Release Notes For GenBank Release 180

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2010

               NCBI-GenBank Flat File Release 180.0

                    Distribution Release Notes

 125764384 loci, 118551641086 bases, from 125764384 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 180.0
1.2 Cutoff Date
1.3 Important Changes in Release 180.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 180.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 180.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 180.0, incorporates data available to the collaborating
databases as of October 15, 2010 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 180.0

1.3.1 Organizational changes

The total number of sequence data files increased by 26 with this release:

  - the BCT division is now composed of  60 files (+1)
  - the CON division is now composed of 142 files (+2)
  - the ENV division is now composed of  30 files (+1)
  - the EST division is now composed of 422 files (+3)
  - the GSS division is now composed of 217 files (+2)
  - the HTG division is now composed of 136 files (+1)
  - the INV division is now composed of  25 files (+1)
  - the PAT division is now composed of 128 files (+7)
  - the PLN division is now composed of  43 files (+1)
  - the PRI division is now composed of  42 files (+1)
  - the SYN division is now composed of   3 files (+1)
  - the TSA division is now composed of  12 files (+4)
  - the VRT division is now composed of  22 files (+1)

The total number of 'index' files increased by 6 with this release:

  - the AUT (author name)  index is now composed of 80 files (+5)
  - the JOU (journal name) index is now composed of 10 files (+1)

1.3.2 /artificial_location is now a controlled-value qualifier

  The /artificial_location is now a controlled-vocabulary qualifier,
with values of "heterogenous population sequenced" or "low-quality
sequence region", as of the October 2010 GenBank Release.

1.3.3 Discontinued qualifiers: /codon and /label

  With October's GenBank Release 180.0, both the /codon and /label
qualifiers have been discontinued.

  Existing /codon qualifiers have been replaced by the appropriate
/transl_except qualifier. If the /codon qualifier impacted multiple
protein residues of a coding region's translation, a /transl_except 
has been added for each such residue.

  The text from existing /label qualifiers have been moved to /note
qualifers of the features involved.

1.3.4 Discontinued feature: conflict

  The conflict feature has been discontinued as of the October 2010
GenBank Release. Existing conflict features have been converted to
misc_difference (which supports all of the qualifiers that conflict
used to).

1.3.5 New feature: mobile_element

  A new feature for the annotation of gene cassettes, transposons, and
insertion sequences is now supported as of this October 2010 GenBank
Release: mobile_element .

  This new feature has a mandatory /mobile_element_type qualifier, to 
provide information about the nature of the mobile element. At present,
this is a free-text qualifier.

  Existing repeat_region features that possessed /mobile_element qualifiers
have been converted to mobile_element features. All qualifiers other than
/mobile_element which have been legal for repeat_region are also supported
for mobile_element, and they were moved to the new feature during the
conversion.

  We expect that the /mobile_element qualifier will be discontinued within
a fairly short time.

1.3.6 Three previously-announced changes delayed

  Three of the Feature-Table changes that were agreed to at the May 2010
International Nucleotide Sequence Database Collaboration annual meeting,
and scheduled for October 2010 implementation, will be delayed. These
changes are:

	Discontinuation of the /partial qualifier.

	A classification system for /inference and /experiment.

	Introduction of the /whole_replicon qualifier.

See Section 1.4 (Upcoming Changes) for further details.

1.3.7 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.8 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
ninety-four of the GSS flatfiles in Release 180.0. Consider gbgss124.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                         October 15 2010

                NCBI-GenBank Flat File Release 180.0

                           GSS Sequences (Part 1)

   87146 loci,    64102517 bases, from    87146 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "124" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

  A variety of changes affecting the GenBank flatfile format were implemented
in October 2010, as a result of discussions among DDBJ, EBI, and NCBI at the
May 2010 International Nucleotide Sequence Database Collaboration annual
meeting.

  However, three of the planned changes could not be completed for this
October 15 GenBank 180.0 release:

a) The /partial qualifier will be discontinued, given that 5' and 3'
   partiality can be indicated via a feature's location ('<' and '>').

b) A classification system will be introduced for the /inference and
   /experiment qualifiers, such that the inferential or experimental
   information can be associated with a feature's existence, location,
   or description.

c) A /whole_replicon qualifier will be introduced, allowing records
   which represent the entirety of a replicon (a chromosome; an organelle;
   a mitochondrial plasmid) to be identified as such.

  An investigation of (a) for older sequence records has thrown into question
whether the /partial qualifier can actually be done away with. On-going
review over the next few weeks will determine whether this change will be
implemented as agreed, amended, or abandoned.

  The implementation of (b) has been delayed because of delays in software
development supporting the new classification system. However, those delays
are short-lived and we expect that the change will be completed well before
the December 2010 GenBank release.

  Specification of the conditions under which the /whole_replicon qualifier
is, and is not, allowed to be used for sequence records is not yet complete,
so implementation of (c) will likewise be delayed for a number of weeks.

  We will inform GenBank users when the issues impacting these three changes
have been clarified.

  
1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1475 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut9.idx - Index of the entries according to author name, part 9.
84. gbbct1.seq - Bacterial sequence entries, part 1.
85. gbbct10.seq - Bacterial sequence entries, part 10.
86. gbbct11.seq - Bacterial sequence entries, part 11.
87. gbbct12.seq - Bacterial sequence entries, part 12.
88. gbbct13.seq - Bacterial sequence entries, part 13.
89. gbbct14.seq - Bacterial sequence entries, part 14.
90. gbbct15.seq - Bacterial sequence entries, part 15.
91. gbbct16.seq - Bacterial sequence entries, part 16.
92. gbbct17.seq - Bacterial sequence entries, part 17.
93. gbbct18.seq - Bacterial sequence entries, part 18.
94. gbbct19.seq - Bacterial sequence entries, part 19.
95. gbbct2.seq - Bacterial sequence entries, part 2.
96. gbbct20.seq - Bacterial sequence entries, part 20.
97. gbbct21.seq - Bacterial sequence entries, part 21.
98. gbbct22.seq - Bacterial sequence entries, part 22.
99. gbbct23.seq - Bacterial sequence entries, part 23.
100. gbbct24.seq - Bacterial sequence entries, part 24.
101. gbbct25.seq - Bacterial sequence entries, part 25.
102. gbbct26.seq - Bacterial sequence entries, part 26.
103. gbbct27.seq - Bacterial sequence entries, part 27.
104. gbbct28.seq - Bacterial sequence entries, part 28.
105. gbbct29.seq - Bacterial sequence entries, part 29.
106. gbbct3.seq - Bacterial sequence entries, part 3.
107. gbbct30.seq - Bacterial sequence entries, part 30.
108. gbbct31.seq - Bacterial sequence entries, part 31.
109. gbbct32.seq - Bacterial sequence entries, part 32.
110. gbbct33.seq - Bacterial sequence entries, part 33.
111. gbbct34.seq - Bacterial sequence entries, part 34.
112. gbbct35.seq - Bacterial sequence entries, part 35.
113. gbbct36.seq - Bacterial sequence entries, part 36.
114. gbbct37.seq - Bacterial sequence entries, part 37.
115. gbbct38.seq - Bacterial sequence entries, part 38.
116. gbbct39.seq - Bacterial sequence entries, part 39.
117. gbbct4.seq - Bacterial sequence entries, part 4.
118. gbbct40.seq - Bacterial sequence entries, part 40.
119. gbbct41.seq - Bacterial sequence entries, part 41.
120. gbbct42.seq - Bacterial sequence entries, part 42.
121. gbbct43.seq - Bacterial sequence entries, part 43.
122. gbbct44.seq - Bacterial sequence entries, part 44.
123. gbbct45.seq - Bacterial sequence entries, part 45.
124. gbbct46.seq - Bacterial sequence entries, part 46.
125. gbbct47.seq - Bacterial sequence entries, part 47.
126. gbbct48.seq - Bacterial sequence entries, part 48.
127. gbbct49.seq - Bacterial sequence entries, part 49.
128. gbbct5.seq - Bacterial sequence entries, part 5.
129. gbbct50.seq - Bacterial sequence entries, part 50.
130. gbbct51.seq - Bacterial sequence entries, part 51.
131. gbbct52.seq - Bacterial sequence entries, part 52.
132. gbbct53.seq - Bacterial sequence entries, part 53.
133. gbbct54.seq - Bacterial sequence entries, part 54.
134. gbbct55.seq - Bacterial sequence entries, part 55.
135. gbbct56.seq - Bacterial sequence entries, part 56.
136. gbbct57.seq - Bacterial sequence entries, part 57.
137. gbbct58.seq - Bacterial sequence entries, part 58.
138. gbbct59.seq - Bacterial sequence entries, part 59.
139. gbbct6.seq - Bacterial sequence entries, part 6.
140. gbbct60.seq - Bacterial sequence entries, part 60.
141. gbbct7.seq - Bacterial sequence entries, part 7.
142. gbbct8.seq - Bacterial sequence entries, part 8.
143. gbbct9.seq - Bacterial sequence entries, part 9.
144. gbchg.txt - Accession numbers of entries updated since the previous release.
145. gbcon1.seq - Constructed sequence entries, part 1.
146. gbcon10.seq - Constructed sequence entries, part 10.
147. gbcon100.seq - Constructed sequence entries, part 100.
148. gbcon101.seq - Constructed sequence entries, part 101.
149. gbcon102.seq - Constructed sequence entries, part 102.
150. gbcon103.seq - Constructed sequence entries, part 103.
151. gbcon104.seq - Constructed sequence entries, part 104.
152. gbcon105.seq - Constructed sequence entries, part 105.
153. gbcon106.seq - Constructed sequence entries, part 106.
154. gbcon107.seq - Constructed sequence entries, part 107.
155. gbcon108.seq - Constructed sequence entries, part 108.
156. gbcon109.seq - Constructed sequence entries, part 109.
157. gbcon11.seq - Constructed sequence entries, part 11.
158. gbcon110.seq - Constructed sequence entries, part 110.
159. gbcon111.seq - Constructed sequence entries, part 111.
160. gbcon112.seq - Constructed sequence entries, part 112.
161. gbcon113.seq - Constructed sequence entries, part 113.
162. gbcon114.seq - Constructed sequence entries, part 114.
163. gbcon115.seq - Constructed sequence entries, part 115.
164. gbcon116.seq - Constructed sequence entries, part 116.
165. gbcon117.seq - Constructed sequence entries, part 117.
166. gbcon118.seq - Constructed sequence entries, part 118.
167. gbcon119.seq - Constructed sequence entries, part 119.
168. gbcon12.seq - Constructed sequence entries, part 12.
169. gbcon120.seq - Constructed sequence entries, part 120.
170. gbcon121.seq - Constructed sequence entries, part 121.
171. gbcon122.seq - Constructed sequence entries, part 122.
172. gbcon123.seq - Constructed sequence entries, part 123.
173. gbcon124.seq - Constructed sequence entries, part 124.
174. gbcon125.seq - Constructed sequence entries, part 125.
175. gbcon126.seq - Constructed sequence entries, part 126.
176. gbcon127.seq - Constructed sequence entries, part 127.
177. gbcon128.seq - Constructed sequence entries, part 128.
178. gbcon129.seq - Constructed sequence entries, part 129.
179. gbcon13.seq - Constructed sequence entries, part 13.
180. gbcon130.seq - Constructed sequence entries, part 130.
181. gbcon131.seq - Constructed sequence entries, part 131.
182. gbcon132.seq - Constructed sequence entries, part 132.
183. gbcon133.seq - Constructed sequence entries, part 133.
184. gbcon134.seq - Constructed sequence entries, part 134.
185. gbcon135.seq - Constructed sequence entries, part 135.
186. gbcon136.seq - Constructed sequence entries, part 136.
187. gbcon137.seq - Constructed sequence entries, part 137.
188. gbcon138.seq - Constructed sequence entries, part 138.
189. gbcon139.seq - Constructed sequence entries, part 139.
190. gbcon14.seq - Constructed sequence entries, part 14.
191. gbcon140.seq - Constructed sequence entries, part 140.
192. gbcon141.seq - Constructed sequence entries, part 141.
193. gbcon142.seq - Constructed sequence entries, part 142.
194. gbcon15.seq - Constructed sequence entries, part 15.
195. gbcon16.seq - Constructed sequence entries, part 16.
196. gbcon17.seq - Constructed sequence entries, part 17.
197. gbcon18.seq - Constructed sequence entries, part 18.
198. gbcon19.seq - Constructed sequence entries, part 19.
199. gbcon2.seq - Constructed sequence entries, part 2.
200. gbcon20.seq - Constructed sequence entries, part 20.
201. gbcon21.seq - Constructed sequence entries, part 21.
202. gbcon22.seq - Constructed sequence entries, part 22.
203. gbcon23.seq - Constructed sequence entries, part 23.
204. gbcon24.seq - Constructed sequence entries, part 24.
205. gbcon25.seq - Constructed sequence entries, part 25.
206. gbcon26.seq - Constructed sequence entries, part 26.
207. gbcon27.seq - Constructed sequence entries, part 27.
208. gbcon28.seq - Constructed sequence entries, part 28.
209. gbcon29.seq - Constructed sequence entries, part 29.
210. gbcon3.seq - Constructed sequence entries, part 3.
211. gbcon30.seq - Constructed sequence entries, part 30.
212. gbcon31.seq - Constructed sequence entries, part 31.
213. gbcon32.seq - Constructed sequence entries, part 32.
214. gbcon33.seq - Constructed sequence entries, part 33.
215. gbcon34.seq - Constructed sequence entries, part 34.
216. gbcon35.seq - Constructed sequence entries, part 35.
217. gbcon36.seq - Constructed sequence entries, part 36.
218. gbcon37.seq - Constructed sequence entries, part 37.
219. gbcon38.seq - Constructed sequence entries, part 38.
220. gbcon39.seq - Constructed sequence entries, part 39.
221. gbcon4.seq - Constructed sequence entries, part 4.
222. gbcon40.seq - Constructed sequence entries, part 40.
223. gbcon41.seq - Constructed sequence entries, part 41.
224. gbcon42.seq - Constructed sequence entries, part 42.
225. gbcon43.seq - Constructed sequence entries, part 43.
226. gbcon44.seq - Constructed sequence entries, part 44.
227. gbcon45.seq - Constructed sequence entries, part 45.
228. gbcon46.seq - Constructed sequence entries, part 46.
229. gbcon47.seq - Constructed sequence entries, part 47.
230. gbcon48.seq - Constructed sequence entries, part 48.
231. gbcon49.seq - Constructed sequence entries, part 49.
232. gbcon5.seq - Constructed sequence entries, part 5.
233. gbcon50.seq - Constructed sequence entries, part 50.
234. gbcon51.seq - Constructed sequence entries, part 51.
235. gbcon52.seq - Constructed sequence entries, part 52.
236. gbcon53.seq - Constructed sequence entries, part 53.
237. gbcon54.seq - Constructed sequence entries, part 54.
238. gbcon55.seq - Constructed sequence entries, part 55.
239. gbcon56.seq - Constructed sequence entries, part 56.
240. gbcon57.seq - Constructed sequence entries, part 57.
241. gbcon58.seq - Constructed sequence entries, part 58.
242. gbcon59.seq - Constructed sequence entries, part 59.
243. gbcon6.seq - Constructed sequence entries, part 6.
244. gbcon60.seq - Constructed sequence entries, part 60.
245. gbcon61.seq - Constructed sequence entries, part 61.
246. gbcon62.seq - Constructed sequence entries, part 62.
247. gbcon63.seq - Constructed sequence entries, part 63.
248. gbcon64.seq - Constructed sequence entries, part 64.
249. gbcon65.seq - Constructed sequence entries, part 65.
250. gbcon66.seq - Constructed sequence entries, part 66.
251. gbcon67.seq - Constructed sequence entries, part 67.
252. gbcon68.seq - Constructed sequence entries, part 68.
253. gbcon69.seq - Constructed sequence entries, part 69.
254. gbcon7.seq - Constructed sequence entries, part 7.
255. gbcon70.seq - Constructed sequence entries, part 70.
256. gbcon71.seq - Constructed sequence entries, part 71.
257. gbcon72.seq - Constructed sequence entries, part 72.
258. gbcon73.seq - Constructed sequence entries, part 73.
259. gbcon74.seq - Constructed sequence entries, part 74.
260. gbcon75.seq - Constructed sequence entries, part 75.
261. gbcon76.seq - Constructed sequence entries, part 76.
262. gbcon77.seq - Constructed sequence entries, part 77.
263. gbcon78.seq - Constructed sequence entries, part 78.
264. gbcon79.seq - Constructed sequence entries, part 79.
265. gbcon8.seq - Constructed sequence entries, part 8.
266. gbcon80.seq - Constructed sequence entries, part 80.
267. gbcon81.seq - Constructed sequence entries, part 81.
268. gbcon82.seq - Constructed sequence entries, part 82.
269. gbcon83.seq - Constructed sequence entries, part 83.
270. gbcon84.seq - Constructed sequence entries, part 84.
271. gbcon85.seq - Constructed sequence entries, part 85.
272. gbcon86.seq - Constructed sequence entries, part 86.
273. gbcon87.seq - Constructed sequence entries, part 87.
274. gbcon88.seq - Constructed sequence entries, part 88.
275. gbcon89.seq - Constructed sequence entries, part 89.
276. gbcon9.seq - Constructed sequence entries, part 9.
277. gbcon90.seq - Constructed sequence entries, part 90.
278. gbcon91.seq - Constructed sequence entries, part 91.
279. gbcon92.seq - Constructed sequence entries, part 92.
280. gbcon93.seq - Constructed sequence entries, part 93.
281. gbcon94.seq - Constructed sequence entries, part 94.
282. gbcon95.seq - Constructed sequence entries, part 95.
283. gbcon96.seq - Constructed sequence entries, part 96.
284. gbcon97.seq - Constructed sequence entries, part 97.
285. gbcon98.seq - Constructed sequence entries, part 98.
286. gbcon99.seq - Constructed sequence entries, part 99.
287. gbdel.txt - Accession numbers of entries deleted since the previous release.
288. gbenv1.seq - Environmental sampling sequence entries, part 1.
289. gbenv10.seq - Environmental sampling sequence entries, part 10.
290. gbenv11.seq - Environmental sampling sequence entries, part 11.
291. gbenv12.seq - Environmental sampling sequence entries, part 12.
292. gbenv13.seq - Environmental sampling sequence entries, part 13.
293. gbenv14.seq - Environmental sampling sequence entries, part 14.
294. gbenv15.seq - Environmental sampling sequence entries, part 15.
295. gbenv16.seq - Environmental sampling sequence entries, part 16.
296. gbenv17.seq - Environmental sampling sequence entries, part 17.
297. gbenv18.seq - Environmental sampling sequence entries, part 18.
298. gbenv19.seq - Environmental sampling sequence entries, part 19.
299. gbenv2.seq - Environmental sampling sequence entries, part 2.
300. gbenv20.seq - Environmental sampling sequence entries, part 20.
301. gbenv21.seq - Environmental sampling sequence entries, part 21.
302. gbenv22.seq - Environmental sampling sequence entries, part 22.
303. gbenv23.seq - Environmental sampling sequence entries, part 23.
304. gbenv24.seq - Environmental sampling sequence entries, part 24.
305. gbenv25.seq - Environmental sampling sequence entries, part 25.
306. gbenv26.seq - Environmental sampling sequence entries, part 26.
307. gbenv27.seq - Environmental sampling sequence entries, part 27.
308. gbenv28.seq - Environmental sampling sequence entries, part 28.
309. gbenv29.seq - Environmental sampling sequence entries, part 29.
310. gbenv3.seq - Environmental sampling sequence entries, part 3.
311. gbenv30.seq - Environmental sampling sequence entries, part 30.
312. gbenv4.seq - Environmental sampling sequence entries, part 4.
313. gbenv5.seq - Environmental sampling sequence entries, part 5.
314. gbenv6.seq - Environmental sampling sequence entries, part 6.
315. gbenv7.seq - Environmental sampling sequence entries, part 7.
316. gbenv8.seq - Environmental sampling sequence entries, part 8.
317. gbenv9.seq - Environmental sampling sequence entries, part 9.
318. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
319. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
320. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
321. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
322. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
323. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
324. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
325. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
326. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
327. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
328. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
329. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
330. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
331. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
332. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
333. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
334. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
335. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
336. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
337. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
338. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
339. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
340. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
341. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
342. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
343. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
344. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
345. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
346. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
347. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
348. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
349. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
350. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
351. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
352. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
353. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
354. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
355. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
356. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
357. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
358. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
359. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
360. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
361. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
362. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
363. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
364. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
365. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
366. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
367. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
368. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
369. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
370. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
371. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
372. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
373. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
374. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
375. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
376. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
377. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
378. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
379. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
380. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
381. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
382. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
383. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
384. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
385. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
386. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
387. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
388. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
389. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
390. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
391. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
392. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
393. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
394. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
395. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
396. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
397. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
398. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
399. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
400. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
401. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
402. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
403. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
404. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
405. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
406. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
407. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
408. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
409. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
410. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
411. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
412. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
413. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
414. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
415. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
416. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
417. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
418. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
419. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
420. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
421. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
422. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
423. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
424. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
425. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
426. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
427. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
428. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
429. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
430. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
431. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
432. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
433. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
434. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
435. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
436. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
437. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
438. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
439. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
440. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
441. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
442. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
443. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
444. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
445. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
446. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
447. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
448. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
449. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
450. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
451. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
452. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
453. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
454. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
455. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
456. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
457. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
458. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
459. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
460. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
461. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
462. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
463. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
464. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
465. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
466. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
467. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
468. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
469. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
470. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
471. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
472. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
473. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
474. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
475. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
476. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
477. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
478. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
479. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
480. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
481. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
482. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
483. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
484. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
485. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
486. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
487. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
488. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
489. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
490. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
491. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
492. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
493. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
494. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
495. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
496. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
497. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
498. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
499. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
500. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
501. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
502. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
503. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
504. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
505. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
506. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
507. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
508. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
509. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
510. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
511. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
512. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
513. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
514. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
515. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
516. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
517. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
518. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
519. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
520. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
521. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
522. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
523. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
524. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
525. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
526. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
527. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
528. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
529. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
530. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
531. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
532. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
533. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
534. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
535. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
536. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
537. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
538. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
539. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
540. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
541. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
542. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
543. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
544. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
545. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
546. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
547. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
548. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
549. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
550. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
551. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
552. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
553. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
554. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
555. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
556. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
557. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
558. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
559. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
560. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
561. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
562. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
563. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
564. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
565. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
566. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
567. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
568. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
569. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
570. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
571. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
572. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
573. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
574. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
575. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
576. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
577. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
578. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
579. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
580. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
581. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
582. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
583. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
584. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
585. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
586. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
587. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
588. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
589. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
590. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
591. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
592. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
593. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
594. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
595. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
596. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
597. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
598. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
599. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
600. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
601. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
602. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
603. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
604. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
605. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
606. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
607. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
608. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
609. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
610. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
611. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
612. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
613. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
614. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
615. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
616. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
617. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
618. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
619. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
620. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
621. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
622. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
623. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
624. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
625. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
626. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
627. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
628. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
629. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
630. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
631. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
632. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
633. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
634. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
635. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
636. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
637. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
638. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
639. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
640. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
641. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
642. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
643. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
644. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
645. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
646. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
647. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
648. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
649. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
650. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
651. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
652. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
653. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
654. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
655. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
656. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
657. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
658. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
659. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
660. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
661. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
662. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
663. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
664. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
665. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
666. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
667. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
668. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
669. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
670. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
671. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
672. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
673. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
674. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
675. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
676. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
677. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
678. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
679. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
680. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
681. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
682. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
683. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
684. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
685. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
686. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
687. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
688. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
689. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
690. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
691. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
692. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
693. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
694. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
695. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
696. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
697. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
698. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
699. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
700. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
701. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
702. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
703. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
704. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
705. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
706. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
707. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
708. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
709. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
710. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
711. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
712. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
713. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
714. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
715. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
716. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
717. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
718. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
719. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
720. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
721. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
722. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
723. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
724. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
725. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
726. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
727. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
728. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
729. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
730. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
731. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
732. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
733. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
734. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
735. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
736. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
737. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
738. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
739. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
740. gbgen.idx - Index of the entries according to gene symbols.
741. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
742. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
743. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
744. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
745. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
746. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
747. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
748. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
749. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
750. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
751. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
752. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
753. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
754. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
755. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
756. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
757. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
758. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
759. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
760. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
761. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
762. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
763. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
764. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
765. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
766. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
767. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
768. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
769. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
770. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
771. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
772. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
773. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
774. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
775. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
776. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
777. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
778. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
779. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
780. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
781. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
782. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
783. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
784. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
785. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
786. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
787. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
788. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
789. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
790. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
791. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
792. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
793. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
794. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
795. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
796. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
797. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
798. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
799. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
800. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
801. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
802. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
803. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
804. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
805. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
806. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
807. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
808. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
809. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
810. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
811. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
812. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
813. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
814. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
815. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
816. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
817. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
818. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
819. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
820. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
821. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
822. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
823. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
824. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
825. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
826. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
827. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
828. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
829. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
830. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
831. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
832. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
833. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
834. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
835. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
836. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
837. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
838. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
839. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
840. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
841. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
842. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
843. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
844. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
845. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
846. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
847. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
848. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
849. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
850. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
851. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
852. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
853. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
854. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
855. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
856. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
857. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
858. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
859. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
860. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
861. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
862. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
863. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
864. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
865. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
866. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
867. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
868. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
869. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
870. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
871. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
872. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
873. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
874. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
875. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
876. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
877. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
878. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
879. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
880. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
881. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
882. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
883. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
884. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
885. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
886. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
887. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
888. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
889. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
890. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
891. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
892. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
893. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
894. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
895. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
896. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
897. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
898. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
899. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
900. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
901. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
902. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
903. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
904. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
905. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
906. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
907. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
908. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
909. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
910. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
911. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
912. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
913. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
914. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
915. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
916. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
917. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
918. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
919. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
920. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
921. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
922. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
923. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
924. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
925. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
926. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
927. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
928. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
929. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
930. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
931. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
932. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
933. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
934. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
935. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
936. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
937. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
938. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
939. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
940. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
941. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
942. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
943. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
944. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
945. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
946. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
947. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
948. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
949. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
950. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
951. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
952. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
953. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
954. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
955. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
956. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
957. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
958. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
959. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
960. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
961. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
962. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
963. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
964. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
965. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
966. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
967. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
968. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
969. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
970. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
971. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
972. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
973. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
974. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
975. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
976. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
977. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
978. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
979. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
980. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
981. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
982. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
983. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
984. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
985. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
986. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
987. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
988. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
989. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
990. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
991. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
992. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
993. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
994. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
995. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
996. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
997. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
998. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
999. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1000. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1001. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1002. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1003. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1004. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1005. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1006. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1007. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1008. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1009. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1010. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1011. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1012. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1013. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1014. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1015. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1016. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1017. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1018. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1019. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1020. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1021. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1022. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1023. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1024. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1025. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1026. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1027. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1028. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1029. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1030. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1031. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1032. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1033. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1034. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1035. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1036. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1037. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1038. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1039. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1040. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1041. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1042. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1043. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1044. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1045. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1046. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1047. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1048. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1049. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1050. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1051. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1052. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1053. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1054. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1055. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1056. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1057. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1058. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1059. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1060. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1061. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1062. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1063. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1064. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1065. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1066. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1067. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1068. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1069. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1070. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1071. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1072. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1073. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1074. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1075. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1076. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1077. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1078. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1079. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1080. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1081. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1082. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1083. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1084. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1085. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1086. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1087. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1088. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1089. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1090. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1091. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1092. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1093. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1094. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1095. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1096. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1097. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1098. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1099. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1100. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1101. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1102. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1103. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1104. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1105. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1106. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1107. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1108. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1109. gbinv1.seq - Invertebrate sequence entries, part 1.
1110. gbinv10.seq - Invertebrate sequence entries, part 10.
1111. gbinv11.seq - Invertebrate sequence entries, part 11.
1112. gbinv12.seq - Invertebrate sequence entries, part 12.
1113. gbinv13.seq - Invertebrate sequence entries, part 13.
1114. gbinv14.seq - Invertebrate sequence entries, part 14.
1115. gbinv15.seq - Invertebrate sequence entries, part 15.
1116. gbinv16.seq - Invertebrate sequence entries, part 16.
1117. gbinv17.seq - Invertebrate sequence entries, part 17.
1118. gbinv18.seq - Invertebrate sequence entries, part 18.
1119. gbinv19.seq - Invertebrate sequence entries, part 19.
1120. gbinv2.seq - Invertebrate sequence entries, part 2.
1121. gbinv20.seq - Invertebrate sequence entries, part 20.
1122. gbinv21.seq - Invertebrate sequence entries, part 21.
1123. gbinv22.seq - Invertebrate sequence entries, part 22.
1124. gbinv23.seq - Invertebrate sequence entries, part 23.
1125. gbinv24.seq - Invertebrate sequence entries, part 24.
1126. gbinv25.seq - Invertebrate sequence entries, part 25.
1127. gbinv3.seq - Invertebrate sequence entries, part 3.
1128. gbinv4.seq - Invertebrate sequence entries, part 4.
1129. gbinv5.seq - Invertebrate sequence entries, part 5.
1130. gbinv6.seq - Invertebrate sequence entries, part 6.
1131. gbinv7.seq - Invertebrate sequence entries, part 7.
1132. gbinv8.seq - Invertebrate sequence entries, part 8.
1133. gbinv9.seq - Invertebrate sequence entries, part 9.
1134. gbjou1.idx - Index of the entries according to journal citation, part 1.
1135. gbjou10.idx - Index of the entries according to journal citation, part 10.
1136. gbjou2.idx - Index of the entries according to journal citation, part 2.
1137. gbjou3.idx - Index of the entries according to journal citation, part 3.
1138. gbjou4.idx - Index of the entries according to journal citation, part 4.
1139. gbjou5.idx - Index of the entries according to journal citation, part 5.
1140. gbjou6.idx - Index of the entries according to journal citation, part 6.
1141. gbjou7.idx - Index of the entries according to journal citation, part 7.
1142. gbjou8.idx - Index of the entries according to journal citation, part 8.
1143. gbjou9.idx - Index of the entries according to journal citation, part 9.
1144. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1145. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1146. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1147. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1148. gbmam1.seq - Other mammalian sequence entries, part 1.
1149. gbmam2.seq - Other mammalian sequence entries, part 2.
1150. gbmam3.seq - Other mammalian sequence entries, part 3.
1151. gbmam4.seq - Other mammalian sequence entries, part 4.
1152. gbmam5.seq - Other mammalian sequence entries, part 5.
1153. gbmam6.seq - Other mammalian sequence entries, part 6.
1154. gbnew.txt - Accession numbers of entries new since the previous release.
1155. gbpat1.seq - Patent sequence entries, part 1.
1156. gbpat10.seq - Patent sequence entries, part 10.
1157. gbpat100.seq - Patent sequence entries, part 100.
1158. gbpat101.seq - Patent sequence entries, part 101.
1159. gbpat102.seq - Patent sequence entries, part 102.
1160. gbpat103.seq - Patent sequence entries, part 103.
1161. gbpat104.seq - Patent sequence entries, part 104.
1162. gbpat105.seq - Patent sequence entries, part 105.
1163. gbpat106.seq - Patent sequence entries, part 106.
1164. gbpat107.seq - Patent sequence entries, part 107.
1165. gbpat108.seq - Patent sequence entries, part 108.
1166. gbpat109.seq - Patent sequence entries, part 109.
1167. gbpat11.seq - Patent sequence entries, part 11.
1168. gbpat110.seq - Patent sequence entries, part 110.
1169. gbpat111.seq - Patent sequence entries, part 111.
1170. gbpat112.seq - Patent sequence entries, part 112.
1171. gbpat113.seq - Patent sequence entries, part 113.
1172. gbpat114.seq - Patent sequence entries, part 114.
1173. gbpat115.seq - Patent sequence entries, part 115.
1174. gbpat116.seq - Patent sequence entries, part 116.
1175. gbpat117.seq - Patent sequence entries, part 117.
1176. gbpat118.seq - Patent sequence entries, part 118.
1177. gbpat119.seq - Patent sequence entries, part 119.
1178. gbpat12.seq - Patent sequence entries, part 12.
1179. gbpat120.seq - Patent sequence entries, part 120.
1180. gbpat121.seq - Patent sequence entries, part 121.
1181. gbpat122.seq - Patent sequence entries, part 122.
1182. gbpat123.seq - Patent sequence entries, part 123.
1183. gbpat124.seq - Patent sequence entries, part 124.
1184. gbpat125.seq - Patent sequence entries, part 125.
1185. gbpat126.seq - Patent sequence entries, part 126.
1186. gbpat127.seq - Patent sequence entries, part 127.
1187. gbpat128.seq - Patent sequence entries, part 128.
1188. gbpat13.seq - Patent sequence entries, part 13.
1189. gbpat14.seq - Patent sequence entries, part 14.
1190. gbpat15.seq - Patent sequence entries, part 15.
1191. gbpat16.seq - Patent sequence entries, part 16.
1192. gbpat17.seq - Patent sequence entries, part 17.
1193. gbpat18.seq - Patent sequence entries, part 18.
1194. gbpat19.seq - Patent sequence entries, part 19.
1195. gbpat2.seq - Patent sequence entries, part 2.
1196. gbpat20.seq - Patent sequence entries, part 20.
1197. gbpat21.seq - Patent sequence entries, part 21.
1198. gbpat22.seq - Patent sequence entries, part 22.
1199. gbpat23.seq - Patent sequence entries, part 23.
1200. gbpat24.seq - Patent sequence entries, part 24.
1201. gbpat25.seq - Patent sequence entries, part 25.
1202. gbpat26.seq - Patent sequence entries, part 26.
1203. gbpat27.seq - Patent sequence entries, part 27.
1204. gbpat28.seq - Patent sequence entries, part 28.
1205. gbpat29.seq - Patent sequence entries, part 29.
1206. gbpat3.seq - Patent sequence entries, part 3.
1207. gbpat30.seq - Patent sequence entries, part 30.
1208. gbpat31.seq - Patent sequence entries, part 31.
1209. gbpat32.seq - Patent sequence entries, part 32.
1210. gbpat33.seq - Patent sequence entries, part 33.
1211. gbpat34.seq - Patent sequence entries, part 34.
1212. gbpat35.seq - Patent sequence entries, part 35.
1213. gbpat36.seq - Patent sequence entries, part 36.
1214. gbpat37.seq - Patent sequence entries, part 37.
1215. gbpat38.seq - Patent sequence entries, part 38.
1216. gbpat39.seq - Patent sequence entries, part 39.
1217. gbpat4.seq - Patent sequence entries, part 4.
1218. gbpat40.seq - Patent sequence entries, part 40.
1219. gbpat41.seq - Patent sequence entries, part 41.
1220. gbpat42.seq - Patent sequence entries, part 42.
1221. gbpat43.seq - Patent sequence entries, part 43.
1222. gbpat44.seq - Patent sequence entries, part 44.
1223. gbpat45.seq - Patent sequence entries, part 45.
1224. gbpat46.seq - Patent sequence entries, part 46.
1225. gbpat47.seq - Patent sequence entries, part 47.
1226. gbpat48.seq - Patent sequence entries, part 48.
1227. gbpat49.seq - Patent sequence entries, part 49.
1228. gbpat5.seq - Patent sequence entries, part 5.
1229. gbpat50.seq - Patent sequence entries, part 50.
1230. gbpat51.seq - Patent sequence entries, part 51.
1231. gbpat52.seq - Patent sequence entries, part 52.
1232. gbpat53.seq - Patent sequence entries, part 53.
1233. gbpat54.seq - Patent sequence entries, part 54.
1234. gbpat55.seq - Patent sequence entries, part 55.
1235. gbpat56.seq - Patent sequence entries, part 56.
1236. gbpat57.seq - Patent sequence entries, part 57.
1237. gbpat58.seq - Patent sequence entries, part 58.
1238. gbpat59.seq - Patent sequence entries, part 59.
1239. gbpat6.seq - Patent sequence entries, part 6.
1240. gbpat60.seq - Patent sequence entries, part 60.
1241. gbpat61.seq - Patent sequence entries, part 61.
1242. gbpat62.seq - Patent sequence entries, part 62.
1243. gbpat63.seq - Patent sequence entries, part 63.
1244. gbpat64.seq - Patent sequence entries, part 64.
1245. gbpat65.seq - Patent sequence entries, part 65.
1246. gbpat66.seq - Patent sequence entries, part 66.
1247. gbpat67.seq - Patent sequence entries, part 67.
1248. gbpat68.seq - Patent sequence entries, part 68.
1249. gbpat69.seq - Patent sequence entries, part 69.
1250. gbpat7.seq - Patent sequence entries, part 7.
1251. gbpat70.seq - Patent sequence entries, part 70.
1252. gbpat71.seq - Patent sequence entries, part 71.
1253. gbpat72.seq - Patent sequence entries, part 72.
1254. gbpat73.seq - Patent sequence entries, part 73.
1255. gbpat74.seq - Patent sequence entries, part 74.
1256. gbpat75.seq - Patent sequence entries, part 75.
1257. gbpat76.seq - Patent sequence entries, part 76.
1258. gbpat77.seq - Patent sequence entries, part 77.
1259. gbpat78.seq - Patent sequence entries, part 78.
1260. gbpat79.seq - Patent sequence entries, part 79.
1261. gbpat8.seq - Patent sequence entries, part 8.
1262. gbpat80.seq - Patent sequence entries, part 80.
1263. gbpat81.seq - Patent sequence entries, part 81.
1264. gbpat82.seq - Patent sequence entries, part 82.
1265. gbpat83.seq - Patent sequence entries, part 83.
1266. gbpat84.seq - Patent sequence entries, part 84.
1267. gbpat85.seq - Patent sequence entries, part 85.
1268. gbpat86.seq - Patent sequence entries, part 86.
1269. gbpat87.seq - Patent sequence entries, part 87.
1270. gbpat88.seq - Patent sequence entries, part 88.
1271. gbpat89.seq - Patent sequence entries, part 89.
1272. gbpat9.seq - Patent sequence entries, part 9.
1273. gbpat90.seq - Patent sequence entries, part 90.
1274. gbpat91.seq - Patent sequence entries, part 91.
1275. gbpat92.seq - Patent sequence entries, part 92.
1276. gbpat93.seq - Patent sequence entries, part 93.
1277. gbpat94.seq - Patent sequence entries, part 94.
1278. gbpat95.seq - Patent sequence entries, part 95.
1279. gbpat96.seq - Patent sequence entries, part 96.
1280. gbpat97.seq - Patent sequence entries, part 97.
1281. gbpat98.seq - Patent sequence entries, part 98.
1282. gbpat99.seq - Patent sequence entries, part 99.
1283. gbphg1.seq - Phage sequence entries, part 1.
1284. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1285. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1286. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1287. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1288. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1289. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1290. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1291. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1292. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1293. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1294. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1295. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1296. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1297. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1298. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1299. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1300. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1301. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1302. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1303. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1304. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1305. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1306. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1307. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1308. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1309. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1310. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1311. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1312. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1313. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1314. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1315. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1316. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1317. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1318. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1319. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1320. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1321. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1322. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1323. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1324. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1325. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1326. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1327. gbpri1.seq - Primate sequence entries, part 1.
1328. gbpri10.seq - Primate sequence entries, part 10.
1329. gbpri11.seq - Primate sequence entries, part 11.
1330. gbpri12.seq - Primate sequence entries, part 12.
1331. gbpri13.seq - Primate sequence entries, part 13.
1332. gbpri14.seq - Primate sequence entries, part 14.
1333. gbpri15.seq - Primate sequence entries, part 15.
1334. gbpri16.seq - Primate sequence entries, part 16.
1335. gbpri17.seq - Primate sequence entries, part 17.
1336. gbpri18.seq - Primate sequence entries, part 18.
1337. gbpri19.seq - Primate sequence entries, part 19.
1338. gbpri2.seq - Primate sequence entries, part 2.
1339. gbpri20.seq - Primate sequence entries, part 20.
1340. gbpri21.seq - Primate sequence entries, part 21.
1341. gbpri22.seq - Primate sequence entries, part 22.
1342. gbpri23.seq - Primate sequence entries, part 23.
1343. gbpri24.seq - Primate sequence entries, part 24.
1344. gbpri25.seq - Primate sequence entries, part 25.
1345. gbpri26.seq - Primate sequence entries, part 26.
1346. gbpri27.seq - Primate sequence entries, part 27.
1347. gbpri28.seq - Primate sequence entries, part 28.
1348. gbpri29.seq - Primate sequence entries, part 29.
1349. gbpri3.seq - Primate sequence entries, part 3.
1350. gbpri30.seq - Primate sequence entries, part 30.
1351. gbpri31.seq - Primate sequence entries, part 31.
1352. gbpri32.seq - Primate sequence entries, part 32.
1353. gbpri33.seq - Primate sequence entries, part 33.
1354. gbpri34.seq - Primate sequence entries, part 34.
1355. gbpri35.seq - Primate sequence entries, part 35.
1356. gbpri36.seq - Primate sequence entries, part 36.
1357. gbpri37.seq - Primate sequence entries, part 37.
1358. gbpri38.seq - Primate sequence entries, part 38.
1359. gbpri39.seq - Primate sequence entries, part 39.
1360. gbpri4.seq - Primate sequence entries, part 4.
1361. gbpri40.seq - Primate sequence entries, part 40.
1362. gbpri41.seq - Primate sequence entries, part 41.
1363. gbpri42.seq - Primate sequence entries, part 42.
1364. gbpri5.seq - Primate sequence entries, part 5.
1365. gbpri6.seq - Primate sequence entries, part 6.
1366. gbpri7.seq - Primate sequence entries, part 7.
1367. gbpri8.seq - Primate sequence entries, part 8.
1368. gbpri9.seq - Primate sequence entries, part 9.
1369. gbrel.txt - Release notes (this document).
1370. gbrod1.seq - Rodent sequence entries, part 1.
1371. gbrod10.seq - Rodent sequence entries, part 10.
1372. gbrod11.seq - Rodent sequence entries, part 11.
1373. gbrod12.seq - Rodent sequence entries, part 12.
1374. gbrod13.seq - Rodent sequence entries, part 13.
1375. gbrod14.seq - Rodent sequence entries, part 14.
1376. gbrod15.seq - Rodent sequence entries, part 15.
1377. gbrod16.seq - Rodent sequence entries, part 16.
1378. gbrod17.seq - Rodent sequence entries, part 17.
1379. gbrod18.seq - Rodent sequence entries, part 18.
1380. gbrod19.seq - Rodent sequence entries, part 19.
1381. gbrod2.seq - Rodent sequence entries, part 2.
1382. gbrod20.seq - Rodent sequence entries, part 20.
1383. gbrod21.seq - Rodent sequence entries, part 21.
1384. gbrod22.seq - Rodent sequence entries, part 22.
1385. gbrod23.seq - Rodent sequence entries, part 23.
1386. gbrod24.seq - Rodent sequence entries, part 24.
1387. gbrod25.seq - Rodent sequence entries, part 25.
1388. gbrod26.seq - Rodent sequence entries, part 26.
1389. gbrod27.seq - Rodent sequence entries, part 27.
1390. gbrod28.seq - Rodent sequence entries, part 28.
1391. gbrod29.seq - Rodent sequence entries, part 29.
1392. gbrod3.seq - Rodent sequence entries, part 3.
1393. gbrod4.seq - Rodent sequence entries, part 4.
1394. gbrod5.seq - Rodent sequence entries, part 5.
1395. gbrod6.seq - Rodent sequence entries, part 6.
1396. gbrod7.seq - Rodent sequence entries, part 7.
1397. gbrod8.seq - Rodent sequence entries, part 8.
1398. gbrod9.seq - Rodent sequence entries, part 9.
1399. gbsdr1.txt - Short directory of the data bank, part 1.
1400. gbsdr2.txt - Short directory of the data bank, part 2.
1401. gbsdr3.txt - Short directory of the data bank, part 3.
1402. gbsec.idx - Index of the entries according to secondary accession number.
1403. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1404. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1405. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1406. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1407. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1408. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1409. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1410. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1411. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1412. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1413. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1414. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1415. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1416. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1417. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1418. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1419. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1420. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1421. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1422. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1423. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1424. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1425. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1426. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1427. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1428. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1429. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1430. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1431. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1432. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1433. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1434. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1435. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1436. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1437. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1438. gbuna1.seq - Unannotated sequence entries, part 1.
1439. gbvrl1.seq - Viral sequence entries, part 1.
1440. gbvrl10.seq - Viral sequence entries, part 10.
1441. gbvrl11.seq - Viral sequence entries, part 11.
1442. gbvrl12.seq - Viral sequence entries, part 12.
1443. gbvrl13.seq - Viral sequence entries, part 13.
1444. gbvrl14.seq - Viral sequence entries, part 14.
1445. gbvrl15.seq - Viral sequence entries, part 15.
1446. gbvrl2.seq - Viral sequence entries, part 2.
1447. gbvrl3.seq - Viral sequence entries, part 3.
1448. gbvrl4.seq - Viral sequence entries, part 4.
1449. gbvrl5.seq - Viral sequence entries, part 5.
1450. gbvrl6.seq - Viral sequence entries, part 6.
1451. gbvrl7.seq - Viral sequence entries, part 7.
1452. gbvrl8.seq - Viral sequence entries, part 8.
1453. gbvrl9.seq - Viral sequence entries, part 9.
1454. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1455. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1456. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1457. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1458. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1459. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1460. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1461. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1462. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1463. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1464. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1465. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1466. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1467. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1468. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1469. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1470. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1471. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1472. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1473. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1474. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1475. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 180.0 flatfiles require roughly 457 GB (sequence
files only) or 490 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1445813706     gbacc1.idx
2204990304     gbacc2.idx
 695760390     gbacc3.idx
 184884194     gbaut1.idx
 204773458     gbaut10.idx
 250500206     gbaut11.idx
 184098686     gbaut12.idx
 187217108     gbaut13.idx
 222471347     gbaut14.idx
 242042651     gbaut15.idx
 186802154     gbaut16.idx
 184834231     gbaut17.idx
 184823688     gbaut18.idx
 185538223     gbaut19.idx
 187650015     gbaut2.idx
 192176095     gbaut20.idx
 204249113     gbaut21.idx
 202846619     gbaut22.idx
 184407752     gbaut23.idx
 184335931     gbaut24.idx
 190942759     gbaut25.idx
 194170686     gbaut26.idx
 183787489     gbaut27.idx
 184764072     gbaut28.idx
 184990979     gbaut29.idx
 213083264     gbaut3.idx
 210204071     gbaut30.idx
 183944859     gbaut31.idx
 202067587     gbaut32.idx
 184562199     gbaut33.idx
 183890291     gbaut34.idx
 183820743     gbaut35.idx
 192473519     gbaut36.idx
 186389081     gbaut37.idx
 186460507     gbaut38.idx
 254750895     gbaut39.idx
 185013194     gbaut4.idx
 185262263     gbaut40.idx
 183937157     gbaut41.idx
 194448954     gbaut42.idx
 189729987     gbaut43.idx
 183934477     gbaut44.idx
 184276200     gbaut45.idx
 183844542     gbaut46.idx
 193214252     gbaut47.idx
 193520661     gbaut48.idx
 185795610     gbaut49.idx
 186971366     gbaut5.idx
 185752569     gbaut50.idx
 188003439     gbaut51.idx
 193568053     gbaut52.idx
 188378637     gbaut53.idx
 186176704     gbaut54.idx
 184400089     gbaut55.idx
 185320517     gbaut56.idx
 184956764     gbaut57.idx
 184060761     gbaut58.idx
 185775727     gbaut59.idx
 183844379     gbaut6.idx
 184573585     gbaut60.idx
 183755657     gbaut61.idx
 184824463     gbaut62.idx
 201384618     gbaut63.idx
 184721061     gbaut64.idx
 248708109     gbaut65.idx
 186670884     gbaut66.idx
 183952971     gbaut67.idx
 185631673     gbaut68.idx
 184019161     gbaut69.idx
 185804166     gbaut7.idx
 183853278     gbaut70.idx
 185304708     gbaut71.idx
 183912268     gbaut72.idx
 183889220     gbaut73.idx
 220619695     gbaut74.idx
 210016573     gbaut75.idx
 184361239     gbaut76.idx
 184191040     gbaut77.idx
 188391611     gbaut78.idx
 216030304     gbaut79.idx
 184921399     gbaut8.idx
  18774028     gbaut80.idx
 183925195     gbaut9.idx
 245234317     gbbct1.seq
 248119773     gbbct10.seq
 249995568     gbbct11.seq
  20201978     gbbct12.seq
 242909148     gbbct13.seq
 249684788     gbbct14.seq
 245030455     gbbct15.seq
 248595591     gbbct16.seq
 248185887     gbbct17.seq
 245867209     gbbct18.seq
 237826198     gbbct19.seq
 246931217     gbbct2.seq
 239571799     gbbct20.seq
 217750123     gbbct21.seq
 242691119     gbbct22.seq
 241410369     gbbct23.seq
 248565113     gbbct24.seq
 247802381     gbbct25.seq
 249349560     gbbct26.seq
 244148900     gbbct27.seq
 247096025     gbbct28.seq
 249960746     gbbct29.seq
 246562421     gbbct3.seq
 249717807     gbbct30.seq
 249787172     gbbct31.seq
 242897380     gbbct32.seq
 249121416     gbbct33.seq
 142296647     gbbct34.seq
 243836637     gbbct35.seq
 246981694     gbbct36.seq
 247858360     gbbct37.seq
 248263253     gbbct38.seq
 231741157     gbbct39.seq
 249998658     gbbct4.seq
 241941072     gbbct40.seq
 246885319     gbbct41.seq
 245621374     gbbct42.seq
 247129003     gbbct43.seq
 243247701     gbbct44.seq
 249883406     gbbct45.seq
 124732651     gbbct46.seq
   6878890     gbbct47.seq
  14080611     gbbct48.seq
  23152852     gbbct49.seq
 150804230     gbbct5.seq
  45032705     gbbct50.seq
  87673379     gbbct51.seq
 169914162     gbbct52.seq
 249998561     gbbct53.seq
 245941533     gbbct54.seq
 242211042     gbbct55.seq
 244051628     gbbct56.seq
 247497013     gbbct57.seq
 249989968     gbbct58.seq
 249999389     gbbct59.seq
 249349909     gbbct6.seq
 220596739     gbbct60.seq
 249816322     gbbct7.seq
 249981198     gbbct8.seq
 247134793     gbbct9.seq
   6826821     gbchg.txt
 249998938     gbcon1.seq
 249992870     gbcon10.seq
 249995445     gbcon100.seq
 249996667     gbcon101.seq
 249998797     gbcon102.seq
 249995641     gbcon103.seq
 156127743     gbcon104.seq
 249995214     gbcon105.seq
 249997693     gbcon106.seq
 249998761     gbcon107.seq
 249997855     gbcon108.seq
  71466271     gbcon109.seq
 249993110     gbcon11.seq
 249999780     gbcon110.seq
 249998466     gbcon111.seq
 233219812     gbcon112.seq
 250000256     gbcon113.seq
 250000098     gbcon114.seq
 249995503     gbcon115.seq
 249682205     gbcon116.seq
 158682237     gbcon117.seq
 249565434     gbcon118.seq
 249998941     gbcon119.seq
 249574468     gbcon12.seq
  14891407     gbcon120.seq
 249995963     gbcon121.seq
 249999409     gbcon122.seq
 250000251     gbcon123.seq
 249581155     gbcon124.seq
  11138979     gbcon125.seq
 249589305     gbcon126.seq
 248950449     gbcon127.seq
 249307716     gbcon128.seq
 249995915     gbcon129.seq
 247306877     gbcon13.seq
 249999233     gbcon130.seq
 161537553     gbcon131.seq
 250000158     gbcon132.seq
 250000013     gbcon133.seq
 249801968     gbcon134.seq
 249993762     gbcon135.seq
 249999846     gbcon136.seq
 248313252     gbcon137.seq
 249996371     gbcon138.seq
 249997052     gbcon139.seq
 249993059     gbcon14.seq
 249998676     gbcon140.seq
  64826016     gbcon141.seq
  21445522     gbcon142.seq
   5457488     gbcon15.seq
 250000059     gbcon16.seq
 249996360     gbcon17.seq
 209071098     gbcon18.seq
 249998658     gbcon19.seq
 248188797     gbcon2.seq
 249956705     gbcon20.seq
  96963359     gbcon21.seq
 249999785     gbcon22.seq
 120025218     gbcon23.seq
 249997576     gbcon24.seq
 249939133     gbcon25.seq
 249999101     gbcon26.seq
 249999374     gbcon27.seq
 201173220     gbcon28.seq
 249998460     gbcon29.seq
 249791108     gbcon3.seq
 250000050     gbcon30.seq
 249998405     gbcon31.seq
 249998847     gbcon32.seq
 249999310     gbcon33.seq
 195698166     gbcon34.seq
 249994638     gbcon35.seq
 249994355     gbcon36.seq
 249996557     gbcon37.seq
 249995872     gbcon38.seq
 249998504     gbcon39.seq
 249979031     gbcon4.seq
 249995403     gbcon40.seq
  60977708     gbcon41.seq
 249996893     gbcon42.seq
 249997617     gbcon43.seq
 249994634     gbcon44.seq
 249997569     gbcon45.seq
 249997343     gbcon46.seq
  42909814     gbcon47.seq
 249995915     gbcon48.seq
 249999280     gbcon49.seq
 249997226     gbcon5.seq
 249995710     gbcon50.seq
 249996631     gbcon51.seq
 249995091     gbcon52.seq
  36225425     gbcon53.seq
 249997103     gbcon54.seq
 249996724     gbcon55.seq
 249997253     gbcon56.seq
 249996527     gbcon57.seq
 249999884     gbcon58.seq
 152476914     gbcon59.seq
 249991121     gbcon6.seq
 249996992     gbcon60.seq
 249997178     gbcon61.seq
 249997201     gbcon62.seq
 249996856     gbcon63.seq
 183504539     gbcon64.seq
 249995931     gbcon65.seq
 249997041     gbcon66.seq
 249998416     gbcon67.seq
 249998317     gbcon68.seq
 245375145     gbcon69.seq
 249994857     gbcon7.seq
 249999551     gbcon70.seq
 249998271     gbcon71.seq
 249998133     gbcon72.seq
 249998704     gbcon73.seq
 249997871     gbcon74.seq
  96481205     gbcon75.seq
 250000212     gbcon76.seq
 249996110     gbcon77.seq
 249999860     gbcon78.seq
 249998416     gbcon79.seq
   6935327     gbcon8.seq
 250000165     gbcon80.seq
  62502628     gbcon81.seq
 249999807     gbcon82.seq
 249998139     gbcon83.seq
 249998956     gbcon84.seq
 249995391     gbcon85.seq
 249998511     gbcon86.seq
  21523692     gbcon87.seq
 249996875     gbcon88.seq
 249995114     gbcon89.seq
 249994769     gbcon9.seq
 249996256     gbcon90.seq
 249999714     gbcon91.seq
 197747900     gbcon92.seq
 249995224     gbcon93.seq
 249999439     gbcon94.seq
 249997468     gbcon95.seq
 249999950     gbcon96.seq
 249995004     gbcon97.seq
 133061783     gbcon98.seq
 249998329     gbcon99.seq
    315382     gbdel.txt
 249999388     gbenv1.seq
 249999105     gbenv10.seq
  52834122     gbenv11.seq
 249998913     gbenv12.seq
 249999119     gbenv13.seq
 249999582     gbenv14.seq
 249999755     gbenv15.seq
 249999356     gbenv16.seq
 249997898     gbenv17.seq
 119104901     gbenv18.seq
 250000078     gbenv19.seq
 249999085     gbenv2.seq
 250000057     gbenv20.seq
 249998885     gbenv21.seq
 249999296     gbenv22.seq
 124181291     gbenv23.seq
 249999419     gbenv24.seq
 249999834     gbenv25.seq
 250000010     gbenv26.seq
 249999006     gbenv27.seq
 249999732     gbenv28.seq
 249998674     gbenv29.seq
 250000043     gbenv3.seq
 215378606     gbenv30.seq
 249998582     gbenv4.seq
 249998994     gbenv5.seq
 126982567     gbenv6.seq
 249998525     gbenv7.seq
 249999524     gbenv8.seq
 249997476     gbenv9.seq
 524291627     gbest1.seq
 524290503     gbest10.seq
 524289988     gbest100.seq
 524289224     gbest101.seq
 524290574     gbest102.seq
 524288798     gbest103.seq
 209781571     gbest104.seq
 524290627     gbest105.seq
 524290525     gbest106.seq
 482468930     gbest107.seq
 386214110     gbest108.seq
 385739104     gbest109.seq
 524290785     gbest11.seq
 380693095     gbest110.seq
 381217036     gbest111.seq
 381807921     gbest112.seq
 379084959     gbest113.seq
 389877100     gbest114.seq
 385902396     gbest115.seq
 382537712     gbest116.seq
 381809106     gbest117.seq
 411443340     gbest118.seq
 524290434     gbest119.seq
 524289471     gbest12.seq
 524291453     gbest120.seq
 524291281     gbest121.seq
 524290812     gbest122.seq
 524291237     gbest123.seq
 361432255     gbest124.seq
 524289297     gbest125.seq
 524290919     gbest126.seq
 524289707     gbest127.seq
 524292131     gbest128.seq
 524290686     gbest129.seq
   1489972     gbest13.seq
 524290282     gbest130.seq
 524290954     gbest131.seq
 524290347     gbest132.seq
 524290865     gbest133.seq
 524290843     gbest134.seq
 524290971     gbest135.seq
 524289886     gbest136.seq
 124886408     gbest137.seq
 524290791     gbest138.seq
 524289286     gbest139.seq
 524289581     gbest14.seq
 524289570     gbest140.seq
 524290939     gbest141.seq
 524290534     gbest142.seq
 524289790     gbest143.seq
 524291800     gbest144.seq
 524289132     gbest145.seq
 524290344     gbest146.seq
 524288856     gbest147.seq
 524292794     gbest148.seq
 524291449     gbest149.seq
 524290016     gbest15.seq
 524290074     gbest150.seq
 325816280     gbest151.seq
 524291481     gbest152.seq
 524289160     gbest153.seq
 524290626     gbest154.seq
 524288745     gbest155.seq
 524289083     gbest156.seq
 524290293     gbest157.seq
 524290677     gbest158.seq
 524291047     gbest159.seq
 524290406     gbest16.seq
 464071321     gbest160.seq
 524293655     gbest161.seq
 524289371     gbest162.seq
 524291013     gbest163.seq
 127394577     gbest164.seq
 524290793     gbest165.seq
 524294558     gbest166.seq
 524290549     gbest167.seq
 524289954     gbest168.seq
 524290130     gbest169.seq
 524289390     gbest17.seq
 524290985     gbest170.seq
 524292970     gbest171.seq
 524290491     gbest172.seq
 524290842     gbest173.seq
 524290096     gbest174.seq
 524292214     gbest175.seq
 524290880     gbest176.seq
 478291819     gbest177.seq
 524291367     gbest178.seq
 524291134     gbest179.seq
 524289750     gbest18.seq
 524289197     gbest180.seq
 524289023     gbest181.seq
 524290882     gbest182.seq
 524289987     gbest183.seq
 524289345     gbest184.seq
 524289727     gbest185.seq
 524289590     gbest186.seq
 524290529     gbest187.seq
 524291093     gbest188.seq
 524290859     gbest189.seq
 524289283     gbest19.seq
 314552681     gbest190.seq
 524291153     gbest191.seq
 524290860     gbest192.seq
 524293723     gbest193.seq
 524290342     gbest194.seq
 524290585     gbest195.seq
 524291608     gbest196.seq
 524289225     gbest197.seq
 524290575     gbest198.seq
 524288849     gbest199.seq
 524290470     gbest2.seq
 524289723     gbest20.seq
 524290556     gbest200.seq
 524290911     gbest201.seq
 524289924     gbest202.seq
 485786778     gbest203.seq
 524290022     gbest204.seq
 524289475     gbest205.seq
 524289701     gbest206.seq
 524289201     gbest207.seq
 524288808     gbest208.seq
 524290207     gbest209.seq
 524289524     gbest21.seq
 524289306     gbest210.seq
 524290342     gbest211.seq
 524290193     gbest212.seq
 524288957     gbest213.seq
 283634016     gbest214.seq
 524291620     gbest215.seq
 524289112     gbest216.seq
 524292481     gbest217.seq
 524291792     gbest218.seq
 524291752     gbest219.seq
 461149573     gbest22.seq
 524289116     gbest220.seq
 524290143     gbest221.seq
 524288733     gbest222.seq
 524290731     gbest223.seq
 524290516     gbest224.seq
 524291746     gbest225.seq
 524290491     gbest226.seq
 524290551     gbest227.seq
 229176423     gbest228.seq
 524291010     gbest229.seq
 508128451     gbest23.seq
 524290104     gbest230.seq
 524291066     gbest231.seq
 524293034     gbest232.seq
 524291241     gbest233.seq
 524289847     gbest234.seq
 524290768     gbest235.seq
 524291145     gbest236.seq
 524290522     gbest237.seq
 524290840     gbest238.seq
 524289612     gbest239.seq
 524289061     gbest24.seq
 524291020     gbest240.seq
 524290856     gbest241.seq
 426507882     gbest242.seq
 524291517     gbest243.seq
 524289110     gbest244.seq
 524291869     gbest245.seq
 524289658     gbest246.seq
 524289679     gbest247.seq
 524290871     gbest248.seq
 524289465     gbest249.seq
 169058861     gbest25.seq
 524289114     gbest250.seq
 524291373     gbest251.seq
 524291460     gbest252.seq
 524291972     gbest253.seq
  94020380     gbest254.seq
 524291501     gbest255.seq
 524290779     gbest256.seq
 524290190     gbest257.seq
 524290181     gbest258.seq
 524291447     gbest259.seq
 524288910     gbest26.seq
 524289992     gbest260.seq
 524290499     gbest261.seq
 524289332     gbest262.seq
 524288780     gbest263.seq
 524290532     gbest264.seq
 149285185     gbest265.seq
 524291212     gbest266.seq
 524291357     gbest267.seq
 524289027     gbest268.seq
 524289647     gbest269.seq
 524291206     gbest27.seq
 524290160     gbest270.seq
 524289622     gbest271.seq
 524290752     gbest272.seq
 524289048     gbest273.seq
 524289395     gbest274.seq
 524291235     gbest275.seq
 524288984     gbest276.seq
  96407626     gbest277.seq
 524291499     gbest278.seq
 524290784     gbest279.seq
 524291238     gbest28.seq
 524290451     gbest280.seq
 524289217     gbest281.seq
 524289441     gbest282.seq
 524290982     gbest283.seq
 524290571     gbest284.seq
 524290211     gbest285.seq
 524290014     gbest286.seq
 524291341     gbest287.seq
 524288774     gbest288.seq
  50944792     gbest289.seq
 524292806     gbest29.seq
 524292229     gbest290.seq
 524290568     gbest291.seq
 524289066     gbest292.seq
 524290621     gbest293.seq
 524288777     gbest294.seq
 524290358     gbest295.seq
 524288733     gbest296.seq
 524291143     gbest297.seq
 479132208     gbest298.seq
 479815038     gbest299.seq
 512724177     gbest3.seq
 524290866     gbest30.seq
 481093270     gbest300.seq
 174132855     gbest301.seq
 524288796     gbest302.seq
 524290527     gbest303.seq
 524290586     gbest304.seq
 524291001     gbest305.seq
 524290209     gbest306.seq
 524289504     gbest307.seq
 524289407     gbest308.seq
 524291368     gbest309.seq
 524288817     gbest31.seq
 524290802     gbest310.seq
 524290720     gbest311.seq
 524292016     gbest312.seq
 524290800     gbest313.seq
 352429471     gbest314.seq
 524289434     gbest315.seq
 524289994     gbest316.seq
 524290476     gbest317.seq
 524291755     gbest318.seq
 524290657     gbest319.seq
 524290408     gbest32.seq
 524289269     gbest320.seq
 524291999     gbest321.seq
 524290976     gbest322.seq
 524291295     gbest323.seq
 523861100     gbest324.seq
 524292330     gbest325.seq
 524290900     gbest326.seq
 524291766     gbest327.seq
 123686313     gbest328.seq
 524290286     gbest329.seq
 524289952     gbest33.seq
 524289996     gbest330.seq
 524290396     gbest331.seq
 524291767     gbest332.seq
 524291243     gbest333.seq
 524290708     gbest334.seq
 524290274     gbest335.seq
 524289590     gbest336.seq
 524289801     gbest337.seq
 524289662     gbest338.seq
 524290459     gbest339.seq
 490574819     gbest34.seq
 524290924     gbest340.seq
 524291216     gbest341.seq
  61773865     gbest342.seq
 524289701     gbest343.seq
 524289179     gbest344.seq
 524290359     gbest345.seq
 524291073     gbest346.seq
 524289964     gbest347.seq
 524289415     gbest348.seq
 524292672     gbest349.seq
 490150714     gbest35.seq
 524288762     gbest350.seq
 524289674     gbest351.seq
 524291282     gbest352.seq
 524288888     gbest353.seq
 524290178     gbest354.seq
 524290896     gbest355.seq
 336095676     gbest356.seq
 524289216     gbest357.seq
 524290695     gbest358.seq
 524291221     gbest359.seq
 492423379     gbest36.seq
 524288983     gbest360.seq
 524290030     gbest361.seq
 524290624     gbest362.seq
 524289388     gbest363.seq
 524291334     gbest364.seq
 524290716     gbest365.seq
 524294364     gbest366.seq
 392403117     gbest367.seq
 524292488     gbest368.seq
 524290999     gbest369.seq
 491641530     gbest37.seq
 524290720     gbest370.seq
 524289046     gbest371.seq
 524289253     gbest372.seq
 524289345     gbest373.seq
 524289244     gbest374.seq
 524289957     gbest375.seq
 524290807     gbest376.seq
 524289349     gbest377.seq
 524290334     gbest378.seq
 190046125     gbest379.seq
 484871815     gbest38.seq
 524290227     gbest380.seq
 524289235     gbest381.seq
 524291433     gbest382.seq
 524289626     gbest383.seq
 524290738     gbest384.seq
 524289580     gbest385.seq
 524292546     gbest386.seq
 524290066     gbest387.seq
 524289215     gbest388.seq
 524289203     gbest389.seq
 497519208     gbest39.seq
 524291845     gbest390.seq
 524291689     gbest391.seq
 378617042     gbest392.seq
 524289715     gbest393.seq
 524290087     gbest394.seq
 524289089     gbest395.seq
 524290530     gbest396.seq
 524290243     gbest397.seq
 524291737     gbest398.seq
 524291665     gbest399.seq
 524291765     gbest4.seq
   5205751     gbest40.seq
 524289360     gbest400.seq
 524289120     gbest401.seq
 524288806     gbest402.seq
 524290898     gbest403.seq
 524291779     gbest404.seq
 396573932     gbest405.seq
 524289750     gbest406.seq
 524289678     gbest407.seq
 524292578     gbest408.seq
 524288837     gbest409.seq
 524293134     gbest41.seq
 524288861     gbest410.seq
 524289692     gbest411.seq
 524292273     gbest412.seq
 524290588     gbest413.seq
 524292636     gbest414.seq
 524289295     gbest415.seq
 524289300     gbest416.seq
 524289407     gbest417.seq
 524290577     gbest418.seq
 381476639     gbest419.seq
 524289064     gbest42.seq
 524290061     gbest420.seq
 524291918     gbest421.seq
 244966885     gbest422.seq
 524290526     gbest43.seq
 524290296     gbest44.seq
 524290314     gbest45.seq
 524291882     gbest46.seq
 524290047     gbest47.seq
 524291166     gbest48.seq
 524290122     gbest49.seq
 524290822     gbest5.seq
 524290806     gbest50.seq
 524290968     gbest51.seq
 524289779     gbest52.seq
 524292209     gbest53.seq
 118577116     gbest54.seq
 524290781     gbest55.seq
 524290246     gbest56.seq
 524291205     gbest57.seq
 524289313     gbest58.seq
 524288906     gbest59.seq
 524291294     gbest6.seq
 524289344     gbest60.seq
 524289341     gbest61.seq
 524290329     gbest62.seq
 524291173     gbest63.seq
 524290885     gbest64.seq
 524288962     gbest65.seq
 524289606     gbest66.seq
 307747537     gbest67.seq
 524290700     gbest68.seq
 524290450     gbest69.seq
 524289082     gbest7.seq
 524289187     gbest70.seq
 524291630     gbest71.seq
 524288838     gbest72.seq
 524291544     gbest73.seq
 524289099     gbest74.seq
 524289792     gbest75.seq
 524290013     gbest76.seq
 524290466     gbest77.seq
 524291294     gbest78.seq
 524290666     gbest79.seq
 524288950     gbest8.seq
  56555005     gbest80.seq
 524289306     gbest81.seq
 524289467     gbest82.seq
 524290775     gbest83.seq
 524291121     gbest84.seq
 524291258     gbest85.seq
 524289311     gbest86.seq
 524289294     gbest87.seq
 524291302     gbest88.seq
 524290250     gbest89.seq
 524290755     gbest9.seq
 524290571     gbest90.seq
 524289870     gbest91.seq
 295056133     gbest92.seq
 524290279     gbest93.seq
 524291351     gbest94.seq
 524291020     gbest95.seq
 524292130     gbest96.seq
 524290508     gbest97.seq
 524289975     gbest98.seq
 524289834     gbest99.seq
 136029171     gbgen.idx
 524289989     gbgss1.seq
 524292081     gbgss10.seq
 232712117     gbgss100.seq
 524290402     gbgss101.seq
 524290252     gbgss102.seq
 524289611     gbgss103.seq
 524290440     gbgss104.seq
 524288790     gbgss105.seq
 524289822     gbgss106.seq
 524289305     gbgss107.seq
 524290852     gbgss108.seq
 524290953     gbgss109.seq
 524291788     gbgss11.seq
 524289595     gbgss110.seq
 443272225     gbgss111.seq
 524290733     gbgss112.seq
 524292088     gbgss113.seq
 524291350     gbgss114.seq
 524290870     gbgss115.seq
 524290501     gbgss116.seq
 524291310     gbgss117.seq
 524289715     gbgss118.seq
 524289149     gbgss119.seq
 524290847     gbgss12.seq
 524291917     gbgss120.seq
 524289683     gbgss121.seq
 524289253     gbgss122.seq
   6673436     gbgss123.seq
 249997408     gbgss124.seq
 249998817     gbgss125.seq
 249997906     gbgss126.seq
 249997703     gbgss127.seq
  28059611     gbgss128.seq
 249997137     gbgss129.seq
 524290765     gbgss13.seq
 250000033     gbgss130.seq
 249998542     gbgss131.seq
 249998333     gbgss132.seq
 224919493     gbgss133.seq
 249998415     gbgss134.seq
 249998761     gbgss135.seq
 249998880     gbgss136.seq
 249999114     gbgss137.seq
 172035984     gbgss138.seq
 249997088     gbgss139.seq
 524289910     gbgss14.seq
 249998903     gbgss140.seq
 249999973     gbgss141.seq
 249997822     gbgss142.seq
 249997800     gbgss143.seq
  76110243     gbgss144.seq
 250000188     gbgss145.seq
   2879209     gbgss146.seq
  79542258     gbgss147.seq
 249999490     gbgss148.seq
 249999950     gbgss149.seq
 524291672     gbgss15.seq
  78247334     gbgss150.seq
 249998378     gbgss151.seq
 249999331     gbgss152.seq
 249997693     gbgss153.seq
 116326140     gbgss154.seq
 249999232     gbgss155.seq
 249999334     gbgss156.seq
 249999609     gbgss157.seq
 246354232     gbgss158.seq
 249999268     gbgss159.seq
 524288946     gbgss16.seq
 249997406     gbgss160.seq
 249999513     gbgss161.seq
 243477113     gbgss162.seq
 249999336     gbgss163.seq
 249997687     gbgss164.seq
 249997948     gbgss165.seq
 249997418     gbgss166.seq
 116439238     gbgss167.seq
 249998013     gbgss168.seq
 250000031     gbgss169.seq
 524291284     gbgss17.seq
 249999974     gbgss170.seq
 249998152     gbgss171.seq
  94058788     gbgss172.seq
 249998892     gbgss173.seq
 249999850     gbgss174.seq
 249998239     gbgss175.seq
 249999582     gbgss176.seq
 163635826     gbgss177.seq
 249999236     gbgss178.seq
 249997993     gbgss179.seq
 524290790     gbgss18.seq
 249998006     gbgss180.seq
 249999353     gbgss181.seq
  95926739     gbgss182.seq
 249999461     gbgss183.seq
 249999350     gbgss184.seq
 249998406     gbgss185.seq
 249998619     gbgss186.seq
 249998550     gbgss187.seq
 249999411     gbgss188.seq
  18590121     gbgss189.seq
 155129762     gbgss19.seq
 249999424     gbgss190.seq
 249999963     gbgss191.seq
 249997369     gbgss192.seq
  43648880     gbgss193.seq
  52862187     gbgss194.seq
 249999919     gbgss195.seq
 249998112     gbgss196.seq
 249997774     gbgss197.seq
 249999401     gbgss198.seq
 249999038     gbgss199.seq
 524289742     gbgss2.seq
 524290226     gbgss20.seq
 249999019     gbgss200.seq
  20598532     gbgss201.seq
 249999684     gbgss202.seq
 249999565     gbgss203.seq
 249998830     gbgss204.seq
 249997904     gbgss205.seq
 249998150     gbgss206.seq
 249998117     gbgss207.seq
  31871896     gbgss208.seq
 249999812     gbgss209.seq
 524291157     gbgss21.seq
 249999035     gbgss210.seq
  47503560     gbgss211.seq
 249999561     gbgss212.seq
 249998751     gbgss213.seq
 249999599     gbgss214.seq
 249999028     gbgss215.seq
 249999713     gbgss216.seq
  16550600     gbgss217.seq
 524290189     gbgss22.seq
 524290658     gbgss23.seq
 524289588     gbgss24.seq
 524288730     gbgss25.seq
 524290251     gbgss26.seq
 524289395     gbgss27.seq
 524291766     gbgss28.seq
 524289334     gbgss29.seq
 524290106     gbgss3.seq
 427751101     gbgss30.seq
 524290372     gbgss31.seq
 524289473     gbgss32.seq
 524290353     gbgss33.seq
 524290058     gbgss34.seq
 524290137     gbgss35.seq
 524290624     gbgss36.seq
 524290508     gbgss37.seq
 469007750     gbgss38.seq
 524288725     gbgss39.seq
 524289593     gbgss4.seq
 524289230     gbgss40.seq
 453251393     gbgss41.seq
 524289796     gbgss42.seq
 524289080     gbgss43.seq
 524291071     gbgss44.seq
 524289281     gbgss45.seq
 156480824     gbgss46.seq
 524290791     gbgss47.seq
 524289036     gbgss48.seq
 524291372     gbgss49.seq
 114446950     gbgss5.seq
 524288728     gbgss50.seq
 524291549     gbgss51.seq
 524290735     gbgss52.seq
 524291229     gbgss53.seq
 524290199     gbgss54.seq
 524289099     gbgss55.seq
 524289411     gbgss56.seq
 403025462     gbgss57.seq
 524289012     gbgss58.seq
 524292027     gbgss59.seq
 524289206     gbgss6.seq
 524289083     gbgss60.seq
 415166904     gbgss61.seq
 524290796     gbgss62.seq
 524288807     gbgss63.seq
 524291150     gbgss64.seq
 524290174     gbgss65.seq
 524288840     gbgss66.seq
 524290963     gbgss67.seq
 524291629     gbgss68.seq
 524291361     gbgss69.seq
 524288432     gbgss7.seq
 524291331     gbgss70.seq
 524290474     gbgss71.seq
 524289158     gbgss72.seq
 411049101     gbgss73.seq
 524289067     gbgss74.seq
 524289786     gbgss75.seq
 524290389     gbgss76.seq
 524289438     gbgss77.seq
 524289284     gbgss78.seq
 524291930     gbgss79.seq
 524291739     gbgss8.seq
 524291383     gbgss80.seq
 524290093     gbgss81.seq
 524288891     gbgss82.seq
 524290751     gbgss83.seq
 524291514     gbgss84.seq
 229679924     gbgss85.seq
 524292132     gbgss86.seq
 524289296     gbgss87.seq
 524290639     gbgss88.seq
 524290493     gbgss89.seq
 524292063     gbgss9.seq
 524291310     gbgss90.seq
 524291780     gbgss91.seq
 524291338     gbgss92.seq
 524288829     gbgss93.seq
 524291050     gbgss94.seq
 524289791     gbgss95.seq
 524291194     gbgss96.seq
 524291029     gbgss97.seq
 524291498     gbgss98.seq
 524289295     gbgss99.seq
 249988458     gbhtc1.seq
 249998254     gbhtc10.seq
 249998954     gbhtc11.seq
  79142152     gbhtc12.seq
 249998738     gbhtc13.seq
 249999241     gbhtc14.seq
  49208101     gbhtc15.seq
 249990019     gbhtc2.seq
 249994097     gbhtc3.seq
 249989139     gbhtc4.seq
 249997691     gbhtc5.seq
 249996247     gbhtc6.seq
 249996862     gbhtc7.seq
  83854894     gbhtc8.seq
 249997812     gbhtc9.seq
 249904694     gbhtg1.seq
 249863312     gbhtg10.seq
 249752175     gbhtg100.seq
 249945600     gbhtg101.seq
 249902534     gbhtg102.seq
 249961521     gbhtg103.seq
   5952683     gbhtg104.seq
 249499004     gbhtg105.seq
 249885159     gbhtg106.seq
 249900528     gbhtg107.seq
 249944132     gbhtg108.seq
 249888028     gbhtg109.seq
   1107147     gbhtg11.seq
 249873588     gbhtg110.seq
 249886255     gbhtg111.seq
 249914676     gbhtg112.seq
 249918424     gbhtg113.seq
   2779249     gbhtg114.seq
 249925067     gbhtg115.seq
 249963986     gbhtg116.seq
 249957715     gbhtg117.seq
 249794576     gbhtg118.seq
 249993947     gbhtg119.seq
 249658267     gbhtg12.seq
 111404939     gbhtg120.seq
 249903443     gbhtg121.seq
 249792853     gbhtg122.seq
 249854861     gbhtg123.seq
 249983162     gbhtg124.seq
 249832745     gbhtg125.seq
 163080900     gbhtg126.seq
 249921852     gbhtg127.seq
 249813962     gbhtg128.seq
 249948862     gbhtg129.seq
 249701321     gbhtg13.seq
 249961944     gbhtg130.seq
 249862297     gbhtg131.seq
 249918088     gbhtg132.seq
 249983762     gbhtg133.seq
 249995690     gbhtg134.seq
 249961284     gbhtg135.seq
  31852232     gbhtg136.seq
 249952420     gbhtg14.seq
 249947884     gbhtg15.seq
 249835884     gbhtg16.seq
 249628655     gbhtg17.seq
 249706830     gbhtg18.seq
 249666330     gbhtg19.seq
 249994606     gbhtg2.seq
 249821773     gbhtg20.seq
 243536188     gbhtg21.seq
 249760645     gbhtg22.seq
 249868408     gbhtg23.seq
 249853408     gbhtg24.seq
 249813402     gbhtg25.seq
 249774414     gbhtg26.seq
 249988400     gbhtg27.seq
 249872927     gbhtg28.seq
 249864461     gbhtg29.seq
 249950111     gbhtg3.seq
 249832113     gbhtg30.seq
 225825682     gbhtg31.seq
 249827828     gbhtg32.seq
 249684646     gbhtg33.seq
 249884842     gbhtg34.seq
 249770561     gbhtg35.seq
 249676282     gbhtg36.seq
 249939303     gbhtg37.seq
 249954576     gbhtg38.seq
 249629775     gbhtg39.seq
 249984089     gbhtg4.seq
 249981649     gbhtg40.seq
 227934091     gbhtg41.seq
 249998307     gbhtg42.seq
 249936527     gbhtg43.seq
 249894895     gbhtg44.seq
 249909173     gbhtg45.seq
 250000253     gbhtg46.seq
 249478239     gbhtg47.seq
 249731464     gbhtg48.seq
 249735638     gbhtg49.seq
 249882044     gbhtg5.seq
 249959056     gbhtg50.seq
 237748480     gbhtg51.seq
 249784719     gbhtg52.seq
 249852227     gbhtg53.seq
 249905626     gbhtg54.seq
 249884822     gbhtg55.seq
 249732182     gbhtg56.seq
  20448412     gbhtg57.seq
 249846548     gbhtg58.seq
 249989277     gbhtg59.seq
 249898388     gbhtg6.seq
 249904211     gbhtg60.seq
 249893214     gbhtg61.seq
 228240177     gbhtg62.seq
 249902619     gbhtg63.seq
 249986507     gbhtg64.seq
 249918160     gbhtg65.seq
 249883738     gbhtg66.seq
 249966605     gbhtg67.seq
  16805116     gbhtg68.seq
 249960711     gbhtg69.seq
 249933701     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249936465     gbhtg72.seq
 227481147     gbhtg73.seq
 249814017     gbhtg74.seq
 249953139     gbhtg75.seq
 249976438     gbhtg76.seq
 249874461     gbhtg77.seq
 245743847     gbhtg78.seq
 249883367     gbhtg79.seq
 249933567     gbhtg8.seq
 249988504     gbhtg80.seq
 249984680     gbhtg81.seq
 249923491     gbhtg82.seq
 216520592     gbhtg83.seq
 249912276     gbhtg84.seq
 249753897     gbhtg85.seq
 249968147     gbhtg86.seq
 249990127     gbhtg87.seq
 223452756     gbhtg88.seq
 249843028     gbhtg89.seq
 249923718     gbhtg9.seq
 249841332     gbhtg90.seq
 249816787     gbhtg91.seq
 249847761     gbhtg92.seq
 214033471     gbhtg93.seq
 249820734     gbhtg94.seq
 249980764     gbhtg95.seq
 249790140     gbhtg96.seq
 249800382     gbhtg97.seq
 170963808     gbhtg98.seq
 249797510     gbhtg99.seq
 249993761     gbinv1.seq
 250000023     gbinv10.seq
 249997636     gbinv11.seq
 160246748     gbinv12.seq
 249996874     gbinv13.seq
 249999535     gbinv14.seq
 250000243     gbinv15.seq
 128056260     gbinv16.seq
 247210154     gbinv17.seq
 249051369     gbinv18.seq
 249999414     gbinv19.seq
 249992095     gbinv2.seq
 249997929     gbinv20.seq
 249998353     gbinv21.seq
 249997607     gbinv22.seq
 249999139     gbinv23.seq
 249980793     gbinv24.seq
  14420395     gbinv25.seq
 248042182     gbinv3.seq
 249998867     gbinv4.seq
 250000184     gbinv5.seq
 249867934     gbinv6.seq
 250000203     gbinv7.seq
  12071741     gbinv8.seq
 249996902     gbinv9.seq
 140197244     gbjou1.idx
  44656577     gbjou10.idx
 145833298     gbjou2.idx
 142011534     gbjou3.idx
 260428856     gbjou4.idx
 292574804     gbjou5.idx
 268706560     gbjou6.idx
 300468841     gbjou7.idx
 287307673     gbjou8.idx
 268614966     gbjou9.idx
 265445136     gbkey1.idx
 178809226     gbkey2.idx
 321443926     gbkey3.idx
  96468580     gbkey4.idx
 249747140     gbmam1.seq
 249999675     gbmam2.seq
 249909598     gbmam3.seq
 249991465     gbmam4.seq
 249832203     gbmam5.seq
 154858299     gbmam6.seq
  46028279     gbnew.txt
 250000010     gbpat1.seq
 249997839     gbpat10.seq
 249999441     gbpat100.seq
 249999845     gbpat101.seq
 249999888     gbpat102.seq
 249999095     gbpat103.seq
 250000223     gbpat104.seq
 249999486     gbpat105.seq
 169767065     gbpat106.seq
 250000124     gbpat107.seq
 249999983     gbpat108.seq
 249999814     gbpat109.seq
 178698078     gbpat11.seq
  86031991     gbpat110.seq
 249999922     gbpat111.seq
 249999366     gbpat112.seq
 249999990     gbpat113.seq
  63514362     gbpat114.seq
 249997314     gbpat115.seq
 249995934     gbpat116.seq
 250000135     gbpat117.seq
 249996737     gbpat118.seq
 249999047     gbpat119.seq
 249997814     gbpat12.seq
 249998556     gbpat120.seq
 216404619     gbpat121.seq
 250000249     gbpat122.seq
 249999893     gbpat123.seq
 249999893     gbpat124.seq
 250000185     gbpat125.seq
 249999753     gbpat126.seq
 250000011     gbpat127.seq
  14853843     gbpat128.seq
 249999097     gbpat13.seq
 249998211     gbpat14.seq
 249998262     gbpat15.seq
 249999588     gbpat16.seq
  65707342     gbpat17.seq
 249999229     gbpat18.seq
 249999331     gbpat19.seq
 249996676     gbpat2.seq
 249999952     gbpat20.seq
 249997141     gbpat21.seq
 185161771     gbpat22.seq
 249999809     gbpat23.seq
 249928982     gbpat24.seq
 249999339     gbpat25.seq
 249999860     gbpat26.seq
  70931223     gbpat27.seq
 249998489     gbpat28.seq
 249998897     gbpat29.seq
 250000152     gbpat3.seq
 249999326     gbpat30.seq
 249998991     gbpat31.seq
 249999739     gbpat32.seq
 180118699     gbpat33.seq
 249998765     gbpat34.seq
 250000100     gbpat35.seq
 249998158     gbpat36.seq
 249999783     gbpat37.seq
 130519975     gbpat38.seq
 250000004     gbpat39.seq
 250000173     gbpat4.seq
 249972532     gbpat40.seq
 249998826     gbpat41.seq
 249998487     gbpat42.seq
 249997701     gbpat43.seq
 249805470     gbpat44.seq
 249999190     gbpat45.seq
 249999545     gbpat46.seq
 171256347     gbpat47.seq
 249998653     gbpat48.seq
 249998527     gbpat49.seq
  71763868     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 249999501     gbpat55.seq
 164403390     gbpat56.seq
 249999689     gbpat57.seq
 249998637     gbpat58.seq
 249999463     gbpat59.seq
 249999527     gbpat6.seq
 249999863     gbpat60.seq
 134380705     gbpat61.seq
 249996182     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999374     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249999834     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244394826     gbpat72.seq
 248968678     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999757     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249997938     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249996127     gbpat82.seq
 221488049     gbpat83.seq
 249999879     gbpat84.seq
 249999564     gbpat85.seq
 249929730     gbpat86.seq
 249824878     gbpat87.seq
 249998855     gbpat88.seq
 192932772     gbpat89.seq
 249999535     gbpat9.seq
 250000012     gbpat90.seq
 249999638     gbpat91.seq
 250000098     gbpat92.seq
  80103982     gbpat93.seq
 249999825     gbpat94.seq
 249999943     gbpat95.seq
 249946575     gbpat96.seq
 249999877     gbpat97.seq
 249849702     gbpat98.seq
  66835451     gbpat99.seq
 110754297     gbphg1.seq
 249996905     gbpln1.seq
 249997369     gbpln10.seq
 249868657     gbpln11.seq
 249989619     gbpln12.seq
  86220916     gbpln13.seq
 249992985     gbpln14.seq
 249936362     gbpln15.seq
 249970582     gbpln16.seq
 248077474     gbpln17.seq
 249958127     gbpln18.seq
 248470008     gbpln19.seq
 249940151     gbpln2.seq
 250000218     gbpln20.seq
  26130132     gbpln21.seq
 249999411     gbpln22.seq
  94566860     gbpln23.seq
 249998765     gbpln24.seq
 249998293     gbpln25.seq
 249775695     gbpln26.seq
 249996551     gbpln27.seq
 249998001     gbpln28.seq
 249997232     gbpln29.seq
 249862881     gbpln3.seq
 249999721     gbpln30.seq
 134309497     gbpln31.seq
 249998016     gbpln32.seq
 249999637     gbpln33.seq
 249998761     gbpln34.seq
 249998324     gbpln35.seq
 104437258     gbpln36.seq
 249998941     gbpln37.seq
 249997712     gbpln38.seq
 249998721     gbpln39.seq
 249896287     gbpln4.seq
 249999761     gbpln40.seq
 249999169     gbpln41.seq
 249998533     gbpln42.seq
  95684252     gbpln43.seq
 249979283     gbpln5.seq
 249997452     gbpln6.seq
 249996585     gbpln7.seq
  27796706     gbpln8.seq
 249998505     gbpln9.seq
 148947183     gbpri1.seq
 249872272     gbpri10.seq
 124885190     gbpri11.seq
 249966847     gbpri12.seq
 249900330     gbpri13.seq
 249899933     gbpri14.seq
 249949219     gbpri15.seq
 249911015     gbpri16.seq
 249858970     gbpri17.seq
 249821596     gbpri18.seq
 249975833     gbpri19.seq
 249951612     gbpri2.seq
 249823069     gbpri20.seq
 249897250     gbpri21.seq
 136799378     gbpri22.seq
 180127201     gbpri23.seq
 249995462     gbpri24.seq
 204691475     gbpri25.seq
 249899019     gbpri26.seq
 249845794     gbpri27.seq
 249838572     gbpri28.seq
 249827438     gbpri29.seq
 249882950     gbpri3.seq
 249875768     gbpri30.seq
 249875155     gbpri31.seq
 249962808     gbpri32.seq
 249997922     gbpri33.seq
  85071225     gbpri34.seq
 249995363     gbpri35.seq
 249998838     gbpri36.seq
 249994107     gbpri37.seq
 249998086     gbpri38.seq
 249990743     gbpri39.seq
 249988745     gbpri4.seq
 146631824     gbpri40.seq
 249999672     gbpri41.seq
  74133527     gbpri42.seq
 249914939     gbpri5.seq
 249915740     gbpri6.seq
 249893851     gbpri7.seq
 249902601     gbpri8.seq
 249974110     gbpri9.seq
    282812     gbrel.txt
 249980590     gbrod1.seq
 249921262     gbrod10.seq
  54232813     gbrod11.seq
 249879313     gbrod12.seq
 249787795     gbrod13.seq
 249998696     gbrod14.seq
 249654174     gbrod15.seq
 249956811     gbrod16.seq
 249890169     gbrod17.seq
 249753341     gbrod18.seq
 146949263     gbrod19.seq
 249764620     gbrod2.seq
 249834785     gbrod20.seq
 249887334     gbrod21.seq
 226629375     gbrod22.seq
 249999747     gbrod23.seq
 249991222     gbrod24.seq
 249983314     gbrod25.seq
 249865309     gbrod26.seq
 249999564     gbrod27.seq
 249999487     gbrod28.seq
  99038741     gbrod29.seq
 249931483     gbrod3.seq
 249801432     gbrod4.seq
 249816403     gbrod5.seq
 249780898     gbrod6.seq
 249802843     gbrod7.seq
 249984012     gbrod8.seq
 249792319     gbrod9.seq
2920060510     gbsdr1.txt
5355496749     gbsdr2.txt
2280718343     gbsdr3.txt
 142025076     gbsec.idx
 249999233     gbsts1.seq
 249997362     gbsts10.seq
 212226966     gbsts11.seq
 249996524     gbsts12.seq
 249999913     gbsts13.seq
 249999565     gbsts14.seq
 249998628     gbsts15.seq
  27217038     gbsts16.seq
 249999776     gbsts17.seq
 249996039     gbsts18.seq
 250000037     gbsts19.seq
 249996363     gbsts2.seq
 146410465     gbsts20.seq
 249999929     gbsts3.seq
 249998244     gbsts4.seq
  36209595     gbsts5.seq
 249997222     gbsts6.seq
 249997899     gbsts7.seq
 249998458     gbsts8.seq
 249997742     gbsts9.seq
 249999920     gbsyn1.seq
 249995336     gbsyn2.seq
   4014218     gbsyn3.seq
 249999371     gbtsa1.seq
 249999937     gbtsa10.seq
 249999308     gbtsa11.seq
 131698529     gbtsa12.seq
 249999929     gbtsa2.seq
 249998344     gbtsa3.seq
 249998436     gbtsa4.seq
  56706584     gbtsa5.seq
 249998438     gbtsa6.seq
 249999024     gbtsa7.seq
 249998597     gbtsa8.seq
 249997586     gbtsa9.seq
    447611     gbuna1.seq
 249761171     gbvrl1.seq
 204545160     gbvrl10.seq
 249990797     gbvrl11.seq
 249990718     gbvrl12.seq
 249994465     gbvrl13.seq
 249996155     gbvrl14.seq
 225701328     gbvrl15.seq
 249997993     gbvrl2.seq
 249820972     gbvrl3.seq
 249999274     gbvrl4.seq
 146494773     gbvrl5.seq
 249997203     gbvrl6.seq
 249997192     gbvrl7.seq
 249998826     gbvrl8.seq
 249996125     gbvrl9.seq
 249869248     gbvrt1.seq
 249884374     gbvrt10.seq
 249968136     gbvrt11.seq
 184518097     gbvrt12.seq
 249997202     gbvrt13.seq
 249809573     gbvrt14.seq
 249898528     gbvrt15.seq
 249999370     gbvrt16.seq
 249999427     gbvrt17.seq
 249995877     gbvrt18.seq
 249998351     gbvrt19.seq
 249998468     gbvrt2.seq
 249997545     gbvrt20.seq
 250000257     gbvrt21.seq
  36302377     gbvrt22.seq
 249784319     gbvrt3.seq
 250000123     gbvrt4.seq
  58599685     gbvrt5.seq
 249996615     gbvrt6.seq
 249999233     gbvrt7.seq
 249790609     gbvrt8.seq
 249774789     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         52450      90653157
BCT10        63         117808727
BCT11        10867      111821847
BCT12        5335       6693859
BCT13        53942      85334347
BCT14        93         110189094
BCT15        151        93915681
BCT16        61         112455059
BCT17        52         112042350
BCT18        46         112693953
BCT19        56         110572060
BCT2         79         110161703
BCT20        66         108817610
BCT21        36         96325907
BCT22        40         106881287
BCT23        58         105533856
BCT24        74         111675186
BCT25        55         110045255
BCT26        63         106845562
BCT27        55         109391288
BCT28        52         108559385
BCT29        46         110496749
BCT3         53         111366361
BCT30        95         109522868
BCT31        59         110930031
BCT32        67         108616570
BCT33        124        109249408
BCT34        34         61811577
BCT35        202        109105476
BCT36        48         109782718
BCT37        43         108253230
BCT38        50         107374448
BCT39        57         101734644
BCT4         4596       108796858
BCT40        47         105859699
BCT41        71         106999678
BCT42        42         106164962
BCT43        57         107308208
BCT44        89         106033309
BCT45        224        100751052
BCT46        381        46867102
BCT47        1589       2511823
BCT48        3176       5212972
BCT49        6347       7901828
BCT5         33857      55268445
BCT50        12648      15076611
BCT51        25628      27746754
BCT52        50514      53996730
BCT53        76557      77450832
BCT54        70922      76044610
BCT55        7669       98699909
BCT56        5892       111603349
BCT57        128        115544567
BCT58        27338      108990483
BCT59        89865      69829878
BCT6         39035      86636534
BCT60        41012      82060683
BCT7         6441       98419342
BCT8         14416      92769466
BCT9         5262       104258066
ENV1         94570      71844702
ENV10        83227      87129841
ENV11        19073      16706871
ENV12        85012      80968039
ENV13        120854     43338508
ENV14        92100      76841173
ENV15        96574      68514483
ENV16        106736     53811072
ENV17        68325      85649415
ENV18        30739      41463380
ENV19        69645      85530498
ENV2         90197      69290545
ENV20        96295      72019848
ENV21        127892     31103960
ENV22        122783     29390540
ENV23        60884      13574965
ENV24        123333     50267068
ENV25        106957     64544633
ENV26        138458     53477267
ENV27        89591      75130542
ENV28        71071      96508561
ENV29        109930     54442634
ENV3         84310      80652791
ENV30        69077      69720328
ENV4         86688      80806548
ENV5         91031      83245694
ENV6         57209      26620903
ENV7         131791     31268854
ENV8         86982      71071423
ENV9         94057      73376617
EST1         162618     63052492
EST10        171812     70538965
EST100       232613     144866631
EST101       222620     113025837
EST102       209208     103272725
EST103       161286     102955965
EST104       62689      53129624
EST105       168732     112757910
EST106       171265     112982585
EST107       113242     64514967
EST108       64234      23580975
EST109       64383      22860297
EST11        168685     73605007
EST110       64712      23768621
EST111       64631      27206234
EST112       64788      22266188
EST113       66047      26115057
EST114       64086      27886175
EST115       64671      26640246
EST116       64868      26842047
EST117       64658      25425409
EST118       61274      39720195
EST119       178173     85731609
EST12        196163     87559579
EST120       176378     84426195
EST121       155725     95546197
EST122       150429     94921525
EST123       158380     98572962
EST124       99324      56330813
EST125       207430     101504225
EST126       155191     80525375
EST127       162663     86296457
EST128       157520     90412579
EST129       157586     83165491
EST13        521        232090
EST130       177795     108103387
EST131       217307     116938288
EST132       169983     99879079
EST133       170418     80055720
EST134       152929     85801818
EST135       151948     90543308
EST136       163868     95438800
EST137       35236      19291677
EST138       194543     110999667
EST139       236069     104095130
EST14        223739     113093929
EST140       155836     92166999
EST141       172857     95024742
EST142       150072     86780014
EST143       136755     88856069
EST144       157819     93205939
EST145       150070     77252759
EST146       125314     65533547
EST147       124876     63627935
EST148       130504     55967596
EST149       129898     51467387
EST15        170017     108538741
EST150       131535     51803803
EST151       83846      31650193
EST152       175716     87979267
EST153       184610     84867097
EST154       160089     112142593
EST155       220920     132179988
EST156       220455     124704945
EST157       169991     91036848
EST158       144467     114107437
EST159       147867     93079477
EST16        188030     112160415
EST160       147297     83831707
EST161       146751     78032343
EST162       155026     92506312
EST163       166089     92137071
EST164       40691      24879389
EST165       158732     98361581
EST166       189599     106364877
EST167       152575     85203641
EST168       131414     68374736
EST169       181002     100111931
EST17        196230     121607753
EST170       175588     103927017
EST171       152637     92955764
EST172       173518     89039902
EST173       131191     83350024
EST174       194332     113656382
EST175       158666     90681958
EST176       114401     67791004
EST177       166288     96544556
EST178       172569     103540690
EST179       184784     132131559
EST18        194429     119199172
EST180       156898     112011990
EST181       191790     94165607
EST182       155361     117641007
EST183       151064     90547604
EST184       148435     79206389
EST185       174823     79999152
EST186       153173     85118768
EST187       160638     101956765
EST188       150425     90208411
EST189       164329     102176231
EST19        171211     115159703
EST190       117609     67536326
EST191       135813     91471775
EST192       133513     89649066
EST193       149232     91728842
EST194       133738     89623400
EST195       122888     86809348
EST196       184929     97601405
EST197       177680     98023399
EST198       177191     98321697
EST199       174402     97779923
EST2         164795     62096425
EST20        209083     109166344
EST200       172095     96260518
EST201       176298     98370687
EST202       177505     96675582
EST203       164709     90603927
EST204       195711     105958426
EST205       206152     109521895
EST206       179504     107961601
EST207       191852     109267645
EST208       201205     120943409
EST209       196073     120554342
EST21        226120     110014555
EST210       186733     120742190
EST211       188042     115830858
EST212       224586     146094342
EST213       228342     114227243
EST214       94637      72514880
EST215       152419     102949171
EST216       148736     91921555
EST217       214979     116082678
EST218       170147     112260247
EST219       98859      98941778
EST22        172351     48128798
EST220       151986     108849542
EST221       161202     96732477
EST222       147214     105893993
EST223       229309     107431440
EST224       139034     102138691
EST225       141611     102376928
EST226       136923     95623000
EST227       125787     91563599
EST228       61784      35413614
EST229       143965     93502147
EST23        127963     36941721
EST230       135418     100373245
EST231       138803     99129249
EST232       125443     85403913
EST233       142190     89313987
EST234       159811     120908161
EST235       137476     121891570
EST236       138659     107636746
EST237       169633     103239768
EST238       175597     111014146
EST239       155004     99862607
EST24        129892     43041968
EST240       180054     123645601
EST241       159604     109350869
EST242       117695     90044422
EST243       167075     102315256
EST244       241333     103023833
EST245       147772     113799324
EST246       193758     58738117
EST247       223970     58453710
EST248       203182     95358831
EST249       182771     125016377
EST25        70647      29329977
EST250       163007     103729283
EST251       181000     111895116
EST252       157511     114189158
EST253       187607     117902621
EST254       30985      17230602
EST255       190399     100332638
EST256       180635     115099168
EST257       167679     111158157
EST258       249092     113777746
EST259       289292     125362180
EST26        220411     101231966
EST260       176494     107022949
EST261       205907     47993681
EST262       242765     122619234
EST263       157921     100188503
EST264       169106     105290461
EST265       50709      30022589
EST266       179751     121879869
EST267       185507     100482787
EST268       182156     119681271
EST269       185133     103244746
EST27        225390     113328885
EST270       215483     29558069
EST271       189732     70062583
EST272       187920     110102155
EST273       185743     119788603
EST274       176392     111735492
EST275       182845     112547314
EST276       172330     81107013
EST277       36485      18908652
EST278       130906     82476973
EST279       137473     88132346
EST28        189026     86134485
EST280       165665     98280293
EST281       275099     28789642
EST282       259678     38286312
EST283       153802     107304129
EST284       166343     116141296
EST285       162055     100352825
EST286       200978     74462741
EST287       241086     58545761
EST288       164814     109371374
EST289       20544      10276884
EST29        162523     71125467
EST290       186912     112428814
EST291       157399     99188938
EST292       205325     112327623
EST293       158242     113768574
EST294       171370     103751020
EST295       194245     116004431
EST296       179419     109045583
EST297       196163     96024436
EST298       190778     68045384
EST299       191396     70941035
EST3         163203     58346077
EST30        174535     70158767
EST300       190719     70650833
EST301       69345      27562590
EST302       192007     96689338
EST303       187348     134714468
EST304       149070     87206847
EST305       155533     95492920
EST306       133777     101500525
EST307       163916     96855468
EST308       181162     104999030
EST309       155504     100406367
EST31        157352     67274141
EST310       165819     94850447
EST311       160795     108230125
EST312       153790     109739970
EST313       169252     108528436
EST314       111658     85666419
EST315       187132     157818907
EST316       174464     91778204
EST317       137562     89091802
EST318       148806     103481219
EST319       139378     91686338
EST32        171488     75449075
EST320       144647     95035090
EST321       148617     103414286
EST322       159898     107688032
EST323       176976     102952035
EST324       152506     85356970
EST325       153925     90968891
EST326       154060     109487652
EST327       164863     100882648
EST328       37166      25983936
EST329       141307     87396609
EST33        182196     75448560
EST330       161040     100183631
EST331       205960     108498518
EST332       127607     70005699
EST333       126899     83554498
EST334       137519     87500095
EST335       136288     86700139
EST336       147576     84175257
EST337       225078     89559605
EST338       181344     86454287
EST339       170105     104702046
EST34        99407      28095954
EST340       170435     102544756
EST341       132871     86178897
EST342       15235      10681129
EST343       137604     91444633
EST344       156921     98868072
EST345       182724     122207075
EST346       167462     87614087
EST347       185810     110948333
EST348       160909     119507619
EST349       74086      44318725
EST35        98358      30040859
EST350       113418     62038931
EST351       137457     81882803
EST352       142054     73897155
EST353       161699     33117817
EST354       161684     33089903
EST355       171653     79838496
EST356       125627     84174555
EST357       258614     118815656
EST358       257680     119865846
EST359       172671     99306949
EST36        98643      31223206
EST360       138272     92259786
EST361       141413     86236764
EST362       168558     101971081
EST363       206054     123606988
EST364       221101     57566465
EST365       210336     128559288
EST366       178870     96202724
EST367       121733     62503074
EST368       180330     119047861
EST369       174131     132473823
EST37        97478      29579354
EST370       155547     107864451
EST371       196422     107927512
EST372       177420     104811081
EST373       222191     137057393
EST374       207783     128132377
EST375       189532     109121697
EST376       187248     84534565
EST377       172063     13415221
EST378       158747     13975124
EST379       58585      10179851
EST38        99800      30264291
EST380       161528     33458332
EST381       161810     32795031
EST382       157609     57625717
EST383       163297     92920713
EST384       181919     123490711
EST385       172326     104480912
EST386       161888     110840471
EST387       144371     98583936
EST388       147772     103436736
EST389       158823     100157322
EST39        102298     30724804
EST390       167419     121681918
EST391       165812     101995482
EST392       127197     48906451
EST393       171401     26952778
EST394       166011     101824490
EST395       156346     104711809
EST396       181469     119901446
EST397       143275     77341512
EST398       199951     114218425
EST399       160148     119013984
EST4         174334     68724014
EST40        1095       282302
EST400       136929     93542608
EST401       142357     93683945
EST402       153219     93696905
EST403       177621     98718634
EST404       178330     98977830
EST405       112856     68796551
EST406       184907     112638737
EST407       146030     91976718
EST408       108494     74875770
EST409       96384      65283158
EST41        102108     53644189
EST410       112452     72105678
EST411       128469     77743994
EST412       141150     92733674
EST413       144188     84978634
EST414       166614     97662487
EST415       187765     113774931
EST416       127513     82023953
EST417       185868     95842444
EST418       182468     88907160
EST419       118153     71557687
EST42        122369     52112480
EST420       175043     67630620
EST421       171564     62690410
EST422       78624      30020659
EST43        168959     87984171
EST44        170186     68556188
EST45        171834     92525445
EST46        175215     91724014
EST47        164834     81919579
EST48        166743     92418144
EST49        160107     90950294
EST5         171974     67410247
EST50        165565     94284223
EST51        163920     93625360
EST52        155052     75161019
EST53        154711     93384388
EST54        38397      16290925
EST55        171535     68638216
EST56        161986     77967479
EST57        174741     100020112
EST58        159364     99419781
EST59        162357     105846618
EST6         180194     70823116
EST60        168293     101697116
EST61        167078     108605300
EST62        177560     78407789
EST63        174859     102934321
EST64        152473     79613731
EST65        154459     88230456
EST66        159936     96367438
EST67        95358      55614462
EST68        146237     86440334
EST69        198985     110620918
EST7         170955     73685961
EST70        210833     110653254
EST71        206238     117293751
EST72        207993     122792528
EST73        197007     113885406
EST74        154241     80256783
EST75        137154     64352698
EST76        147412     75984500
EST77        158559     110055127
EST78        151797     81130455
EST79        148229     81471910
EST8         183809     73282961
EST80        15300      16802946
EST81        187567     96561596
EST82        219471     128510099
EST83        211919     113446337
EST84        222523     104755405
EST85        205243     90321885
EST86        152617     92399917
EST87        151559     81459607
EST88        169990     89069929
EST89        156577     85505501
EST9         170921     74409391
EST90        156123     100124850
EST91        155951     106497635
EST92        90407      47618192
EST93        155639     117818121
EST94        144443     106441761
EST95        149183     109585898
EST96        143374     86335839
EST97        164196     91395558
EST98        176088     111612544
EST99        258661     157860018
GSS1         205789     90174747
GSS10        136697     66638930
GSS100       85231      43057555
GSS101       195369     123709625
GSS102       171362     114185150
GSS103       204082     120214971
GSS104       209359     137095544
GSS105       214970     142139377
GSS106       213642     143433159
GSS107       209744     148258595
GSS108       210974     146696949
GSS109       208995     149477422
GSS11        138935     74785184
GSS110       206574     150888518
GSS111       152874     113593535
GSS112       135296     85656970
GSS113       173591     81374386
GSS114       192345     86757146
GSS115       176167     150366252
GSS116       183021     128334250
GSS117       188345     152147956
GSS118       195882     129458296
GSS119       192306     135653506
GSS12        150052     71645258
GSS120       200620     111543834
GSS121       178655     133102172
GSS122       174425     140065381
GSS123       2595       1009235
GSS124       87146      64102517
GSS125       83555      62802306
GSS126       103711     48629580
GSS127       68516      58447747
GSS128       7504       6899982
GSS129       68591      57924394
GSS13        147386     72057865
GSS130       69224      56650935
GSS131       69460      56187403
GSS132       71202      55998401
GSS133       68561      51865315
GSS134       75915      58209304
GSS135       87237      74898207
GSS136       81830      44609896
GSS137       93341      45143465
GSS138       56581      44294953
GSS139       77438      61353715
GSS14        180591     90589334
GSS140       69655      58699702
GSS141       67711      62707076
GSS142       62046      53381270
GSS143       95569      42915019
GSS144       21044      4905042
GSS145       112672     70634090
GSS146       1088       802743
GSS147       23226      28867035
GSS148       106621     69122590
GSS149       85457      35201726
GSS15        165393     96605770
GSS150       37313      23219225
GSS151       120402     72958896
GSS152       118337     75092514
GSS153       105426     63990802
GSS154       47835      23142546
GSS155       83102      54651503
GSS156       95630      61300959
GSS157       107319     78552403
GSS158       106422     76714273
GSS159       106058     79947480
GSS16        175055     92851473
GSS160       103996     80016519
GSS161       76376      51040365
GSS162       104570     63290945
GSS163       109868     66415305
GSS164       106323     59388992
GSS165       68303      37395892
GSS166       70143      39046688
GSS167       36533      17439317
GSS168       85481      46023427
GSS169       97119      55907586
GSS17        196533     125621946
GSS170       94982      49597190
GSS171       96286      55922591
GSS172       42132      23615490
GSS173       114638     43642267
GSS174       117085     39368203
GSS175       108676     55514545
GSS176       101471     78372335
GSS177       65199      40988720
GSS178       95891      36542252
GSS179       95417      37268709
GSS18        194711     106479472
GSS180       96671      35161518
GSS181       94285      39167432
GSS182       37736      17626556
GSS183       103939     66277823
GSS184       94551      61190929
GSS185       95128      60357048
GSS186       94773      60868501
GSS187       75456      69806637
GSS188       74978      73998303
GSS189       4831       7669769
GSS19        59752      25437618
GSS190       83736      28233267
GSS191       84219      27346468
GSS192       84926      25909272
GSS193       14851      4422302
GSS194       16547      7508221
GSS195       92689      59664938
GSS196       91834      47919637
GSS197       96594      58917503
GSS198       91411      63211512
GSS199       90323      64889518
GSS2         186370     94788401
GSS20        186916     105322671
GSS200       91054      63764867
GSS201       7427       5313332
GSS202       89694      65112997
GSS203       91751      63324801
GSS204       91480      67269119
GSS205       83657      79703161
GSS206       84185      78966201
GSS207       91879      76832958
GSS208       12387      9639114
GSS209       117650     64297121
GSS21        169128     115837914
GSS210       96973      62004430
GSS211       17943      10969369
GSS212       94787      57200301
GSS213       93517      59081345
GSS214       93900      58510429
GSS215       94714      57307691
GSS216       94279      58016121
GSS217       6701       3333254
GSS22        174184     99582895
GSS23        192369     138599496
GSS24        201033     123471734
GSS25        175457     104246621
GSS26        197072     119480726
GSS27        167838     161610244
GSS28        190624     134427548
GSS29        167179     120575133
GSS3         178561     89383943
GSS30        158731     105315922
GSS31        201673     130043244
GSS32        222403     119400836
GSS33        224622     116464658
GSS34        225847     114839954
GSS35        216729     131101319
GSS36        202761     159857338
GSS37        199139     148662682
GSS38        188477     55109967
GSS39        186333     106234122
GSS4         169875     86614174
GSS40        191325     138933721
GSS41        150682     135332163
GSS42        187622     102184708
GSS43        178261     125609833
GSS44        189663     127750237
GSS45        194847     125942531
GSS46        53295      50118667
GSS47        175398     104012483
GSS48        170991     105338695
GSS49        171834     105223965
GSS5         37307      23392794
GSS50        186392     124599449
GSS51        190585     117318545
GSS52        190206     125111512
GSS53        189049     119453106
GSS54        189660     132334451
GSS55        193182     112144944
GSS56        194503     124514952
GSS57        139506     107239273
GSS58        176473     141452510
GSS59        164987     113501389
GSS6         165197     86454148
GSS60        164771     113957518
GSS61        148748     100755802
GSS62        160481     131381765
GSS63        173037     144912030
GSS64        187480     121672816
GSS65        207363     129090176
GSS66        196670     113303552
GSS67        251736     131206295
GSS68        157516     105626161
GSS69        165278     126105180
GSS7         168801     80509155
GSS70        165920     126999175
GSS71        168047     126904498
GSS72        184852     114660920
GSS73        153962     113516805
GSS74        204046     129696056
GSS75        174135     114723585
GSS76        204934     135114464
GSS77        227955     77639594
GSS78        187494     114996969
GSS79        126134     93247017
GSS8         168974     90773407
GSS80        148462     119526539
GSS81        143023     118724908
GSS82        146600     118581759
GSS83        146517     121755921
GSS84        147293     120525169
GSS85        66807      55325711
GSS86        153116     125189801
GSS87        151211     119797782
GSS88        147162     116207653
GSS89        146029     118503290
GSS9         138697     67649628
GSS90        148214     123451508
GSS91        151860     123280024
GSS92        150921     121305900
GSS93        149486     124130828
GSS94        149686     123749626
GSS95        150354     122457322
GSS96        147975     115583746
GSS97        145074     117966230
GSS98        148906     124769101
GSS99        184775     128705163
HTC1         25057      27045808
HTC10        64078      67375744
HTC11        74795      76398895
HTC12        21266      31047585
HTC13        66997      61008541
HTC14        68361      69531096
HTC15        17596      12458095
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15981      40345967
HTC6         16068      37476179
HTC7         53837      31481114
HTC8         31133      19445871
HTC9         62293      77362082
HTG1         1318       188771164
HTG10        1298       186333849
HTG100       989        189318323
HTG101       997        189394206
HTG102       985        189419172
HTG103       1161       190567827
HTG104       32         4526682
HTG105       1090       189528150
HTG106       1040       189738262
HTG107       1395       191466140
HTG108       1301       190961916
HTG109       1620       191136666
HTG11        6          837687
HTG110       1378       191801664
HTG111       1445       190411167
HTG112       1137       190213122
HTG113       1099       185226672
HTG114       19         2147866
HTG115       1514       182320332
HTG116       990        192291316
HTG117       739        168801207
HTG118       1087       193647321
HTG119       1101       193186076
HTG12        1451       183826000
HTG120       464        86304769
HTG121       1031       189856172
HTG122       1054       192626911
HTG123       1161       192048803
HTG124       1086       192991466
HTG125       1073       193035103
HTG126       720        125862637
HTG127       1120       192691168
HTG128       1087       192396449
HTG129       1080       192512306
HTG13        875        191580267
HTG130       1094       192371026
HTG131       1080       191988042
HTG132       1071       192267653
HTG133       1077       192406348
HTG134       1117       192086190
HTG135       1155       190016975
HTG136       240        23444335
HTG14        750        192192484
HTG15        745        192079551
HTG16        784        191991252
HTG17        800        191673948
HTG18        770        191911891
HTG19        2060       170753191
HTG2         2470       186037380
HTG20        1078       187572876
HTG21        933        184541383
HTG22        785        191651908
HTG23        928        190141652
HTG24        906        190387661
HTG25        811        191239638
HTG26        784        191781819
HTG27        874        191154594
HTG28        896        190443140
HTG29        939        189977999
HTG3         2513       185208586
HTG30        910        190822897
HTG31        843        171828946
HTG32        875        191097680
HTG33        966        189315433
HTG34        884        190984277
HTG35        865        191179116
HTG36        826        191553884
HTG37        948        189962435
HTG38        949        190503054
HTG39        940        190034955
HTG4         2550       188439001
HTG40        1047       189191247
HTG41        1103       170257655
HTG42        1257       188188838
HTG43        1169       188132191
HTG44        1150       188026157
HTG45        1118       191332771
HTG46        1269       190703866
HTG47        1174       190717160
HTG48        1130       191137302
HTG49        1047       191184441
HTG5         1283       185453274
HTG50        1021       189712765
HTG51        1061       180778979
HTG52        969        190090757
HTG53        1106       190109635
HTG54        1046       190260051
HTG55        1014       189766536
HTG56        967        189017980
HTG57        89         15545773
HTG58        1010       189344282
HTG59        1031       190032537
HTG6         1273       185124562
HTG60        1070       187377445
HTG61        1128       188170515
HTG62        1002       173184925
HTG63        1086       189585086
HTG64        1065       189567157
HTG65        1169       188828767
HTG66        1178       187478964
HTG67        1283       184490539
HTG68        95         12336833
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187658245
HTG73        1031       171977135
HTG74        1118       188295824
HTG75        1103       190843621
HTG76        1137       190917883
HTG77        1182       190813322
HTG78        1102       187147429
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190062476
HTG81        1214       189987246
HTG82        1120       189706900
HTG83        958        164506501
HTG84        1228       188383308
HTG85        1251       187687552
HTG86        1141       190046144
HTG87        1147       189797786
HTG88        990        169864866
HTG89        1183       189859637
HTG9         1200       186916809
HTG90        1104       190148649
HTG91        1145       190088330
HTG92        1100       190386057
HTG93        992        163352095
HTG94        1056       190721648
HTG95        1157       191052767
HTG96        1036       189089901
HTG97        1070       189523412
HTG98        697        129848543
HTG99        1018       189685746
INV1         94101      48399547
INV10        57626      88428724
INV11        83654      65541093
INV12        53552      42232276
INV13        85036      66305435
INV14        80904      66998014
INV15        78692      67790060
INV16        38378      36494398
INV17        8168       145023213
INV18        320        155148771
INV19        29051      118812911
INV2         8396       173252271
INV20        78018      65423005
INV21        73883      63166878
INV22        73366      49494194
INV23        74051      50376824
INV24        42929      100466924
INV25        1078       6779753
INV3         1188       167428329
INV4         23966      122201163
INV5         79467      71396354
INV6         36828      111459135
INV7         43107      103085585
INV8         4119       3200423
INV9         80644      71840339
MAM1         14080      163353933
MAM2         27184      146962170
MAM3         51853      94392894
MAM4         31524      148680320
MAM5         81866      77522000
MAM6         38820      59492200
PAT1         222584     70118640
PAT10        124645     102571664
PAT100       193712     81686401
PAT101       150217     108404022
PAT102       356051     11379688
PAT103       257211     57607099
PAT104       266090     51425150
PAT105       268710     45315201
PAT106       94335      72485595
PAT107       203659     47736667
PAT108       277827     9628431
PAT109       220409     46465135
PAT11        98067      63921710
PAT110       106723     2881242
PAT111       270386     21672571
PAT112       186754     61243094
PAT113       109815     106056960
PAT114       47499      9547002
PAT115       87390      88404059
PAT116       78495      95690560
PAT117       145700     77452710
PAT118       167131     71672065
PAT119       121715     92739548
PAT12        142116     62839306
PAT120       102686     85583689
PAT121       164069     42868362
PAT122       270022     5130418
PAT123       269978     5129582
PAT124       269978     5129582
PAT125       269634     5123046
PAT126       269396     5118524
PAT127       247246     29625533
PAT128       15355      3681658
PAT13        105847     59926449
PAT14        103682     50111599
PAT15        121155     53340285
PAT16        113167     61276231
PAT17        39069      16194026
PAT18        146866     52619866
PAT19        153883     78031245
PAT2         194513     84658194
PAT20        105015     118267861
PAT21        133366     95756379
PAT22        84489      78955747
PAT23        123584     103413558
PAT24        119395     105824731
PAT25        145802     86555806
PAT26        175038     64241582
PAT27        71181      1779525
PAT28        102177     77405969
PAT29        93964      87637529
PAT3         171988     95892359
PAT30        119943     61669806
PAT31        96657      78965237
PAT32        128385     55040981
PAT33        92184      51103312
PAT34        111301     78152661
PAT35        138107     29118428
PAT36        158496     24088068
PAT37        114684     49013158
PAT38        44860      54579798
PAT39        95735      83200429
PAT4         153746     106059888
PAT40        100229     70976055
PAT41        136206     39303264
PAT42        143781     35446940
PAT43        123737     64747144
PAT44        104348     81197381
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57169      23943480
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274454     6861350
PAT56        129252     31622558
PAT57        161322     77820344
PAT58        92937      89473089
PAT59        106721     74678844
PAT6         170642     91909261
PAT60        122357     64030175
PAT61        67098      30231972
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154847     88276419
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131174     97068238
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        109868     84438934
PAT84        342935     8573375
PAT85        188806     88519660
PAT86        111348     132068608
PAT87        3850       194703659
PAT88        131292     110979300
PAT89        158599     54826034
PAT9         129733     101132925
PAT90        224739     34113982
PAT91        250080     15844374
PAT92        180674     63687304
PAT93        51645      26035465
PAT94        114209     110462581
PAT95        137727     83290495
PAT96        164129     99338183
PAT97        158877     103325984
PAT98        137417     114988187
PAT99        42311      27994848
PHG1         5574       44675058
PLN1         59881      93426541
PLN10        37160      49276775
PLN11        37340      72908971
PLN12        14017      137396051
PLN13        7652       36617299
PLN14        17556      144689898
PLN15        17614      146132511
PLN16        17540      146254893
PLN17        24642      129067800
PLN18        5739       150765655
PLN19        1244       169457566
PLN2         24096      134545242
PLN20        15872      152719026
PLN21        5345       6422629
PLN22        67473      69922481
PLN23        28405      30656356
PLN24        77085      76410753
PLN25        65471      81618269
PLN26        40690      116669687
PLN27        15537      139705778
PLN28        19531      130509260
PLN29        77766      74269225
PLN3         1396       181629060
PLN30        90472      65894771
PLN31        48134      32709003
PLN32        80937      71251271
PLN33        78021      76066310
PLN34        80191      70541404
PLN35        81682      76684190
PLN36        45312      22112368
PLN37        101222     57728340
PLN38        81075      69277708
PLN39        45856      102100646
PLN4         1882       187350016
PLN40        78525      75284484
PLN41        78434      75314736
PLN42        74216      76796654
PLN43        17561      36623818
PLN5         1823       194438398
PLN6         15470      156794398
PLN7         75882      79387542
PLN8         8143       8485352
PLN9         73376      76197082
PRI1         23015      59645441
PRI10        1280       179427568
PRI11        745        90543993
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720991
PRI17        1137       193649117
PRI18        1098       194174732
PRI19        1166       193723867
PRI2         17590      150205814
PRI20        1759       191943310
PRI21        2748       190073284
PRI22        20543      69478867
PRI23        32483      85337156
PRI24        61487      78326126
PRI25        30556      68508260
PRI26        6602       167012246
PRI27        2120       180826269
PRI28        1603       181718304
PRI29        2030       181844962
PRI3         1435       175512642
PRI30        1976       180765380
PRI31        13058      154568425
PRI32        1295       183195058
PRI33        43857      104096766
PRI34        21463      27368236
PRI35        32191      63614159
PRI36        20231      117529774
PRI37        18704      147025890
PRI38        67371      86985568
PRI39        50314      89025658
PRI4         1288       185841046
PRI40        32945      61283195
PRI41        68786      81668506
PRI42        8632       42988582
PRI5         1317       183917363
PRI6         1182       180166249
PRI7         1250       181265435
PRI8         1216       178092374
PRI9         1360       174643732
ROD1         32001      141281577
ROD10        982        181217972
ROD11        208        39287360
ROD12        1034       185475616
ROD13        940        182704112
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185812687
ROD18        1189       190370327
ROD19        16440      82387923
ROD2         915        175229966
ROD20        20158      148888830
ROD21        1137       182363017
ROD22        1062       165597656
ROD23        13708      162712297
ROD24        38674      69920367
ROD25        21944      104115930
ROD26        1515       187856178
ROD27        137637     36990264
ROD28        82956      72586020
ROD29        27324      31930251
ROD3         908        173381822
ROD4         899        173861411
ROD5         922        174175352
ROD6         969        178238704
ROD7         965        179326222
ROD8         982        181406206
ROD9         997        182054285
STS1         85198      36520121
STS10        57907      44419978
STS11        49213      37736560
STS12        57924      43637361
STS13        64502      42942872
STS14        93330      34074517
STS15        103303     26251767
STS16        11147      3017128
STS17        102990     27289864
STS18        87041      34345853
STS19        98823      33227242
STS2         84773      49806133
STS20        54544      20186885
STS3         67436      26373836
STS4         75800      36971759
STS5         7808       4576869
STS6         54177      31603126
STS7         54081      31788805
STS8         54235      31906296
STS9         55657      37682948
SYN1         44280      72817447
SYN2         49092      70537397
SYN3         621        1853247
TSA1         120497     38242009
TSA10        89137      62197183
TSA11        134846     31200551
TSA12        76229      13521723
TSA2         113534     41672044
TSA3         110397     41018234
TSA4         111041     44110506
TSA5         30117      7017805
TSA6         117559     60377531
TSA7         110843     74874338
TSA8         116946     64891905
TSA9         114144     51421241
UNA1         222        120289
VRL1         70349      67339165
VRL10        44782      60282471
VRL11        62262      72140806
VRL12        58034      72255432
VRL13        61433      68435260
VRL14        59745      72773685
VRL15        59155      65373216
VRL2         73130      64084261
VRL3         70820      62797248
VRL4         69207      70548710
VRL5         36491      39712342
VRL6         48364      77592072
VRL7         63408      70096717
VRL8         61865      72467087
VRL9         65661      69894570
VRT1         34511      135701001
VRT10        1257       189413778
VRT11        8277       178097525
VRT12        3988       136034657
VRT13        13177      170897930
VRT14        5275       182914197
VRT15        3950       186224988
VRT16        38554      133290451
VRT17        80139      68443385
VRT18        78060      67236269
VRT19        78185      65601638
VRT2         11662      177600840
VRT20        63758      95987731
VRT21        77554      63547401
VRT22        11104      10538590
VRT3         62108      93097425
VRT4         20345      154696571
VRT5         19027      15793465
VRT6         73015      66830402
VRT7         31735      63527191
VRT8         30658      111967049
VRT9         1203       190000786

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 180.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

16403297 14891556303   Homo sapiens
7871531   8892650030   Mus musculus
2179595   6458987847   Rattus norvegicus
2190848   5362571338   Bos taurus
3892658   5037718386   Zea mays
3219186   4784078545   Sus scrofa
1698243   3125621603   Danio rerio
228238    1352920226   Strongylocentrotus purpuratus
1243345   1197439938   Oryza sativa Japonica Group
1756913   1187717551   Nicotiana tabacum
1424202   1147136093   Xenopus (Silurana) tropicalis
1212433   1049762304   Drosophila melanogaster
213953    1002175163   Pan troglodytes
2294285   1002146700   Arabidopsis thaliana
1452602    943091356   Canis lupus familiaris
660621     913979288   Vitis vinifera
810333     891564107   Gallus gallus
1880599    887191622   Glycine max
82244      823113612   Macaca mulatta
1216415    748356051   Ciona intestinalis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 180.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 180.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,	Gert Roosen,
	Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade,	Constantin Vasilyev

User Support
	Peter Cooper, Wayne Matten, Scott McGinnis, Steve Pechous, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center