        182507388
HTG22        785        191684696
HTG23        928        190159617
HTG24        906        190387593
HTG25        811        191268599
HTG26        784        191781819
HTG27        873        190949801
HTG28        897        190354118
HTG29        939        189892262
HTG3         2515       185243126
HTG30        910        190790072
HTG31        843        171585533
HTG32        875        191097672
HTG33        966        189315366
HTG34        884        190984364
HTG35        865        191179116
HTG36        826        191624339
HTG37        948        189894058
HTG38        949        190417008
HTG39        940        190044682
HTG4         2554       188402426
HTG40        1046       189062172
HTG41        1104       170230281
HTG42        1259       187949406
HTG43        1170       187985639
HTG44        1150       187972384
HTG45        1116       191079408
HTG46        1268       190655764
HTG47        1174       191044119
HTG48        1133       191313318
HTG49        1046       191200841
HTG5         1283       185543864
HTG50        1027       189685079
HTG51        1051       179615774
HTG52        969        190090757
HTG53        1106       190075891
HTG54        1045       190185372
HTG55        1014       189817413
HTG56        968        189209192
HTG57        89         15552204
HTG58        1010       189375905
HTG59        1030       189856620
HTG6         1273       185016781
HTG60        1069       187344650
HTG61        1129       188175020
HTG62        1003       173290341
HTG63        1085       189469529
HTG64        1065       189478336
HTG65        1169       188867797
HTG66        1177       187445142
HTG67        1283       184293866
HTG68        97         12761644
HTG69        1221       185314622
HTG7         1275       185326125
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187697719
HTG73        1032       172166470
HTG74        1118       188295824
HTG75        1102       190776880
HTG76        1137       190833452
HTG77        1182       190747635
HTG78        1104       187556657
HTG79        1171       190202159
HTG8         1459       184483094
HTG80        1115       190062476
HTG81        1213       189850345
HTG82        1120       189631269
HTG83        960        164861549
HTG84        1228       188383308
HTG85        1255       187800512
HTG86        1143       190038275
HTG87        1145       189655674
HTG88        996        170968832
HTG89        1179       189969442
HTG9         1200       186953640
HTG90        1109       190168110
HTG91        1145       190098913
HTG92        1098       190415845
HTG93        1014       167041593
HTG94        1056       190718504
HTG95        1156       190986055
HTG96        1037       189157087
HTG97        1070       189518990
HTG98        698        130036632
HTG99        1018       189742775
INV1         94012      48743855
INV10        57776      88392215
INV11        83705      65455705
INV12        53034      41878682
INV13        85034      66322255
INV14        80893      66926920
INV15        78671      67750656
INV16        37507      35734927
INV17        8168       145023213
INV18        320        155148771
INV19        29019      118868773
INV2         6346       176928107
INV20        76454      66002777
INV21        73230      61146957
INV22        75225      51584768
INV23        70236      55669565
INV24        18258      80048129
INV3         1037       166770400
INV4         26567      119616934
INV5         79521      71032363
INV6         34178      114030365
INV7         45857      100249700
INV8         1362       1071390
INV9         80647      71843409
MAM1         13990      163483013
MAM2         28459      144660644
MAM3         50567      96839062
MAM4         35209      144263234
MAM5         77849      82575468
MAM6         35748      47452969
PAT1         222542     70116699
PAT10        124671     102520366
PAT100       193712     81686401
PAT101       150217     108404022
PAT102       356051     11379688
PAT103       257211     57607099
PAT104       266090     51425150
PAT105       268710     45315201
PAT106       94335      72485595
PAT107       202624     47408098
PAT108       275088     9862650
PAT109       220268     46461610
PAT11        98176      64009641
PAT110       110638     2979117
PAT111       268989     21637646
PAT112       187202     59837899
PAT113       108381     107018097
PAT114       49882      10025985
PAT115       87373      88383023
PAT116       78489      95661640
PAT117       145556     77498667
PAT118       167279     71548587
PAT119       121577     92835468
PAT12        142111     62830898
PAT120       102764     85499924
PAT121       153480     60358177
PAT13        105850     59912061
PAT14        103664     50124377
PAT15        121031     53297038
PAT16        113131     61246366
PAT17        39249      16277156
PAT18        146866     52619866
PAT19        153883     78031245
PAT2         194544     84644913
PAT20        105015     118267861
PAT21        133364     95751197
PAT22        84491      78960929
PAT23        123529     103394713
PAT24        119449     105667073
PAT25        145590     86690543
PAT26        174982     64276623
PAT27        71450      1786250
PAT28        102173     77403263
PAT29        93960      87634560
PAT3         171983     95894231
PAT30        119941     61670405
PAT31        96647      78965449
PAT32        128380     55025764
PAT33        92209      51123393
PAT34        111299     78149541
PAT35        137077     29095801
PAT36        158182     23470638
PAT37        114368     49614838
PAT38        46528      54621498
PAT39        95733      83195520
PAT4         153734     106065135
PAT40        100229     70978738
PAT41        135055     39276665
PAT42        144345     33794787
PAT43        123793     64465837
PAT44        104069     81668191
PAT45        92445      75338805
PAT46        113581     66155429
PAT47        66704      55632142
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57197      23951583
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274454     6861350
PAT56        129252     31622558
PAT57        161320     77719729
PAT58        92887      89504257
PAT59        106652     74723970
PAT6         170642     91909261
PAT60        122358     64030477
PAT61        67218      30255991
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115295     60519183
PAT68        103216     9953783
PAT69        175346     10510347
PAT7         154824     88271839
PAT70        171510     10872527
PAT71        171496     10866712
PAT72        100446     86262564
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1136       196318666
PAT77        97600      5772327
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131192     97041292
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        66670      5727766
PAT84        342935     8573375
PAT85        188806     88519660
PAT86        111348     132068608
PAT87        3850       194703659
PAT88        131292     110979300
PAT89        158599     54826034
PAT9         129603     101127818
PAT90        224734     34113669
PAT91        250080     15844367
PAT92        180676     63676895
PAT93        51648      26046194
PAT94        114194     110462254
PAT95        137675     83270000
PAT96        164194     99292634
PAT97        158793     103369255
PAT98        137503     115011287
PAT99        42311      27994848
PHG1         5540       43456808
PLN1         59765      93335684
PLN10        37199      49290222
PLN11        37379      72563828
PLN12        14014      137473967
PLN13        7658       36936511
PLN14        17556      144689898
PLN15        17614      146132511
PLN16        17540      146254893
PLN17        24631      129062531
PLN18        5739       150765655
PLN19        1244       169457566
PLN2         21940      137478908
PLN20        15890      152623009
PLN21        5326       6393298
PLN22        67380      69807565
PLN23        28499      30771583
PLN24        76886      76245392
PLN25        65490      81535427
PLN26        41144      116539187
PLN27        16523      138662105
PLN28        19523      131093344
PLN29        77414      74166462
PLN3         1399       182127698
PLN30        92113      64351627
PLN31        45010      32631013
PLN32        80775      71157172
PLN33        77888      75907064
PLN34        80097      70458023
PLN35        81622      76661514
PLN36        45555      22308921
PLN37        101164     57634601
PLN38        81045      69123475
PLN39        45468      103013865
PLN4         1917       187650354
PLN40        78296      76080916
PLN41        80703      71487094
PLN42        47318      79877450
PLN5         1781       194376116
PLN6         18524      152119749
PLN7         75466      78953440
PLN8         5448       5098343
PLN9         73294      76126980
PRI1         23015      59645441
PRI10        1280       179500955
PRI11        744        90381918
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720991
PRI17        1137       193683608
PRI18        1099       194305908
PRI19        1166       193667129
PRI2         17504      150286275
PRI20        1778       192006998
PRI21        2797       189913530
PRI22        20270      52621174
PRI23        32483      85337157
PRI24        61487      78326126
PRI25        30556      68508260
PRI26        6602       167012246
PRI27        2120       180826269
PRI28        1603       181718304
PRI29        2030       181844962
PRI3         1435       175513824
PRI30        1976       180765380
PRI31        13058      154568425
PRI32        1295       183195058
PRI33        43859      104099795
PRI34        21440      27298328
PRI35        32191      63614159
PRI36        20231      117529774
PRI37        18695      146997934
PRI38        67426      87023249
PRI39        50262      89090447
PRI4         1288       185730305
PRI40        61179      95821482
PRI41        45463      83576799
PRI5         1317       183882869
PRI6         1181       180121261
PRI7         1250       181273461
PRI8         1216       178010512
PRI9         1360       174636998
ROD1         31630      141614861
ROD10        982        181189246
ROD11        206        38890959
ROD12        1034       185475616
ROD13        940        182704112
ROD14        1040       189324025
ROD15        950        180306408
ROD16        966        181926259
ROD17        991        185797836
ROD18        1189       190467109
ROD19        16291      62024067
ROD2         914        175158355
ROD20        20158      148888876
ROD21        1137       182363017
ROD22        1062       165597656
ROD23        13706      162709501
ROD24        38675      69921307
ROD25        21944      104101014
ROD26        1516       187886352
ROD27        137637     36990264
ROD28        83208      72944325
ROD29        24616      29620774
ROD3         908        173312966
ROD4         899        173867299
ROD5         922        174233402
ROD6         970        178319138
ROD7         965        179340883
ROD8         981        181303793
ROD9         997        182075524
STS1         85154      36500860
STS10        57907      44419978
STS11        49213      37736560
STS12        57924      43637361
STS13        64507      42945093
STS14        93331      34073542
STS15        103303     26251930
STS16        11141      3015718
STS17        102990     27289864
STS18        87041      34345853
STS19        98823      33227242
STS2         84773      49795698
STS20        54419      20091481
STS3         67392      26386214
STS4         75852      36964749
STS5         7839       4599878
STS6         54177      31603126
STS7         54081      31788805
STS8         54235      31906296
STS9         55657      37682948
SYN1         44565      72763853
SYN2         48029      69784502
TSA1         120497     38242009
TSA2         114117     41879217
TSA3         113260     42011774
TSA4         115084     44028031
TSA5         119975     55352967
TSA6         110086     75556306
TSA7         120663     63418340
TSA8         99757      38188201
UNA1         222        120289
VRL1         70653      67185699
VRL10        58184      72806621
VRL11        57538      72736980
VRL12        61848      71027814
VRL13        58814      71111278
VRL14        63956      72318431
VRL15        16855      17297345
VRL2         73012      64176224
VRL3         70999      62810671
VRL4         69410      70167912
VRL5         35349      39271446
VRL6         48394      77597977
VRL7         62417      71782229
VRL8         65590      69462531
VRL9         64325      70372087
VRT1         33540      137161017
VRT10        1256       189400524
VRT11        8281       178070276
VRT12        3957       131551292
VRT13        13177      170897930
VRT14        5275       182914197
VRT15        3950       186224988
VRT16        38962      132674897
VRT17        80078      68437060
VRT18        78245      67262368
VRT19        78313      65291745
VRT2         13096      175332417
VRT20        64144      95569566
VRT21        63845      54286042
VRT3         60673      95418198
VRT4         21850      152451377
VRT5         17465      14499548
VRT6         73019      66845355
VRT7         31736      63525935
VRT8         30248      115924583
VRT9         1205       190049946

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 179.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

14777279 14792487417   Homo sapiens
7868927   8859010528   Mus musculus
2179303   6443768086   Rattus norvegicus
2190553   5361712195   Bos taurus
3892588   5037629354   Zea mays
3218845   4783381701   Sus scrofa
1697981   3137945523   Danio rerio
228238    1352920226   Strongylocentrotus purpuratus
1243187   1197245122   Oryza sativa Japonica Group
1756444   1187388273   Nicotiana tabacum
1424176   1147132278   Xenopus (Silurana) tropicalis
1208293   1047707620   Drosophila melanogaster
213931    1001926471   Pan troglodytes
2293078   1001073627   Arabidopsis thaliana
1452547    943043649   Canis lupus familiaris
660561     913911649   Vitis vinifera
810244     891463513   Gallus gallus
1878867    886103518   Glycine max
82136      821393285   Macaca mulatta
1216410    748350657   Ciona intestinalis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          August 15 2010

                NCBI-GenBank Flat File Release 179.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 179.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,	Gert Roosen,
	Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade,	Constantin Vasilyev

User Support
	Peter Cooper, Wayne Matten, Scott McGinnis, Steve Pechous, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center