Release Notes For GenBank Release 182

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2011

               NCBI-GenBank Flat File Release 182.0

                    Distribution Release Notes

 132015054 loci, 124277818310 bases, from 132015054 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 182.0
1.2 Cutoff Date
1.3 Important Changes in Release 182.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 182.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 182.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 182.0, incorporates data available to the collaborating
databases as of February 14, 2011 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 182.0

1.3.1 Organizational changes

The total number of sequence data files increased by 27 with this release:

  - the BCT division is now composed of  65 files (+2)
  - the CON division is now composed of 148 files (+5)
  - the ENV division is now composed of  40 files (+7)
  - the EST division is now composed of 433 files (+6)
  - the GSS division is now composed of 227 files (+3)
  - the MAM division is now composed of   7 files (+1)
  - the PAT division is now composed of 140 files (+2)
  - the TSA division is now composed of  16 files (+1)

The total number of 'index' files increased by 13 with this release:

  - the AUT (author name)  index is now composed of 95 files (+13)

1.3.2 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
ninety-five of the GSS flatfiles in Release 182.0. Consider gbgss133.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2011

                NCBI-GenBank Flat File Release 182.0

                           GSS Sequences (Part 1)

   87132 loci,    64062850 bases, from    87132 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "133" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

  A variety of changes affecting the GenBank flatfile format were implemented
in October 2010, as a result of discussions among DDBJ, EBI, and NCBI at the
May 2010 International Nucleotide Sequence Database Collaboration annual
meeting.

  However, three of the planned changes could not be completed for the
October 15 GenBank 180.0 release:

a) The /partial qualifier will be discontinued, given that 5' and 3'
   partiality can be indicated via a feature's location ('<' and '>').

b) A classification system will be introduced for the /inference and
   /experiment qualifiers, such that the inferential or experimental
   information can be associated with a feature's existence, location,
   or description.

c) A /whole_replicon qualifier will be introduced, allowing records
   which represent the entirety of a replicon (a chromosome; an organelle;
   a mitochondrial plasmid) to be identified as such.

  An investigation of (a) for older sequence records has thrown into question
whether the /partial qualifier can actually be done away with. On-going
review will determine whether this change will be implemented as agreed,
amended, or abandoned.

  The implementation of (b) has been delayed because of delays in software
development supporting the new classification system. We do not expect to
be able to deploy the new /inference and /experiment qualifiers until at
least February 2011.

  Specification of the conditions under which the /whole_replicon qualifier
is, and is not, allowed to be used for sequence records is not yet complete,
so implementation of (c) has likewise been delayed.

  We will inform GenBank users when the issues impacting these three changes
have been clarified.
  
1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1553 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbaut93.idx - Index of the entries according to author name, part 93.
97. gbaut94.idx - Index of the entries according to author name, part 94.
98. gbaut95.idx - Index of the entries according to author name, part 95.
99. gbbct1.seq - Bacterial sequence entries, part 1.
100. gbbct10.seq - Bacterial sequence entries, part 10.
101. gbbct11.seq - Bacterial sequence entries, part 11.
102. gbbct12.seq - Bacterial sequence entries, part 12.
103. gbbct13.seq - Bacterial sequence entries, part 13.
104. gbbct14.seq - Bacterial sequence entries, part 14.
105. gbbct15.seq - Bacterial sequence entries, part 15.
106. gbbct16.seq - Bacterial sequence entries, part 16.
107. gbbct17.seq - Bacterial sequence entries, part 17.
108. gbbct18.seq - Bacterial sequence entries, part 18.
109. gbbct19.seq - Bacterial sequence entries, part 19.
110. gbbct2.seq - Bacterial sequence entries, part 2.
111. gbbct20.seq - Bacterial sequence entries, part 20.
112. gbbct21.seq - Bacterial sequence entries, part 21.
113. gbbct22.seq - Bacterial sequence entries, part 22.
114. gbbct23.seq - Bacterial sequence entries, part 23.
115. gbbct24.seq - Bacterial sequence entries, part 24.
116. gbbct25.seq - Bacterial sequence entries, part 25.
117. gbbct26.seq - Bacterial sequence entries, part 26.
118. gbbct27.seq - Bacterial sequence entries, part 27.
119. gbbct28.seq - Bacterial sequence entries, part 28.
120. gbbct29.seq - Bacterial sequence entries, part 29.
121. gbbct3.seq - Bacterial sequence entries, part 3.
122. gbbct30.seq - Bacterial sequence entries, part 30.
123. gbbct31.seq - Bacterial sequence entries, part 31.
124. gbbct32.seq - Bacterial sequence entries, part 32.
125. gbbct33.seq - Bacterial sequence entries, part 33.
126. gbbct34.seq - Bacterial sequence entries, part 34.
127. gbbct35.seq - Bacterial sequence entries, part 35.
128. gbbct36.seq - Bacterial sequence entries, part 36.
129. gbbct37.seq - Bacterial sequence entries, part 37.
130. gbbct38.seq - Bacterial sequence entries, part 38.
131. gbbct39.seq - Bacterial sequence entries, part 39.
132. gbbct4.seq - Bacterial sequence entries, part 4.
133. gbbct40.seq - Bacterial sequence entries, part 40.
134. gbbct41.seq - Bacterial sequence entries, part 41.
135. gbbct42.seq - Bacterial sequence entries, part 42.
136. gbbct43.seq - Bacterial sequence entries, part 43.
137. gbbct44.seq - Bacterial sequence entries, part 44.
138. gbbct45.seq - Bacterial sequence entries, part 45.
139. gbbct46.seq - Bacterial sequence entries, part 46.
140. gbbct47.seq - Bacterial sequence entries, part 47.
141. gbbct48.seq - Bacterial sequence entries, part 48.
142. gbbct49.seq - Bacterial sequence entries, part 49.
143. gbbct5.seq - Bacterial sequence entries, part 5.
144. gbbct50.seq - Bacterial sequence entries, part 50.
145. gbbct51.seq - Bacterial sequence entries, part 51.
146. gbbct52.seq - Bacterial sequence entries, part 52.
147. gbbct53.seq - Bacterial sequence entries, part 53.
148. gbbct54.seq - Bacterial sequence entries, part 54.
149. gbbct55.seq - Bacterial sequence entries, part 55.
150. gbbct56.seq - Bacterial sequence entries, part 56.
151. gbbct57.seq - Bacterial sequence entries, part 57.
152. gbbct58.seq - Bacterial sequence entries, part 58.
153. gbbct59.seq - Bacterial sequence entries, part 59.
154. gbbct6.seq - Bacterial sequence entries, part 6.
155. gbbct60.seq - Bacterial sequence entries, part 60.
156. gbbct61.seq - Bacterial sequence entries, part 61.
157. gbbct62.seq - Bacterial sequence entries, part 62.
158. gbbct63.seq - Bacterial sequence entries, part 63.
159. gbbct64.seq - Bacterial sequence entries, part 64.
160. gbbct65.seq - Bacterial sequence entries, part 65.
161. gbbct7.seq - Bacterial sequence entries, part 7.
162. gbbct8.seq - Bacterial sequence entries, part 8.
163. gbbct9.seq - Bacterial sequence entries, part 9.
164. gbchg.txt - Accession numbers of entries updated since the previous release.
165. gbcon1.seq - Constructed sequence entries, part 1.
166. gbcon10.seq - Constructed sequence entries, part 10.
167. gbcon100.seq - Constructed sequence entries, part 100.
168. gbcon101.seq - Constructed sequence entries, part 101.
169. gbcon102.seq - Constructed sequence entries, part 102.
170. gbcon103.seq - Constructed sequence entries, part 103.
171. gbcon104.seq - Constructed sequence entries, part 104.
172. gbcon105.seq - Constructed sequence entries, part 105.
173. gbcon106.seq - Constructed sequence entries, part 106.
174. gbcon107.seq - Constructed sequence entries, part 107.
175. gbcon108.seq - Constructed sequence entries, part 108.
176. gbcon109.seq - Constructed sequence entries, part 109.
177. gbcon11.seq - Constructed sequence entries, part 11.
178. gbcon110.seq - Constructed sequence entries, part 110.
179. gbcon111.seq - Constructed sequence entries, part 111.
180. gbcon112.seq - Constructed sequence entries, part 112.
181. gbcon113.seq - Constructed sequence entries, part 113.
182. gbcon114.seq - Constructed sequence entries, part 114.
183. gbcon115.seq - Constructed sequence entries, part 115.
184. gbcon116.seq - Constructed sequence entries, part 116.
185. gbcon117.seq - Constructed sequence entries, part 117.
186. gbcon118.seq - Constructed sequence entries, part 118.
187. gbcon119.seq - Constructed sequence entries, part 119.
188. gbcon12.seq - Constructed sequence entries, part 12.
189. gbcon120.seq - Constructed sequence entries, part 120.
190. gbcon121.seq - Constructed sequence entries, part 121.
191. gbcon122.seq - Constructed sequence entries, part 122.
192. gbcon123.seq - Constructed sequence entries, part 123.
193. gbcon124.seq - Constructed sequence entries, part 124.
194. gbcon125.seq - Constructed sequence entries, part 125.
195. gbcon126.seq - Constructed sequence entries, part 126.
196. gbcon127.seq - Constructed sequence entries, part 127.
197. gbcon128.seq - Constructed sequence entries, part 128.
198. gbcon129.seq - Constructed sequence entries, part 129.
199. gbcon13.seq - Constructed sequence entries, part 13.
200. gbcon130.seq - Constructed sequence entries, part 130.
201. gbcon131.seq - Constructed sequence entries, part 131.
202. gbcon132.seq - Constructed sequence entries, part 132.
203. gbcon133.seq - Constructed sequence entries, part 133.
204. gbcon134.seq - Constructed sequence entries, part 134.
205. gbcon135.seq - Constructed sequence entries, part 135.
206. gbcon136.seq - Constructed sequence entries, part 136.
207. gbcon137.seq - Constructed sequence entries, part 137.
208. gbcon138.seq - Constructed sequence entries, part 138.
209. gbcon139.seq - Constructed sequence entries, part 139.
210. gbcon14.seq - Constructed sequence entries, part 14.
211. gbcon140.seq - Constructed sequence entries, part 140.
212. gbcon141.seq - Constructed sequence entries, part 141.
213. gbcon142.seq - Constructed sequence entries, part 142.
214. gbcon143.seq - Constructed sequence entries, part 143.
215. gbcon144.seq - Constructed sequence entries, part 144.
216. gbcon145.seq - Constructed sequence entries, part 145.
217. gbcon146.seq - Constructed sequence entries, part 146.
218. gbcon147.seq - Constructed sequence entries, part 147.
219. gbcon148.seq - Constructed sequence entries, part 148.
220. gbcon15.seq - Constructed sequence entries, part 15.
221. gbcon16.seq - Constructed sequence entries, part 16.
222. gbcon17.seq - Constructed sequence entries, part 17.
223. gbcon18.seq - Constructed sequence entries, part 18.
224. gbcon19.seq - Constructed sequence entries, part 19.
225. gbcon2.seq - Constructed sequence entries, part 2.
226. gbcon20.seq - Constructed sequence entries, part 20.
227. gbcon21.seq - Constructed sequence entries, part 21.
228. gbcon22.seq - Constructed sequence entries, part 22.
229. gbcon23.seq - Constructed sequence entries, part 23.
230. gbcon24.seq - Constructed sequence entries, part 24.
231. gbcon25.seq - Constructed sequence entries, part 25.
232. gbcon26.seq - Constructed sequence entries, part 26.
233. gbcon27.seq - Constructed sequence entries, part 27.
234. gbcon28.seq - Constructed sequence entries, part 28.
235. gbcon29.seq - Constructed sequence entries, part 29.
236. gbcon3.seq - Constructed sequence entries, part 3.
237. gbcon30.seq - Constructed sequence entries, part 30.
238. gbcon31.seq - Constructed sequence entries, part 31.
239. gbcon32.seq - Constructed sequence entries, part 32.
240. gbcon33.seq - Constructed sequence entries, part 33.
241. gbcon34.seq - Constructed sequence entries, part 34.
242. gbcon35.seq - Constructed sequence entries, part 35.
243. gbcon36.seq - Constructed sequence entries, part 36.
244. gbcon37.seq - Constructed sequence entries, part 37.
245. gbcon38.seq - Constructed sequence entries, part 38.
246. gbcon39.seq - Constructed sequence entries, part 39.
247. gbcon4.seq - Constructed sequence entries, part 4.
248. gbcon40.seq - Constructed sequence entries, part 40.
249. gbcon41.seq - Constructed sequence entries, part 41.
250. gbcon42.seq - Constructed sequence entries, part 42.
251. gbcon43.seq - Constructed sequence entries, part 43.
252. gbcon44.seq - Constructed sequence entries, part 44.
253. gbcon45.seq - Constructed sequence entries, part 45.
254. gbcon46.seq - Constructed sequence entries, part 46.
255. gbcon47.seq - Constructed sequence entries, part 47.
256. gbcon48.seq - Constructed sequence entries, part 48.
257. gbcon49.seq - Constructed sequence entries, part 49.
258. gbcon5.seq - Constructed sequence entries, part 5.
259. gbcon50.seq - Constructed sequence entries, part 50.
260. gbcon51.seq - Constructed sequence entries, part 51.
261. gbcon52.seq - Constructed sequence entries, part 52.
262. gbcon53.seq - Constructed sequence entries, part 53.
263. gbcon54.seq - Constructed sequence entries, part 54.
264. gbcon55.seq - Constructed sequence entries, part 55.
265. gbcon56.seq - Constructed sequence entries, part 56.
266. gbcon57.seq - Constructed sequence entries, part 57.
267. gbcon58.seq - Constructed sequence entries, part 58.
268. gbcon59.seq - Constructed sequence entries, part 59.
269. gbcon6.seq - Constructed sequence entries, part 6.
270. gbcon60.seq - Constructed sequence entries, part 60.
271. gbcon61.seq - Constructed sequence entries, part 61.
272. gbcon62.seq - Constructed sequence entries, part 62.
273. gbcon63.seq - Constructed sequence entries, part 63.
274. gbcon64.seq - Constructed sequence entries, part 64.
275. gbcon65.seq - Constructed sequence entries, part 65.
276. gbcon66.seq - Constructed sequence entries, part 66.
277. gbcon67.seq - Constructed sequence entries, part 67.
278. gbcon68.seq - Constructed sequence entries, part 68.
279. gbcon69.seq - Constructed sequence entries, part 69.
280. gbcon7.seq - Constructed sequence entries, part 7.
281. gbcon70.seq - Constructed sequence entries, part 70.
282. gbcon71.seq - Constructed sequence entries, part 71.
283. gbcon72.seq - Constructed sequence entries, part 72.
284. gbcon73.seq - Constructed sequence entries, part 73.
285. gbcon74.seq - Constructed sequence entries, part 74.
286. gbcon75.seq - Constructed sequence entries, part 75.
287. gbcon76.seq - Constructed sequence entries, part 76.
288. gbcon77.seq - Constructed sequence entries, part 77.
289. gbcon78.seq - Constructed sequence entries, part 78.
290. gbcon79.seq - Constructed sequence entries, part 79.
291. gbcon8.seq - Constructed sequence entries, part 8.
292. gbcon80.seq - Constructed sequence entries, part 80.
293. gbcon81.seq - Constructed sequence entries, part 81.
294. gbcon82.seq - Constructed sequence entries, part 82.
295. gbcon83.seq - Constructed sequence entries, part 83.
296. gbcon84.seq - Constructed sequence entries, part 84.
297. gbcon85.seq - Constructed sequence entries, part 85.
298. gbcon86.seq - Constructed sequence entries, part 86.
299. gbcon87.seq - Constructed sequence entries, part 87.
300. gbcon88.seq - Constructed sequence entries, part 88.
301. gbcon89.seq - Constructed sequence entries, part 89.
302. gbcon9.seq - Constructed sequence entries, part 9.
303. gbcon90.seq - Constructed sequence entries, part 90.
304. gbcon91.seq - Constructed sequence entries, part 91.
305. gbcon92.seq - Constructed sequence entries, part 92.
306. gbcon93.seq - Constructed sequence entries, part 93.
307. gbcon94.seq - Constructed sequence entries, part 94.
308. gbcon95.seq - Constructed sequence entries, part 95.
309. gbcon96.seq - Constructed sequence entries, part 96.
310. gbcon97.seq - Constructed sequence entries, part 97.
311. gbcon98.seq - Constructed sequence entries, part 98.
312. gbcon99.seq - Constructed sequence entries, part 99.
313. gbdel.txt - Accession numbers of entries deleted since the previous release.
314. gbenv1.seq - Environmental sampling sequence entries, part 1.
315. gbenv10.seq - Environmental sampling sequence entries, part 10.
316. gbenv11.seq - Environmental sampling sequence entries, part 11.
317. gbenv12.seq - Environmental sampling sequence entries, part 12.
318. gbenv13.seq - Environmental sampling sequence entries, part 13.
319. gbenv14.seq - Environmental sampling sequence entries, part 14.
320. gbenv15.seq - Environmental sampling sequence entries, part 15.
321. gbenv16.seq - Environmental sampling sequence entries, part 16.
322. gbenv17.seq - Environmental sampling sequence entries, part 17.
323. gbenv18.seq - Environmental sampling sequence entries, part 18.
324. gbenv19.seq - Environmental sampling sequence entries, part 19.
325. gbenv2.seq - Environmental sampling sequence entries, part 2.
326. gbenv20.seq - Environmental sampling sequence entries, part 20.
327. gbenv21.seq - Environmental sampling sequence entries, part 21.
328. gbenv22.seq - Environmental sampling sequence entries, part 22.
329. gbenv23.seq - Environmental sampling sequence entries, part 23.
330. gbenv24.seq - Environmental sampling sequence entries, part 24.
331. gbenv25.seq - Environmental sampling sequence entries, part 25.
332. gbenv26.seq - Environmental sampling sequence entries, part 26.
333. gbenv27.seq - Environmental sampling sequence entries, part 27.
334. gbenv28.seq - Environmental sampling sequence entries, part 28.
335. gbenv29.seq - Environmental sampling sequence entries, part 29.
336. gbenv3.seq - Environmental sampling sequence entries, part 3.
337. gbenv30.seq - Environmental sampling sequence entries, part 30.
338. gbenv31.seq - Environmental sampling sequence entries, part 31.
339. gbenv32.seq - Environmental sampling sequence entries, part 32.
340. gbenv33.seq - Environmental sampling sequence entries, part 33.
341. gbenv34.seq - Environmental sampling sequence entries, part 34.
342. gbenv35.seq - Environmental sampling sequence entries, part 35.
343. gbenv36.seq - Environmental sampling sequence entries, part 36.
344. gbenv37.seq - Environmental sampling sequence entries, part 37.
345. gbenv38.seq - Environmental sampling sequence entries, part 38.
346. gbenv39.seq - Environmental sampling sequence entries, part 39.
347. gbenv4.seq - Environmental sampling sequence entries, part 4.
348. gbenv40.seq - Environmental sampling sequence entries, part 40.
349. gbenv5.seq - Environmental sampling sequence entries, part 5.
350. gbenv6.seq - Environmental sampling sequence entries, part 6.
351. gbenv7.seq - Environmental sampling sequence entries, part 7.
352. gbenv8.seq - Environmental sampling sequence entries, part 8.
353. gbenv9.seq - Environmental sampling sequence entries, part 9.
354. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
355. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
356. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
357. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
358. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
359. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
360. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
361. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
362. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
363. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
364. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
365. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
366. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
367. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
368. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
369. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
370. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
371. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
372. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
373. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
374. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
375. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
376. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
377. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
378. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
379. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
380. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
381. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
382. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
383. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
384. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
385. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
386. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
387. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
388. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
389. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
390. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
391. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
392. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
393. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
394. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
395. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
396. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
397. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
398. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
399. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
400. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
401. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
402. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
403. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
404. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
405. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
406. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
407. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
408. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
409. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
410. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
411. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
412. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
413. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
414. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
415. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
416. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
417. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
418. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
419. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
420. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
421. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
422. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
423. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
424. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
425. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
426. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
427. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
428. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
429. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
430. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
431. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
432. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
433. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
434. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
435. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
436. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
437. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
438. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
439. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
440. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
441. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
442. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
443. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
444. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
445. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
446. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
447. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
448. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
449. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
450. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
451. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
452. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
453. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
454. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
455. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
456. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
457. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
458. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
459. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
460. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
461. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
462. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
463. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
464. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
465. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
466. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
467. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
468. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
469. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
470. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
471. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
472. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
473. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
474. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
475. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
476. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
477. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
478. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
479. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
480. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
481. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
482. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
483. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
484. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
485. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
486. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
487. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
488. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
489. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
490. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
491. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
492. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
493. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
494. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
495. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
496. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
497. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
498. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
499. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
500. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
501. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
502. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
503. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
504. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
505. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
506. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
507. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
508. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
509. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
510. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
511. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
512. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
513. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
514. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
515. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
516. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
517. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
518. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
519. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
520. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
521. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
522. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
523. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
524. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
525. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
526. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
527. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
528. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
529. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
530. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
531. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
532. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
533. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
534. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
535. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
536. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
537. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
538. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
539. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
540. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
541. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
542. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
543. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
544. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
545. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
546. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
547. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
548. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
549. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
550. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
551. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
552. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
553. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
554. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
555. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
556. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
557. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
558. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
559. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
560. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
561. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
562. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
563. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
564. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
565. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
566. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
567. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
568. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
569. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
570. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
571. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
572. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
573. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
574. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
575. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
576. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
577. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
578. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
579. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
580. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
581. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
582. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
583. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
584. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
585. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
586. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
587. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
588. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
589. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
590. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
591. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
592. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
593. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
594. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
595. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
596. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
597. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
598. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
599. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
600. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
601. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
602. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
603. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
604. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
605. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
606. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
607. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
608. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
609. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
610. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
611. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
612. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
613. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
614. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
615. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
616. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
617. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
618. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
619. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
620. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
621. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
622. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
623. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
624. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
625. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
626. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
627. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
628. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
629. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
630. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
631. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
632. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
633. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
634. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
635. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
636. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
637. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
638. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
639. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
640. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
641. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
642. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
643. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
644. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
645. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
646. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
647. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
648. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
649. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
650. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
651. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
652. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
653. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
654. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
655. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
656. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
657. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
658. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
659. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
660. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
661. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
662. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
663. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
664. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
665. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
666. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
667. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
668. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
669. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
670. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
671. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
672. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
673. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
674. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
675. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
676. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
677. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
678. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
679. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
680. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
681. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
682. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
683. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
684. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
685. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
686. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
687. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
688. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
689. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
690. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
691. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
692. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
693. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
694. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
695. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
696. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
697. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
698. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
699. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
700. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
701. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
702. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
703. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
704. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
705. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
706. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
707. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
708. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
709. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
710. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
711. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
712. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
713. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
714. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
715. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
716. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
717. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
718. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
719. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
720. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
721. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
722. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
723. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
724. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
725. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
726. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
727. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
728. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
729. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
730. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
731. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
732. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
733. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
734. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
735. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
736. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
737. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
738. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
739. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
740. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
741. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
742. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
743. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
744. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
745. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
746. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
747. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
748. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
749. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
750. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
751. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
752. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
753. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
754. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
755. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
756. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
757. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
758. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
759. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
760. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
761. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
762. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
763. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
764. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
765. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
766. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
767. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
768. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
769. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
770. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
771. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
772. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
773. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
774. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
775. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
776. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
777. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
778. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
779. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
780. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
781. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
782. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
783. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
784. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
785. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
786. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
787. gbgen.idx - Index of the entries according to gene symbols.
788. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
789. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
790. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
791. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
792. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
793. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
794. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
795. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
796. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
797. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
798. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
799. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
800. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
801. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
802. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
803. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
804. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
805. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
806. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
807. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
808. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
809. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
810. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
811. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
812. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
813. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
814. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
815. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
816. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
817. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
818. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
819. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
820. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
821. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
822. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
823. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
824. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
825. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
826. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
827. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
828. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
829. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
830. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
831. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
832. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
833. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
834. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
835. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
836. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
837. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
838. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
839. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
840. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
841. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
842. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
843. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
844. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
845. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
846. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
847. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
848. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
849. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
850. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
851. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
852. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
853. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
854. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
855. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
856. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
857. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
858. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
859. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
860. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
861. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
862. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
863. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
864. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
865. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
866. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
867. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
868. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
869. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
870. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
871. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
872. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
873. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
874. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
875. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
876. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
877. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
878. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
879. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
880. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
881. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
882. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
883. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
884. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
885. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
886. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
887. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
888. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
889. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
890. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
891. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
892. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
893. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
894. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
895. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
896. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
897. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
898. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
899. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
900. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
901. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
902. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
903. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
904. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
905. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
906. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
907. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
908. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
909. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
910. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
911. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
912. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
913. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
914. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
915. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
916. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
917. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
918. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
919. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
920. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
921. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
922. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
923. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
924. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
925. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
926. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
927. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
928. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
929. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
930. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
931. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
932. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
933. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
934. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
935. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
936. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
937. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
938. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
939. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
940. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
941. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
942. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
943. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
944. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
945. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
946. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
947. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
948. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
949. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
950. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
951. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
952. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
953. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
954. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
955. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
956. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
957. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
958. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
959. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
960. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
961. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
962. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
963. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
964. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
965. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
966. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
967. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
968. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
969. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
970. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
971. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
972. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
973. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
974. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
975. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
976. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
977. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
978. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
979. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
980. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
981. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
982. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
983. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
984. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
985. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
986. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
987. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
988. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
989. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
990. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
991. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
992. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
993. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
994. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
995. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
996. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
997. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
998. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
999. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1000. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1001. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1002. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1003. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1004. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1005. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1006. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1007. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1008. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1009. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1010. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1011. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1012. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1013. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1014. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1015. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1016. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1017. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1018. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1019. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1020. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1021. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1022. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1023. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1024. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1025. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1026. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1027. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1028. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1029. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1030. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1031. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1032. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1033. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1034. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1035. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1036. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1037. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1038. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1039. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1040. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1041. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1042. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1043. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1044. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1045. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1046. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1047. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1048. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1049. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1050. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1051. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1052. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1053. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1054. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1055. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1056. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1057. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1058. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1059. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1060. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1061. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1062. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1063. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1064. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1065. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1066. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1067. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1068. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1069. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1070. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1071. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1072. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1073. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1074. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1075. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1076. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1077. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1078. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1079. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1080. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1081. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1082. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1083. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1084. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1085. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1086. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1087. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1088. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1089. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1090. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1091. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1092. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1093. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1094. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1095. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1096. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1097. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1098. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1099. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1100. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1101. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1102. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1103. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1104. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1105. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1106. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1107. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1108. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1109. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1110. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1111. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1112. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1113. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1114. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1115. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1116. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1117. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1118. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1119. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1120. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1121. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1122. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1123. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1124. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1125. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1126. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1127. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1128. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1129. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1130. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1131. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1132. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1133. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1134. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1135. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1136. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1137. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1138. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1139. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1140. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1141. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1142. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1143. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1144. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1145. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1146. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1147. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1148. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1149. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1150. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1151. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1152. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1153. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1154. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1155. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1156. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1157. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1158. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1159. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1160. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1161. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1162. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1163. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1164. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1165. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1166. gbinv1.seq - Invertebrate sequence entries, part 1.
1167. gbinv10.seq - Invertebrate sequence entries, part 10.
1168. gbinv11.seq - Invertebrate sequence entries, part 11.
1169. gbinv12.seq - Invertebrate sequence entries, part 12.
1170. gbinv13.seq - Invertebrate sequence entries, part 13.
1171. gbinv14.seq - Invertebrate sequence entries, part 14.
1172. gbinv15.seq - Invertebrate sequence entries, part 15.
1173. gbinv16.seq - Invertebrate sequence entries, part 16.
1174. gbinv17.seq - Invertebrate sequence entries, part 17.
1175. gbinv18.seq - Invertebrate sequence entries, part 18.
1176. gbinv19.seq - Invertebrate sequence entries, part 19.
1177. gbinv2.seq - Invertebrate sequence entries, part 2.
1178. gbinv20.seq - Invertebrate sequence entries, part 20.
1179. gbinv21.seq - Invertebrate sequence entries, part 21.
1180. gbinv22.seq - Invertebrate sequence entries, part 22.
1181. gbinv23.seq - Invertebrate sequence entries, part 23.
1182. gbinv24.seq - Invertebrate sequence entries, part 24.
1183. gbinv25.seq - Invertebrate sequence entries, part 25.
1184. gbinv26.seq - Invertebrate sequence entries, part 26.
1185. gbinv3.seq - Invertebrate sequence entries, part 3.
1186. gbinv4.seq - Invertebrate sequence entries, part 4.
1187. gbinv5.seq - Invertebrate sequence entries, part 5.
1188. gbinv6.seq - Invertebrate sequence entries, part 6.
1189. gbinv7.seq - Invertebrate sequence entries, part 7.
1190. gbinv8.seq - Invertebrate sequence entries, part 8.
1191. gbinv9.seq - Invertebrate sequence entries, part 9.
1192. gbjou1.idx - Index of the entries according to journal citation, part 1.
1193. gbjou10.idx - Index of the entries according to journal citation, part 10.
1194. gbjou2.idx - Index of the entries according to journal citation, part 2.
1195. gbjou3.idx - Index of the entries according to journal citation, part 3.
1196. gbjou4.idx - Index of the entries according to journal citation, part 4.
1197. gbjou5.idx - Index of the entries according to journal citation, part 5.
1198. gbjou6.idx - Index of the entries according to journal citation, part 6.
1199. gbjou7.idx - Index of the entries according to journal citation, part 7.
1200. gbjou8.idx - Index of the entries according to journal citation, part 8.
1201. gbjou9.idx - Index of the entries according to journal citation, part 9.
1202. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1203. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1204. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1205. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1206. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1207. gbmam1.seq - Other mammalian sequence entries, part 1.
1208. gbmam2.seq - Other mammalian sequence entries, part 2.
1209. gbmam3.seq - Other mammalian sequence entries, part 3.
1210. gbmam4.seq - Other mammalian sequence entries, part 4.
1211. gbmam5.seq - Other mammalian sequence entries, part 5.
1212. gbmam6.seq - Other mammalian sequence entries, part 6.
1213. gbmam7.seq - Other mammalian sequence entries, part 7.
1214. gbnew.txt - Accession numbers of entries new since the previous release.
1215. gbpat1.seq - Patent sequence entries, part 1.
1216. gbpat10.seq - Patent sequence entries, part 10.
1217. gbpat100.seq - Patent sequence entries, part 100.
1218. gbpat101.seq - Patent sequence entries, part 101.
1219. gbpat102.seq - Patent sequence entries, part 102.
1220. gbpat103.seq - Patent sequence entries, part 103.
1221. gbpat104.seq - Patent sequence entries, part 104.
1222. gbpat105.seq - Patent sequence entries, part 105.
1223. gbpat106.seq - Patent sequence entries, part 106.
1224. gbpat107.seq - Patent sequence entries, part 107.
1225. gbpat108.seq - Patent sequence entries, part 108.
1226. gbpat109.seq - Patent sequence entries, part 109.
1227. gbpat11.seq - Patent sequence entries, part 11.
1228. gbpat110.seq - Patent sequence entries, part 110.
1229. gbpat111.seq - Patent sequence entries, part 111.
1230. gbpat112.seq - Patent sequence entries, part 112.
1231. gbpat113.seq - Patent sequence entries, part 113.
1232. gbpat114.seq - Patent sequence entries, part 114.
1233. gbpat115.seq - Patent sequence entries, part 115.
1234. gbpat116.seq - Patent sequence entries, part 116.
1235. gbpat117.seq - Patent sequence entries, part 117.
1236. gbpat118.seq - Patent sequence entries, part 118.
1237. gbpat119.seq - Patent sequence entries, part 119.
1238. gbpat12.seq - Patent sequence entries, part 12.
1239. gbpat120.seq - Patent sequence entries, part 120.
1240. gbpat121.seq - Patent sequence entries, part 121.
1241. gbpat122.seq - Patent sequence entries, part 122.
1242. gbpat123.seq - Patent sequence entries, part 123.
1243. gbpat124.seq - Patent sequence entries, part 124.
1244. gbpat125.seq - Patent sequence entries, part 125.
1245. gbpat126.seq - Patent sequence entries, part 126.
1246. gbpat127.seq - Patent sequence entries, part 127.
1247. gbpat128.seq - Patent sequence entries, part 128.
1248. gbpat129.seq - Patent sequence entries, part 129.
1249. gbpat13.seq - Patent sequence entries, part 13.
1250. gbpat130.seq - Patent sequence entries, part 130.
1251. gbpat131.seq - Patent sequence entries, part 131.
1252. gbpat132.seq - Patent sequence entries, part 132.
1253. gbpat133.seq - Patent sequence entries, part 133.
1254. gbpat134.seq - Patent sequence entries, part 134.
1255. gbpat135.seq - Patent sequence entries, part 135.
1256. gbpat136.seq - Patent sequence entries, part 136.
1257. gbpat137.seq - Patent sequence entries, part 137.
1258. gbpat138.seq - Patent sequence entries, part 138.
1259. gbpat139.seq - Patent sequence entries, part 139.
1260. gbpat14.seq - Patent sequence entries, part 14.
1261. gbpat140.seq - Patent sequence entries, part 140.
1262. gbpat15.seq - Patent sequence entries, part 15.
1263. gbpat16.seq - Patent sequence entries, part 16.
1264. gbpat17.seq - Patent sequence entries, part 17.
1265. gbpat18.seq - Patent sequence entries, part 18.
1266. gbpat19.seq - Patent sequence entries, part 19.
1267. gbpat2.seq - Patent sequence entries, part 2.
1268. gbpat20.seq - Patent sequence entries, part 20.
1269. gbpat21.seq - Patent sequence entries, part 21.
1270. gbpat22.seq - Patent sequence entries, part 22.
1271. gbpat23.seq - Patent sequence entries, part 23.
1272. gbpat24.seq - Patent sequence entries, part 24.
1273. gbpat25.seq - Patent sequence entries, part 25.
1274. gbpat26.seq - Patent sequence entries, part 26.
1275. gbpat27.seq - Patent sequence entries, part 27.
1276. gbpat28.seq - Patent sequence entries, part 28.
1277. gbpat29.seq - Patent sequence entries, part 29.
1278. gbpat3.seq - Patent sequence entries, part 3.
1279. gbpat30.seq - Patent sequence entries, part 30.
1280. gbpat31.seq - Patent sequence entries, part 31.
1281. gbpat32.seq - Patent sequence entries, part 32.
1282. gbpat33.seq - Patent sequence entries, part 33.
1283. gbpat34.seq - Patent sequence entries, part 34.
1284. gbpat35.seq - Patent sequence entries, part 35.
1285. gbpat36.seq - Patent sequence entries, part 36.
1286. gbpat37.seq - Patent sequence entries, part 37.
1287. gbpat38.seq - Patent sequence entries, part 38.
1288. gbpat39.seq - Patent sequence entries, part 39.
1289. gbpat4.seq - Patent sequence entries, part 4.
1290. gbpat40.seq - Patent sequence entries, part 40.
1291. gbpat41.seq - Patent sequence entries, part 41.
1292. gbpat42.seq - Patent sequence entries, part 42.
1293. gbpat43.seq - Patent sequence entries, part 43.
1294. gbpat44.seq - Patent sequence entries, part 44.
1295. gbpat45.seq - Patent sequence entries, part 45.
1296. gbpat46.seq - Patent sequence entries, part 46.
1297. gbpat47.seq - Patent sequence entries, part 47.
1298. gbpat48.seq - Patent sequence entries, part 48.
1299. gbpat49.seq - Patent sequence entries, part 49.
1300. gbpat5.seq - Patent sequence entries, part 5.
1301. gbpat50.seq - Patent sequence entries, part 50.
1302. gbpat51.seq - Patent sequence entries, part 51.
1303. gbpat52.seq - Patent sequence entries, part 52.
1304. gbpat53.seq - Patent sequence entries, part 53.
1305. gbpat54.seq - Patent sequence entries, part 54.
1306. gbpat55.seq - Patent sequence entries, part 55.
1307. gbpat56.seq - Patent sequence entries, part 56.
1308. gbpat57.seq - Patent sequence entries, part 57.
1309. gbpat58.seq - Patent sequence entries, part 58.
1310. gbpat59.seq - Patent sequence entries, part 59.
1311. gbpat6.seq - Patent sequence entries, part 6.
1312. gbpat60.seq - Patent sequence entries, part 60.
1313. gbpat61.seq - Patent sequence entries, part 61.
1314. gbpat62.seq - Patent sequence entries, part 62.
1315. gbpat63.seq - Patent sequence entries, part 63.
1316. gbpat64.seq - Patent sequence entries, part 64.
1317. gbpat65.seq - Patent sequence entries, part 65.
1318. gbpat66.seq - Patent sequence entries, part 66.
1319. gbpat67.seq - Patent sequence entries, part 67.
1320. gbpat68.seq - Patent sequence entries, part 68.
1321. gbpat69.seq - Patent sequence entries, part 69.
1322. gbpat7.seq - Patent sequence entries, part 7.
1323. gbpat70.seq - Patent sequence entries, part 70.
1324. gbpat71.seq - Patent sequence entries, part 71.
1325. gbpat72.seq - Patent sequence entries, part 72.
1326. gbpat73.seq - Patent sequence entries, part 73.
1327. gbpat74.seq - Patent sequence entries, part 74.
1328. gbpat75.seq - Patent sequence entries, part 75.
1329. gbpat76.seq - Patent sequence entries, part 76.
1330. gbpat77.seq - Patent sequence entries, part 77.
1331. gbpat78.seq - Patent sequence entries, part 78.
1332. gbpat79.seq - Patent sequence entries, part 79.
1333. gbpat8.seq - Patent sequence entries, part 8.
1334. gbpat80.seq - Patent sequence entries, part 80.
1335. gbpat81.seq - Patent sequence entries, part 81.
1336. gbpat82.seq - Patent sequence entries, part 82.
1337. gbpat83.seq - Patent sequence entries, part 83.
1338. gbpat84.seq - Patent sequence entries, part 84.
1339. gbpat85.seq - Patent sequence entries, part 85.
1340. gbpat86.seq - Patent sequence entries, part 86.
1341. gbpat87.seq - Patent sequence entries, part 87.
1342. gbpat88.seq - Patent sequence entries, part 88.
1343. gbpat89.seq - Patent sequence entries, part 89.
1344. gbpat9.seq - Patent sequence entries, part 9.
1345. gbpat90.seq - Patent sequence entries, part 90.
1346. gbpat91.seq - Patent sequence entries, part 91.
1347. gbpat92.seq - Patent sequence entries, part 92.
1348. gbpat93.seq - Patent sequence entries, part 93.
1349. gbpat94.seq - Patent sequence entries, part 94.
1350. gbpat95.seq - Patent sequence entries, part 95.
1351. gbpat96.seq - Patent sequence entries, part 96.
1352. gbpat97.seq - Patent sequence entries, part 97.
1353. gbpat98.seq - Patent sequence entries, part 98.
1354. gbpat99.seq - Patent sequence entries, part 99.
1355. gbphg1.seq - Phage sequence entries, part 1.
1356. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1357. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1358. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1359. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1360. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1361. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1362. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1363. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1364. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1365. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1366. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1367. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1368. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1369. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1370. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1371. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1372. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1373. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1374. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1375. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1376. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1377. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1378. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1379. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1380. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1381. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1382. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1383. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1384. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1385. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1386. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1387. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1388. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1389. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1390. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1391. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1392. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1393. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1394. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1395. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1396. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1397. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1398. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1399. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1400. gbpri1.seq - Primate sequence entries, part 1.
1401. gbpri10.seq - Primate sequence entries, part 10.
1402. gbpri11.seq - Primate sequence entries, part 11.
1403. gbpri12.seq - Primate sequence entries, part 12.
1404. gbpri13.seq - Primate sequence entries, part 13.
1405. gbpri14.seq - Primate sequence entries, part 14.
1406. gbpri15.seq - Primate sequence entries, part 15.
1407. gbpri16.seq - Primate sequence entries, part 16.
1408. gbpri17.seq - Primate sequence entries, part 17.
1409. gbpri18.seq - Primate sequence entries, part 18.
1410. gbpri19.seq - Primate sequence entries, part 19.
1411. gbpri2.seq - Primate sequence entries, part 2.
1412. gbpri20.seq - Primate sequence entries, part 20.
1413. gbpri21.seq - Primate sequence entries, part 21.
1414. gbpri22.seq - Primate sequence entries, part 22.
1415. gbpri23.seq - Primate sequence entries, part 23.
1416. gbpri24.seq - Primate sequence entries, part 24.
1417. gbpri25.seq - Primate sequence entries, part 25.
1418. gbpri26.seq - Primate sequence entries, part 26.
1419. gbpri27.seq - Primate sequence entries, part 27.
1420. gbpri28.seq - Primate sequence entries, part 28.
1421. gbpri29.seq - Primate sequence entries, part 29.
1422. gbpri3.seq - Primate sequence entries, part 3.
1423. gbpri30.seq - Primate sequence entries, part 30.
1424. gbpri31.seq - Primate sequence entries, part 31.
1425. gbpri32.seq - Primate sequence entries, part 32.
1426. gbpri33.seq - Primate sequence entries, part 33.
1427. gbpri34.seq - Primate sequence entries, part 34.
1428. gbpri35.seq - Primate sequence entries, part 35.
1429. gbpri36.seq - Primate sequence entries, part 36.
1430. gbpri37.seq - Primate sequence entries, part 37.
1431. gbpri38.seq - Primate sequence entries, part 38.
1432. gbpri39.seq - Primate sequence entries, part 39.
1433. gbpri4.seq - Primate sequence entries, part 4.
1434. gbpri40.seq - Primate sequence entries, part 40.
1435. gbpri41.seq - Primate sequence entries, part 41.
1436. gbpri42.seq - Primate sequence entries, part 42.
1437. gbpri5.seq - Primate sequence entries, part 5.
1438. gbpri6.seq - Primate sequence entries, part 6.
1439. gbpri7.seq - Primate sequence entries, part 7.
1440. gbpri8.seq - Primate sequence entries, part 8.
1441. gbpri9.seq - Primate sequence entries, part 9.
1442. gbrel.txt - Release notes (this document).
1443. gbrod1.seq - Rodent sequence entries, part 1.
1444. gbrod10.seq - Rodent sequence entries, part 10.
1445. gbrod11.seq - Rodent sequence entries, part 11.
1446. gbrod12.seq - Rodent sequence entries, part 12.
1447. gbrod13.seq - Rodent sequence entries, part 13.
1448. gbrod14.seq - Rodent sequence entries, part 14.
1449. gbrod15.seq - Rodent sequence entries, part 15.
1450. gbrod16.seq - Rodent sequence entries, part 16.
1451. gbrod17.seq - Rodent sequence entries, part 17.
1452. gbrod18.seq - Rodent sequence entries, part 18.
1453. gbrod19.seq - Rodent sequence entries, part 19.
1454. gbrod2.seq - Rodent sequence entries, part 2.
1455. gbrod20.seq - Rodent sequence entries, part 20.
1456. gbrod21.seq - Rodent sequence entries, part 21.
1457. gbrod22.seq - Rodent sequence entries, part 22.
1458. gbrod23.seq - Rodent sequence entries, part 23.
1459. gbrod24.seq - Rodent sequence entries, part 24.
1460. gbrod25.seq - Rodent sequence entries, part 25.
1461. gbrod26.seq - Rodent sequence entries, part 26.
1462. gbrod27.seq - Rodent sequence entries, part 27.
1463. gbrod28.seq - Rodent sequence entries, part 28.
1464. gbrod29.seq - Rodent sequence entries, part 29.
1465. gbrod3.seq - Rodent sequence entries, part 3.
1466. gbrod4.seq - Rodent sequence entries, part 4.
1467. gbrod5.seq - Rodent sequence entries, part 5.
1468. gbrod6.seq - Rodent sequence entries, part 6.
1469. gbrod7.seq - Rodent sequence entries, part 7.
1470. gbrod8.seq - Rodent sequence entries, part 8.
1471. gbrod9.seq - Rodent sequence entries, part 9.
1472. gbsdr1.txt - Short directory of the data bank, part 1.
1473. gbsdr2.txt - Short directory of the data bank, part 2.
1474. gbsdr3.txt - Short directory of the data bank, part 3.
1475. gbsec.idx - Index of the entries according to secondary accession number.
1476. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1477. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1478. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1479. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1480. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1481. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1482. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1483. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1484. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1485. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1486. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1487. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1488. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1489. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1490. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1491. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1492. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1493. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1494. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1495. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1496. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1497. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1498. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1499. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1500. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1501. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1502. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1503. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1504. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1505. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1506. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1507. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1508. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1509. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1510. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1511. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1512. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1513. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1514. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1515. gbuna1.seq - Unannotated sequence entries, part 1.
1516. gbvrl1.seq - Viral sequence entries, part 1.
1517. gbvrl10.seq - Viral sequence entries, part 10.
1518. gbvrl11.seq - Viral sequence entries, part 11.
1519. gbvrl12.seq - Viral sequence entries, part 12.
1520. gbvrl13.seq - Viral sequence entries, part 13.
1521. gbvrl14.seq - Viral sequence entries, part 14.
1522. gbvrl15.seq - Viral sequence entries, part 15.
1523. gbvrl16.seq - Viral sequence entries, part 16.
1524. gbvrl2.seq - Viral sequence entries, part 2.
1525. gbvrl3.seq - Viral sequence entries, part 3.
1526. gbvrl4.seq - Viral sequence entries, part 4.
1527. gbvrl5.seq - Viral sequence entries, part 5.
1528. gbvrl6.seq - Viral sequence entries, part 6.
1529. gbvrl7.seq - Viral sequence entries, part 7.
1530. gbvrl8.seq - Viral sequence entries, part 8.
1531. gbvrl9.seq - Viral sequence entries, part 9.
1532. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1533. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1534. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1535. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1536. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1537. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1538. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1539. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1540. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1541. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1542. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1543. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1544. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1545. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1546. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1547. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1548. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1549. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1550. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1551. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1552. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1553. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 182.0 flatfiles require roughly 479 GB (sequence
files only) or 517 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1556439450     gbacc1.idx
2263544415     gbacc2.idx
 743472318     gbacc3.idx
 184666863     gbaut1.idx
 185057741     gbaut10.idx
 185830401     gbaut11.idx
 183907100     gbaut12.idx
 241103184     gbaut13.idx
 185197457     gbaut14.idx
 185795066     gbaut15.idx
 184883463     gbaut16.idx
 184041609     gbaut17.idx
 186326979     gbaut18.idx
 193625288     gbaut19.idx
 227361695     gbaut2.idx
 184028954     gbaut20.idx
 185073501     gbaut21.idx
 187974502     gbaut22.idx
 186898901     gbaut23.idx
 184453557     gbaut24.idx
 231208367     gbaut25.idx
 186391756     gbaut26.idx
 185214618     gbaut27.idx
 183738484     gbaut28.idx
 185918668     gbaut29.idx
 191251840     gbaut3.idx
 184018841     gbaut30.idx
 245177716     gbaut31.idx
 184406061     gbaut32.idx
 186473759     gbaut33.idx
 188648504     gbaut34.idx
 184025968     gbaut35.idx
 184377448     gbaut36.idx
 226381465     gbaut37.idx
 186544530     gbaut38.idx
 223784281     gbaut39.idx
 184072243     gbaut4.idx
 189479806     gbaut40.idx
 183838476     gbaut41.idx
 184039817     gbaut42.idx
 193008498     gbaut43.idx
 183838113     gbaut44.idx
 184339533     gbaut45.idx
 241619040     gbaut46.idx
 215330238     gbaut47.idx
 183927386     gbaut48.idx
 186347852     gbaut49.idx
 213860931     gbaut5.idx
 183828912     gbaut50.idx
 185271301     gbaut51.idx
 187091132     gbaut52.idx
 184355682     gbaut53.idx
 183676359     gbaut54.idx
 189821806     gbaut55.idx
 186292827     gbaut56.idx
 207529706     gbaut57.idx
 202599544     gbaut58.idx
 183871930     gbaut59.idx
 190213988     gbaut6.idx
 184490741     gbaut60.idx
 185081026     gbaut61.idx
 189981062     gbaut62.idx
 184256992     gbaut63.idx
 253384044     gbaut64.idx
 186427177     gbaut65.idx
 184005750     gbaut66.idx
 184411453     gbaut67.idx
 184644023     gbaut68.idx
 184968179     gbaut69.idx
 188371618     gbaut7.idx
 187347178     gbaut70.idx
 183812301     gbaut71.idx
 184960424     gbaut72.idx
 185931161     gbaut73.idx
 185439860     gbaut74.idx
 203272165     gbaut75.idx
 190383137     gbaut76.idx
 184108701     gbaut77.idx
 184076201     gbaut78.idx
 184308135     gbaut79.idx
 195369262     gbaut8.idx
 184430929     gbaut80.idx
 183884064     gbaut81.idx
 186981804     gbaut82.idx
 183960344     gbaut83.idx
 225435427     gbaut84.idx
 184213244     gbaut85.idx
 183890428     gbaut86.idx
 189051932     gbaut87.idx
 189242710     gbaut88.idx
 245121413     gbaut89.idx
 238905766     gbaut9.idx
 184134597     gbaut90.idx
 190588772     gbaut91.idx
 210853725     gbaut92.idx
 185632299     gbaut93.idx
 194910472     gbaut94.idx
   3399415     gbaut95.idx
 249116849     gbbct1.seq
 249591213     gbbct10.seq
 245138779     gbbct11.seq
 148593999     gbbct12.seq
 242955296     gbbct13.seq
 249814797     gbbct14.seq
 245439232     gbbct15.seq
 248609047     gbbct16.seq
 248217037     gbbct17.seq
 245910054     gbbct18.seq
 237872377     gbbct19.seq
 246421868     gbbct2.seq
 239625282     gbbct20.seq
 217775461     gbbct21.seq
 242724507     gbbct22.seq
 241431048     gbbct23.seq
 248624064     gbbct24.seq
 247824208     gbbct25.seq
 249350022     gbbct26.seq
 244148846     gbbct27.seq
 247096106     gbbct28.seq
 249960605     gbbct29.seq
 236027779     gbbct3.seq
 249719096     gbbct30.seq
 249795352     gbbct31.seq
 242897885     gbbct32.seq
 249121782     gbbct33.seq
 142296675     gbbct34.seq
 243836717     gbbct35.seq
 246067142     gbbct36.seq
 243600539     gbbct37.seq
 249570521     gbbct38.seq
 249103704     gbbct39.seq
 249998093     gbbct4.seq
 246433981     gbbct40.seq
 242190413     gbbct41.seq
 244000592     gbbct42.seq
 248678507     gbbct43.seq
 246123096     gbbct44.seq
 167806217     gbbct45.seq
 243651378     gbbct46.seq
 247300295     gbbct47.seq
 242367167     gbbct48.seq
 239567682     gbbct49.seq
 165758270     gbbct5.seq
 137786052     gbbct50.seq
   6880118     gbbct51.seq
  14080966     gbbct52.seq
  23154399     gbbct53.seq
  45081957     gbbct54.seq
  87716775     gbbct55.seq
 169891053     gbbct56.seq
 249995701     gbbct57.seq
 249798248     gbbct58.seq
 245578148     gbbct59.seq
 241849893     gbbct6.seq
 248404064     gbbct60.seq
 245832707     gbbct61.seq
 247607635     gbbct62.seq
 250000258     gbbct63.seq
 249999342     gbbct64.seq
 238190545     gbbct65.seq
 248846035     gbbct7.seq
 248602443     gbbct8.seq
 241397946     gbbct9.seq
 242357376     gbchg.txt
 249999723     gbcon1.seq
 249992870     gbcon10.seq
 249995445     gbcon100.seq
 249996667     gbcon101.seq
 249998797     gbcon102.seq
 249995641     gbcon103.seq
 156127743     gbcon104.seq
 249995214     gbcon105.seq
 249997693     gbcon106.seq
 249998761     gbcon107.seq
 249997849     gbcon108.seq
  71466271     gbcon109.seq
 249993110     gbcon11.seq
 249997850     gbcon110.seq
 250000112     gbcon111.seq
 235562084     gbcon112.seq
 250000256     gbcon113.seq
 250000098     gbcon114.seq
 249995503     gbcon115.seq
 249681981     gbcon116.seq
 163085195     gbcon117.seq
 249752127     gbcon118.seq
 249999746     gbcon119.seq
 248621114     gbcon12.seq
  95643917     gbcon120.seq
 249997002     gbcon121.seq
 249998975     gbcon122.seq
 249999596     gbcon123.seq
 249445745     gbcon124.seq
  22409822     gbcon125.seq
 249960501     gbcon126.seq
 249962626     gbcon127.seq
 249838400     gbcon128.seq
 249999426     gbcon129.seq
 247307680     gbcon13.seq
 249999644     gbcon130.seq
 184590758     gbcon131.seq
 249999432     gbcon132.seq
 249999914     gbcon133.seq
 249799145     gbcon134.seq
 249993762     gbcon135.seq
 249999846     gbcon136.seq
 248313252     gbcon137.seq
 249999728     gbcon138.seq
 249837837     gbcon139.seq
 249998540     gbcon14.seq
 103454675     gbcon140.seq
 249998022     gbcon141.seq
 249899993     gbcon142.seq
 249990117     gbcon143.seq
 249995965     gbcon144.seq
 249995143     gbcon145.seq
 249999563     gbcon146.seq
  19514928     gbcon147.seq
  21455318     gbcon148.seq
  22737000     gbcon15.seq
 249764369     gbcon16.seq
 249996421     gbcon17.seq
 151530570     gbcon18.seq
 249995534     gbcon19.seq
 248189653     gbcon2.seq
 248348499     gbcon20.seq
 122890034     gbcon21.seq
 249999651     gbcon22.seq
 120025218     gbcon23.seq
 249997576     gbcon24.seq
 249924092     gbcon25.seq
 249999082     gbcon26.seq
 249999373     gbcon27.seq
 201173216     gbcon28.seq
 249998458     gbcon29.seq
 249791108     gbcon3.seq
 250000048     gbcon30.seq
 249998405     gbcon31.seq
 249998852     gbcon32.seq
 249977920     gbcon33.seq
 209346446     gbcon34.seq
 249994638     gbcon35.seq
 249994355     gbcon36.seq
 249996557     gbcon37.seq
 249995872     gbcon38.seq
 249998504     gbcon39.seq
 249979031     gbcon4.seq
 249995403     gbcon40.seq
  60977708     gbcon41.seq
 249996893     gbcon42.seq
 249997617     gbcon43.seq
 249994634     gbcon44.seq
 249997569     gbcon45.seq
 249997343     gbcon46.seq
  42909814     gbcon47.seq
 249995915     gbcon48.seq
 249999280     gbcon49.seq
 249997507     gbcon5.seq
 249995710     gbcon50.seq
 249996631     gbcon51.seq
 249995091     gbcon52.seq
  36225425     gbcon53.seq
 249997103     gbcon54.seq
 249996724     gbcon55.seq
 249997253     gbcon56.seq
 249996527     gbcon57.seq
 249999884     gbcon58.seq
 152476914     gbcon59.seq
 249999187     gbcon6.seq
 249996992     gbcon60.seq
 249997178     gbcon61.seq
 249997201     gbcon62.seq
 249996856     gbcon63.seq
 183504539     gbcon64.seq
 249995931     gbcon65.seq
 249997041     gbcon66.seq
 249998416     gbcon67.seq
 249998317     gbcon68.seq
 245375145     gbcon69.seq
 249995074     gbcon7.seq
 249999551     gbcon70.seq
 249998271     gbcon71.seq
 249998133     gbcon72.seq
 249998704     gbcon73.seq
 249997871     gbcon74.seq
  96481205     gbcon75.seq
 250000212     gbcon76.seq
 249996110     gbcon77.seq
 249999860     gbcon78.seq
 249998416     gbcon79.seq
   1584353     gbcon8.seq
 250000165     gbcon80.seq
  62502628     gbcon81.seq
 249999807     gbcon82.seq
 249998139     gbcon83.seq
 249998956     gbcon84.seq
 249995391     gbcon85.seq
 249998511     gbcon86.seq
  21523692     gbcon87.seq
 249996875     gbcon88.seq
 249995114     gbcon89.seq
 249994769     gbcon9.seq
 249996256     gbcon90.seq
 249999714     gbcon91.seq
 197747900     gbcon92.seq
 249995224     gbcon93.seq
 249999439     gbcon94.seq
 249997468     gbcon95.seq
 249999950     gbcon96.seq
 249995004     gbcon97.seq
 133061783     gbcon98.seq
 249998329     gbcon99.seq
    157283     gbdel.txt
 249999504     gbenv1.seq
 250000212     gbenv10.seq
  53620865     gbenv11.seq
 250000143     gbenv12.seq
 250000007     gbenv13.seq
 249999336     gbenv14.seq
 250000092     gbenv15.seq
 249999618     gbenv16.seq
 249999398     gbenv17.seq
 192920043     gbenv18.seq
 249999300     gbenv19.seq
 249998391     gbenv2.seq
 249998825     gbenv20.seq
 249999426     gbenv21.seq
 249998585     gbenv22.seq
 123686582     gbenv23.seq
 249998737     gbenv24.seq
 249998416     gbenv25.seq
 249999143     gbenv26.seq
 249999146     gbenv27.seq
 249998758     gbenv28.seq
  15212303     gbenv29.seq
 248307289     gbenv3.seq
 249998069     gbenv30.seq
 249996706     gbenv31.seq
 249998288     gbenv32.seq
 250000007     gbenv33.seq
 106364137     gbenv34.seq
 249999841     gbenv35.seq
 249998040     gbenv36.seq
 249999191     gbenv37.seq
 249999306     gbenv38.seq
 249997993     gbenv39.seq
 249999090     gbenv4.seq
 101330475     gbenv40.seq
 249998825     gbenv5.seq
 150047845     gbenv6.seq
 249998594     gbenv7.seq
 250000078     gbenv8.seq
 249997714     gbenv9.seq
 524289749     gbest1.seq
 524291469     gbest10.seq
 524290539     gbest100.seq
 524289509     gbest101.seq
 524289310     gbest102.seq
 524289803     gbest103.seq
 254811243     gbest104.seq
 524288785     gbest105.seq
 524291625     gbest106.seq
 486233627     gbest107.seq
 386816097     gbest108.seq
 386176916     gbest109.seq
 524289536     gbest11.seq
 381480797     gbest110.seq
 382661788     gbest111.seq
 382599718     gbest112.seq
 380020131     gbest113.seq
 390473404     gbest114.seq
 386274343     gbest115.seq
 384106504     gbest116.seq
 382729233     gbest117.seq
 411523412     gbest118.seq
 524290008     gbest119.seq
 524289621     gbest12.seq
 524289198     gbest120.seq
 524289001     gbest121.seq
 524289608     gbest122.seq
 524289571     gbest123.seq
 390642097     gbest124.seq
 524289820     gbest125.seq
 524292015     gbest126.seq
 524289413     gbest127.seq
 524291517     gbest128.seq
 524290552     gbest129.seq
  46225630     gbest13.seq
 524289966     gbest130.seq
 524290389     gbest131.seq
 524290381     gbest132.seq
 524289925     gbest133.seq
 524290575     gbest134.seq
 524288843     gbest135.seq
 524288734     gbest136.seq
 172039887     gbest137.seq
 524289584     gbest138.seq
 524290592     gbest139.seq
 524289447     gbest14.seq
 524290526     gbest140.seq
 524291732     gbest141.seq
 524289473     gbest142.seq
 524289445     gbest143.seq
 524291824     gbest144.seq
 524292199     gbest145.seq
 524291419     gbest146.seq
 524291102     gbest147.seq
 524289907     gbest148.seq
 524290195     gbest149.seq
 524289266     gbest15.seq
 524290166     gbest150.seq
 376059917     gbest151.seq
 524291162     gbest152.seq
 524291221     gbest153.seq
 524288908     gbest154.seq
 524290861     gbest155.seq
 524289670     gbest156.seq
 524292455     gbest157.seq
 524293029     gbest158.seq
 524289170     gbest159.seq
 524290794     gbest16.seq
 467502978     gbest160.seq
 524290258     gbest161.seq
 524290291     gbest162.seq
 524288913     gbest163.seq
 175541805     gbest164.seq
 524290929     gbest165.seq
 524292174     gbest166.seq
 524290512     gbest167.seq
 524292494     gbest168.seq
 524290812     gbest169.seq
 524290731     gbest17.seq
 524291360     gbest170.seq
 524291611     gbest171.seq
 524288755     gbest172.seq
 524288819     gbest173.seq
 524289756     gbest174.seq
 524289464     gbest175.seq
 524289659     gbest176.seq
 522853057     gbest177.seq
 524291273     gbest178.seq
 524291447     gbest179.seq
 524291235     gbest18.seq
 524289350     gbest180.seq
 524290260     gbest181.seq
 524288840     gbest182.seq
 524289627     gbest183.seq
 524290942     gbest184.seq
 524288722     gbest185.seq
 524289899     gbest186.seq
 524289998     gbest187.seq
 524289058     gbest188.seq
 524290904     gbest189.seq
 524290651     gbest19.seq
 355548980     gbest190.seq
 524291146     gbest191.seq
 524289981     gbest192.seq
 524288960     gbest193.seq
 524290798     gbest194.seq
 524292939     gbest195.seq
 524290352     gbest196.seq
 524289584     gbest197.seq
 524291348     gbest198.seq
 524289158     gbest199.seq
 524290845     gbest2.seq
 524289659     gbest20.seq
 524290648     gbest200.seq
 524290971     gbest201.seq
 524290039     gbest202.seq
 519178046     gbest203.seq
 524291462     gbest204.seq
 524289965     gbest205.seq
 524288995     gbest206.seq
 524288786     gbest207.seq
 524291327     gbest208.seq
 524290792     gbest209.seq
 524290923     gbest21.seq
 524289519     gbest210.seq
 524290241     gbest211.seq
 524289955     gbest212.seq
 524289081     gbest213.seq
 326627935     gbest214.seq
 524289318     gbest215.seq
 524292294     gbest216.seq
 524292395     gbest217.seq
 524291016     gbest218.seq
 524289285     gbest219.seq
 474203263     gbest22.seq
 524289810     gbest220.seq
 524288973     gbest221.seq
 524290417     gbest222.seq
 524289788     gbest223.seq
 524292083     gbest224.seq
 524291189     gbest225.seq
 524290780     gbest226.seq
 524289217     gbest227.seq
 273049602     gbest228.seq
 524292680     gbest229.seq
 506170524     gbest23.seq
 524289322     gbest230.seq
 524290653     gbest231.seq
 524292442     gbest232.seq
 524289472     gbest233.seq
 524289397     gbest234.seq
 524291547     gbest235.seq
 524289032     gbest236.seq
 524290221     gbest237.seq
 524288841     gbest238.seq
 524289366     gbest239.seq
 524290282     gbest24.seq
 524290972     gbest240.seq
 524292216     gbest241.seq
 467136358     gbest242.seq
 524292007     gbest243.seq
 524291319     gbest244.seq
 524291845     gbest245.seq
 524290829     gbest246.seq
 524290017     gbest247.seq
 524291811     gbest248.seq
 524291104     gbest249.seq
 201867033     gbest25.seq
 524290670     gbest250.seq
 524289397     gbest251.seq
 524292227     gbest252.seq
 524290880     gbest253.seq
 137603726     gbest254.seq
 524292228     gbest255.seq
 524290604     gbest256.seq
 524290301     gbest257.seq
 524290468     gbest258.seq
 524289485     gbest259.seq
 524290017     gbest26.seq
 524289725     gbest260.seq
 524289638     gbest261.seq
 524289830     gbest262.seq
 524290694     gbest263.seq
 524290116     gbest264.seq
 185483684     gbest265.seq
 524291132     gbest266.seq
 524289860     gbest267.seq
 524289076     gbest268.seq
 524289319     gbest269.seq
 524291234     gbest27.seq
 524289660     gbest270.seq
 524289119     gbest271.seq
 524290390     gbest272.seq
 524290547     gbest273.seq
 524290002     gbest274.seq
 524291815     gbest275.seq
 524288847     gbest276.seq
 145297391     gbest277.seq
 524291572     gbest278.seq
 524289469     gbest279.seq
 524292018     gbest28.seq
 524289950     gbest280.seq
 524289794     gbest281.seq
 524289719     gbest282.seq
 524290752     gbest283.seq
 524289628     gbest284.seq
 524290371     gbest285.seq
 524288842     gbest286.seq
 524288902     gbest287.seq
 524289224     gbest288.seq
 120139715     gbest289.seq
 524292646     gbest29.seq
 524289786     gbest290.seq
 524291136     gbest291.seq
 524289705     gbest292.seq
 524292106     gbest293.seq
 524288736     gbest294.seq
 524290319     gbest295.seq
 524289021     gbest296.seq
 524289174     gbest297.seq
 477649640     gbest298.seq
 481774959     gbest299.seq
 506975902     gbest3.seq
 524289946     gbest30.seq
 481328785     gbest300.seq
 215730946     gbest301.seq
 524288848     gbest302.seq
 524289726     gbest303.seq
 524290636     gbest304.seq
 524290549     gbest305.seq
 524288843     gbest306.seq
 524289920     gbest307.seq
 524289031     gbest308.seq
 524290504     gbest309.seq
 524290617     gbest31.seq
 524289418     gbest310.seq
 524288925     gbest311.seq
 524291142     gbest312.seq
 524289462     gbest313.seq
 392790341     gbest314.seq
 524288859     gbest315.seq
 524290150     gbest316.seq
 524288908     gbest317.seq
 524290800     gbest318.seq
 524288923     gbest319.seq
 524290085     gbest32.seq
 524290929     gbest320.seq
 524288953     gbest321.seq
 524290813     gbest322.seq
 524290390     gbest323.seq
 524291654     gbest324.seq
 524290630     gbest325.seq
 524289997     gbest326.seq
 524291787     gbest327.seq
 158011615     gbest328.seq
 524290242     gbest329.seq
 524291386     gbest33.seq
 524291309     gbest330.seq
 524291386     gbest331.seq
 524290757     gbest332.seq
 524290035     gbest333.seq
 524289753     gbest334.seq
 524289676     gbest335.seq
 524290400     gbest336.seq
 524288807     gbest337.seq
 524291496     gbest338.seq
 524291002     gbest339.seq
 498033625     gbest34.seq
 524290546     gbest340.seq
 524290643     gbest341.seq
 102522342     gbest342.seq
 524289561     gbest343.seq
 524291196     gbest344.seq
 524289455     gbest345.seq
 524291658     gbest346.seq
 524291512     gbest347.seq
 524293273     gbest348.seq
 524295260     gbest349.seq
 490692378     gbest35.seq
 524291172     gbest350.seq
 524292440     gbest351.seq
 524289310     gbest352.seq
 524291855     gbest353.seq
 524290220     gbest354.seq
 524290020     gbest355.seq
 386450464     gbest356.seq
 524289398     gbest357.seq
 524288764     gbest358.seq
 524289520     gbest359.seq
 493267104     gbest36.seq
 524291063     gbest360.seq
 524291617     gbest361.seq
 524290478     gbest362.seq
 524288823     gbest363.seq
 524290876     gbest364.seq
 524289134     gbest365.seq
 524293006     gbest366.seq
 438138306     gbest367.seq
 524290110     gbest368.seq
 524289091     gbest369.seq
 491104638     gbest37.seq
 469747776     gbest370.seq
 524289194     gbest371.seq
 524291948     gbest372.seq
 524291197     gbest373.seq
 524291024     gbest374.seq
 524289328     gbest375.seq
 524290290     gbest376.seq
 524289904     gbest377.seq
 449297523     gbest378.seq
 524289380     gbest379.seq
 485983064     gbest38.seq
 524290166     gbest380.seq
 524291556     gbest381.seq
 524290181     gbest382.seq
 524290783     gbest383.seq
 524291083     gbest384.seq
 524288997     gbest385.seq
 524292181     gbest386.seq
 524289861     gbest387.seq
 524290656     gbest388.seq
 524288860     gbest389.seq
 495733904     gbest39.seq
 524291145     gbest390.seq
 430157930     gbest391.seq
 524291466     gbest392.seq
 524288873     gbest393.seq
 524288976     gbest394.seq
 524290365     gbest395.seq
 524291399     gbest396.seq
 524292247     gbest397.seq
 524290960     gbest398.seq
 524290399     gbest399.seq
 524290067     gbest4.seq
  38125955     gbest40.seq
 524290085     gbest400.seq
 524290401     gbest401.seq
 524291843     gbest402.seq
 524289780     gbest403.seq
 434915712     gbest404.seq
 524290474     gbest405.seq
 524291249     gbest406.seq
 524288981     gbest407.seq
 524290863     gbest408.seq
 524290173     gbest409.seq
 524291458     gbest41.seq
 524293165     gbest410.seq
 524295148     gbest411.seq
 524290279     gbest412.seq
 524295930     gbest413.seq
 524292126     gbest414.seq
 524290817     gbest415.seq
 524289324     gbest416.seq
 524290379     gbest417.seq
 353029973     gbest418.seq
 524293629     gbest419.seq
 524290305     gbest42.seq
 524288861     gbest420.seq
 524290709     gbest421.seq
 524291253     gbest422.seq
 524288823     gbest423.seq
 524291486     gbest424.seq
 524292388     gbest425.seq
 524291316     gbest426.seq
 524289451     gbest427.seq
 524290024     gbest428.seq
 524290478     gbest429.seq
 524288771     gbest43.seq
 524291630     gbest430.seq
  63598816     gbest431.seq
 524291478     gbest432.seq
  46278683     gbest433.seq
 524289194     gbest44.seq
 524289255     gbest45.seq
 524290345     gbest46.seq
 524290334     gbest47.seq
 524289970     gbest48.seq
 524290030     gbest49.seq
 524290922     gbest5.seq
 524290686     gbest50.seq
 524291304     gbest51.seq
 524288991     gbest52.seq
 524288747     gbest53.seq
 172188815     gbest54.seq
 524290958     gbest55.seq
 524290586     gbest56.seq
 524289195     gbest57.seq
 524290283     gbest58.seq
 524290664     gbest59.seq
 524290262     gbest6.seq
 524290024     gbest60.seq
 524290036     gbest61.seq
 524291114     gbest62.seq
 524289516     gbest63.seq
 524289479     gbest64.seq
 524289230     gbest65.seq
 524289680     gbest66.seq
 365549840     gbest67.seq
 524288980     gbest68.seq
 524289377     gbest69.seq
 524290194     gbest7.seq
 524290470     gbest70.seq
 524289441     gbest71.seq
 524291107     gbest72.seq
 524288959     gbest73.seq
 524290542     gbest74.seq
 524289052     gbest75.seq
 524290537     gbest76.seq
 524288960     gbest77.seq
 524289907     gbest78.seq
 524292051     gbest79.seq
 524288833     gbest8.seq
 103431373     gbest80.seq
 524289166     gbest81.seq
 524289981     gbest82.seq
 524290561     gbest83.seq
 524290097     gbest84.seq
 524289129     gbest85.seq
 524291624     gbest86.seq
 524290033     gbest87.seq
 524290048     gbest88.seq
 524291806     gbest89.seq
 524289601     gbest9.seq
 524289538     gbest90.seq
 524290985     gbest91.seq
 347655426     gbest92.seq
 524288995     gbest93.seq
 524289575     gbest94.seq
 524288941     gbest95.seq
 524291516     gbest96.seq
 524289963     gbest97.seq
 524290397     gbest98.seq
 524289070     gbest99.seq
 156645864     gbgen.idx
 524289741     gbgss1.seq
 524289918     gbgss10.seq
 305402863     gbgss100.seq
 524289763     gbgss101.seq
 524289105     gbgss102.seq
 524289783     gbgss103.seq
 524290354     gbgss104.seq
 524289487     gbgss105.seq
 524290166     gbgss106.seq
 524289935     gbgss107.seq
 524291173     gbgss108.seq
 524288868     gbgss109.seq
 524291870     gbgss11.seq
 524291270     gbgss110.seq
 474454140     gbgss111.seq
 524289665     gbgss112.seq
 524289067     gbgss113.seq
 524289464     gbgss114.seq
 524288933     gbgss115.seq
 524290285     gbgss116.seq
 524289502     gbgss117.seq
 524289976     gbgss118.seq
 524290927     gbgss119.seq
 524290331     gbgss12.seq
 524290198     gbgss120.seq
 524291725     gbgss121.seq
 524290237     gbgss122.seq
 524290604     gbgss123.seq
 112192948     gbgss124.seq
 524288935     gbgss125.seq
 524290464     gbgss126.seq
 524290482     gbgss127.seq
 524290769     gbgss128.seq
 524290308     gbgss129.seq
 524290202     gbgss13.seq
 524289229     gbgss130.seq
 524289228     gbgss131.seq
  40651663     gbgss132.seq
 249998232     gbgss133.seq
 249999841     gbgss134.seq
 250000073     gbgss135.seq
 250000238     gbgss136.seq
  28276001     gbgss137.seq
 249997137     gbgss138.seq
 250000033     gbgss139.seq
 524290255     gbgss14.seq
 249998542     gbgss140.seq
 249998333     gbgss141.seq
 224919493     gbgss142.seq
 249998415     gbgss143.seq
 249998761     gbgss144.seq
 249998880     gbgss145.seq
 250000157     gbgss146.seq
 188952519     gbgss147.seq
 249999433     gbgss148.seq
 249998390     gbgss149.seq
 524290973     gbgss15.seq
 249999267     gbgss150.seq
 249998392     gbgss151.seq
 249998759     gbgss152.seq
  76677884     gbgss153.seq
 249997579     gbgss154.seq
   2077145     gbgss155.seq
  79542372     gbgss156.seq
 249999609     gbgss157.seq
 249999331     gbgss158.seq
  88106989     gbgss159.seq
 524289904     gbgss16.seq
 249999685     gbgss160.seq
 249998355     gbgss161.seq
 249998984     gbgss162.seq
 203023933     gbgss163.seq
 249999232     gbgss164.seq
 249998256     gbgss165.seq
 250000262     gbgss166.seq
 246145215     gbgss167.seq
 249999268     gbgss168.seq
 249997406     gbgss169.seq
 524289821     gbgss17.seq
 249999793     gbgss170.seq
 243553715     gbgss171.seq
 249999336     gbgss172.seq
 250000088     gbgss173.seq
 249998347     gbgss174.seq
 249999296     gbgss175.seq
 121655059     gbgss176.seq
 249998013     gbgss177.seq
 250000031     gbgss178.seq
 249999974     gbgss179.seq
 524288720     gbgss18.seq
 249998152     gbgss180.seq
  94058788     gbgss181.seq
 249998892     gbgss182.seq
 249999850     gbgss183.seq
 249998239     gbgss184.seq
 249999582     gbgss185.seq
 171078309     gbgss186.seq
 249999236     gbgss187.seq
 249997993     gbgss188.seq
 249998006     gbgss189.seq
 207635290     gbgss19.seq
 249999353     gbgss190.seq
  95926739     gbgss191.seq
 249999461     gbgss192.seq
 249999350     gbgss193.seq
 249998406     gbgss194.seq
 249998619     gbgss195.seq
 249999398     gbgss196.seq
 249999995     gbgss197.seq
  17245248     gbgss198.seq
 249999424     gbgss199.seq
 524288790     gbgss2.seq
 524290739     gbgss20.seq
 249999963     gbgss200.seq
 249997369     gbgss201.seq
  43648880     gbgss202.seq
  52862187     gbgss203.seq
 250000236     gbgss204.seq
 249997928     gbgss205.seq
 250000245     gbgss206.seq
 249999824     gbgss207.seq
 249998258     gbgss208.seq
 249998887     gbgss209.seq
 524289546     gbgss21.seq
  60367551     gbgss210.seq
 249997633     gbgss211.seq
 249998526     gbgss212.seq
 249998545     gbgss213.seq
 250000107     gbgss214.seq
 249999308     gbgss215.seq
 249999371     gbgss216.seq
  40462803     gbgss217.seq
 249999812     gbgss218.seq
 249997079     gbgss219.seq
 524289506     gbgss22.seq
 249998029     gbgss220.seq
 248228351     gbgss221.seq
 249999561     gbgss222.seq
 249998751     gbgss223.seq
 249999599     gbgss224.seq
 249999028     gbgss225.seq
 249999713     gbgss226.seq
  16550600     gbgss227.seq
 524289664     gbgss23.seq
 524290301     gbgss24.seq
 524291759     gbgss25.seq
 524290403     gbgss26.seq
 524292009     gbgss27.seq
 524289137     gbgss28.seq
 524290737     gbgss29.seq
 524291429     gbgss3.seq
 466140389     gbgss30.seq
 524290644     gbgss31.seq
 524290000     gbgss32.seq
 524289128     gbgss33.seq
 524288742     gbgss34.seq
 524291191     gbgss35.seq
 524290101     gbgss36.seq
 524289453     gbgss37.seq
 477084638     gbgss38.seq
 524288965     gbgss39.seq
 524290659     gbgss4.seq
 524289163     gbgss40.seq
 476801969     gbgss41.seq
 524290080     gbgss42.seq
 524288837     gbgss43.seq
 524290462     gbgss44.seq
 524290447     gbgss45.seq
 169969153     gbgss46.seq
 524290347     gbgss47.seq
 524289342     gbgss48.seq
 524291265     gbgss49.seq
 130223630     gbgss5.seq
 524291334     gbgss50.seq
 524289086     gbgss51.seq
 524289952     gbgss52.seq
 524290985     gbgss53.seq
 524290958     gbgss54.seq
 524290124     gbgss55.seq
 524290902     gbgss56.seq
 432582210     gbgss57.seq
 524288728     gbgss58.seq
 524291249     gbgss59.seq
 524288973     gbgss6.seq
 524291352     gbgss60.seq
 424789040     gbgss61.seq
 524290833     gbgss62.seq
 524290918     gbgss63.seq
 524289510     gbgss64.seq
 524289470     gbgss65.seq
 524291362     gbgss66.seq
 524291159     gbgss67.seq
 524290733     gbgss68.seq
 524291038     gbgss69.seq
 524291366     gbgss7.seq
 524289964     gbgss70.seq
 524288984     gbgss71.seq
 524290918     gbgss72.seq
 449867679     gbgss73.seq
 524290077     gbgss74.seq
 524289470     gbgss75.seq
 524290803     gbgss76.seq
 524289205     gbgss77.seq
 524290151     gbgss78.seq
 524289776     gbgss79.seq
 524289914     gbgss8.seq
 524289694     gbgss80.seq
 524291883     gbgss81.seq
 524291254     gbgss82.seq
 524291793     gbgss83.seq
 524291793     gbgss84.seq
 275559034     gbgss85.seq
 524290218     gbgss86.seq
 524289173     gbgss87.seq
 524291999     gbgss88.seq
 524291781     gbgss89.seq
 524290790     gbgss9.seq
 524289364     gbgss90.seq
 524291169     gbgss91.seq
 524289097     gbgss92.seq
 524289396     gbgss93.seq
 524289998     gbgss94.seq
 524291113     gbgss95.seq
 524288887     gbgss96.seq
 524290304     gbgss97.seq
 524290369     gbgss98.seq
 524289300     gbgss99.seq
 249988446     gbhtc1.seq
 250000195     gbhtc10.seq
 249997913     gbhtc11.seq
  79789050     gbhtc12.seq
 249998718     gbhtc13.seq
 249997964     gbhtc14.seq
  57677630     gbhtc15.seq
 249990019     gbhtc2.seq
 249994097     gbhtc3.seq
 249989139     gbhtc4.seq
 249997691     gbhtc5.seq
 249996247     gbhtc6.seq
 249996862     gbhtc7.seq
  83854894     gbhtc8.seq
 249998542     gbhtc9.seq
 249904812     gbhtg1.seq
 249863408     gbhtg10.seq
 249917503     gbhtg100.seq
 249830439     gbhtg101.seq
 249884880     gbhtg102.seq
 249914920     gbhtg103.seq
   5504377     gbhtg104.seq
 249499238     gbhtg105.seq
 249899099     gbhtg106.seq
 249802366     gbhtg107.seq
 249927313     gbhtg108.seq
 249961038     gbhtg109.seq
   1107147     gbhtg11.seq
 249919195     gbhtg110.seq
 249784857     gbhtg111.seq
 249900985     gbhtg112.seq
 249834672     gbhtg113.seq
  65230355     gbhtg114.seq
 249970085     gbhtg115.seq
 249897536     gbhtg116.seq
 249932767     gbhtg117.seq
 249931552     gbhtg118.seq
 249976607     gbhtg119.seq
 249658387     gbhtg12.seq
  59297358     gbhtg120.seq
 249907068     gbhtg121.seq
 249997872     gbhtg122.seq
 249770919     gbhtg123.seq
 249830702     gbhtg124.seq
 249931708     gbhtg125.seq
 155414982     gbhtg126.seq
 249908662     gbhtg127.seq
 249813867     gbhtg128.seq
 249888286     gbhtg129.seq
 249699749     gbhtg13.seq
 249856313     gbhtg130.seq
 249913340     gbhtg131.seq
 249797073     gbhtg132.seq
 249878457     gbhtg133.seq
 249959770     gbhtg134.seq
 249987298     gbhtg135.seq
  31226731     gbhtg136.seq
 249812920     gbhtg14.seq
 249967540     gbhtg15.seq
 249809968     gbhtg16.seq
 249872360     gbhtg17.seq
 249758294     gbhtg18.seq
 249928943     gbhtg19.seq
 249994630     gbhtg2.seq
 249913596     gbhtg20.seq
 242544182     gbhtg21.seq
 249760645     gbhtg22.seq
 249868408     gbhtg23.seq
 249994184     gbhtg24.seq
 249921752     gbhtg25.seq
 249761207     gbhtg26.seq
 249891619     gbhtg27.seq
 249961145     gbhtg28.seq
 249848492     gbhtg29.seq
 249950135     gbhtg3.seq
 249992987     gbhtg30.seq
 225341986     gbhtg31.seq
 249827828     gbhtg32.seq
 249732911     gbhtg33.seq
 249932308     gbhtg34.seq
 249888115     gbhtg35.seq
 249776978     gbhtg36.seq
 249860337     gbhtg37.seq
 249647940     gbhtg38.seq
 249809629     gbhtg39.seq
 249984089     gbhtg4.seq
 249941134     gbhtg40.seq
 226910359     gbhtg41.seq
 249998331     gbhtg42.seq
 249936527     gbhtg43.seq
 249894895     gbhtg44.seq
 249909173     gbhtg45.seq
 250000253     gbhtg46.seq
 249478757     gbhtg47.seq
 249731618     gbhtg48.seq
 249737497     gbhtg49.seq
 249882044     gbhtg5.seq
 249959815     gbhtg50.seq
 237748579     gbhtg51.seq
 249784840     gbhtg52.seq
 249852612     gbhtg53.seq
 249905747     gbhtg54.seq
 249884954     gbhtg55.seq
 249732248     gbhtg56.seq
  20448445     gbhtg57.seq
 249846592     gbhtg58.seq
 250000116     gbhtg59.seq
 249898460     gbhtg6.seq
 249917026     gbhtg60.seq
 249939524     gbhtg61.seq
 227541388     gbhtg62.seq
 249902652     gbhtg63.seq
 249986757     gbhtg64.seq
 249918193     gbhtg65.seq
 249883760     gbhtg66.seq
 249966605     gbhtg67.seq
  16805116     gbhtg68.seq
 249960711     gbhtg69.seq
 249933725     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249936542     gbhtg72.seq
 227270574     gbhtg73.seq
 249814083     gbhtg74.seq
 249953172     gbhtg75.seq
 249976471     gbhtg76.seq
 249876760     gbhtg77.seq
 245743847     gbhtg78.seq
 249883367     gbhtg79.seq
 249933567     gbhtg8.seq
 249988504     gbhtg80.seq
 249985054     gbhtg81.seq
 249923601     gbhtg82.seq
 216520297     gbhtg83.seq
 249912287     gbhtg84.seq
 249753930     gbhtg85.seq
 249999728     gbhtg86.seq
 249969843     gbhtg87.seq
 221623820     gbhtg88.seq
 249843050     gbhtg89.seq
 249923766     gbhtg9.seq
 249970890     gbhtg90.seq
 249816092     gbhtg91.seq
 249823019     gbhtg92.seq
 212441434     gbhtg93.seq
 249819427     gbhtg94.seq
 249934715     gbhtg95.seq
 249954863     gbhtg96.seq
 249842265     gbhtg97.seq
 169279701     gbhtg98.seq
 249746678     gbhtg99.seq
 249997742     gbinv1.seq
 249998437     gbinv10.seq
 156836437     gbinv11.seq
 249998686     gbinv12.seq
 249998430     gbinv13.seq
 249999370     gbinv14.seq
 136124764     gbinv15.seq
 247561587     gbinv16.seq
 249925806     gbinv17.seq
 249999756     gbinv18.seq
 249045326     gbinv19.seq
 249865949     gbinv2.seq
 249998772     gbinv20.seq
 249995974     gbinv21.seq
 239454227     gbinv22.seq
 250000249     gbinv23.seq
 249998887     gbinv24.seq
 249983951     gbinv25.seq
 242221875     gbinv26.seq
 214083265     gbinv3.seq
 249997989     gbinv4.seq
 249998282     gbinv5.seq
 249997831     gbinv6.seq
 212250579     gbinv7.seq
 249998394     gbinv8.seq
 249998698     gbinv9.seq
 139490945     gbjou1.idx
 187770430     gbjou10.idx
 180222679     gbjou2.idx
 142011534     gbjou3.idx
 260936183     gbjou4.idx
 278736810     gbjou5.idx
 275131274     gbjou6.idx
 301529037     gbjou7.idx
 298017525     gbjou8.idx
 276127381     gbjou9.idx
 289145779     gbkey1.idx
 178802528     gbkey2.idx
 197478372     gbkey3.idx
 220658816     gbkey4.idx
  25895641     gbkey5.idx
 249801897     gbmam1.seq
 249998516     gbmam2.seq
 249820675     gbmam3.seq
 249997752     gbmam4.seq
 250000023     gbmam5.seq
 249996231     gbmam6.seq
   2022519     gbmam7.seq
  37204978     gbnew.txt
 249999691     gbpat1.seq
 249999905     gbpat10.seq
 249999878     gbpat100.seq
 249849703     gbpat101.seq
  66835452     gbpat102.seq
 249999441     gbpat103.seq
 249999845     gbpat104.seq
 249999888     gbpat105.seq
 249999095     gbpat106.seq
 160256390     gbpat107.seq
 249999974     gbpat108.seq
 249999633     gbpat109.seq
 179257126     gbpat11.seq
 249999435     gbpat110.seq
 249998830     gbpat111.seq
 249999029     gbpat112.seq
 249999236     gbpat113.seq
 249943136     gbpat114.seq
 250000124     gbpat115.seq
 249999983     gbpat116.seq
 250000114     gbpat117.seq
  86031991     gbpat118.seq
 249999922     gbpat119.seq
 250000000     gbpat12.seq
 249999187     gbpat120.seq
 249999389     gbpat121.seq
  63529069     gbpat122.seq
 249994671     gbpat123.seq
 249996731     gbpat124.seq
 250000102     gbpat125.seq
 249999321     gbpat126.seq
 250000166     gbpat127.seq
 249998092     gbpat128.seq
 222014044     gbpat129.seq
 249981225     gbpat13.seq
 250000249     gbpat130.seq
 249999893     gbpat131.seq
 249999893     gbpat132.seq
 220539897     gbpat133.seq
 249999753     gbpat134.seq
 249997465     gbpat135.seq
 249999639     gbpat136.seq
 249999111     gbpat137.seq
 249998926     gbpat138.seq
 250000052     gbpat139.seq
 249999737     gbpat14.seq
 196630508     gbpat140.seq
 249995220     gbpat15.seq
 249998865     gbpat16.seq
  65866387     gbpat17.seq
 250000027     gbpat18.seq
 249999801     gbpat19.seq
 249998547     gbpat2.seq
 249999076     gbpat20.seq
 249996841     gbpat21.seq
 185764925     gbpat22.seq
 249999987     gbpat23.seq
 249998065     gbpat24.seq
 249999246     gbpat25.seq
 250000047     gbpat26.seq
  70926601     gbpat27.seq
 249983374     gbpat28.seq
 249999590     gbpat29.seq
 249999343     gbpat3.seq
 250000102     gbpat30.seq
 249999654     gbpat31.seq
 249999891     gbpat32.seq
 180160871     gbpat33.seq
 249997945     gbpat34.seq
 249999933     gbpat35.seq
 249998884     gbpat36.seq
 249999786     gbpat37.seq
 130526002     gbpat38.seq
 249995217     gbpat39.seq
 249998802     gbpat4.seq
 249980197     gbpat40.seq
 249999229     gbpat41.seq
 249998815     gbpat42.seq
 250000126     gbpat43.seq
 249812989     gbpat44.seq
 249999190     gbpat45.seq
 249999579     gbpat46.seq
 171259279     gbpat47.seq
 249999672     gbpat48.seq
 249998527     gbpat49.seq
  71788701     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 249999876     gbpat55.seq
 164687260     gbpat56.seq
 249878083     gbpat57.seq
 249997927     gbpat58.seq
 249998816     gbpat59.seq
 249999527     gbpat6.seq
 249999394     gbpat60.seq
 134897275     gbpat61.seq
 249998194     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999455     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249999919     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244402894     gbpat72.seq
 248968678     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999857     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249997141     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249999943     gbpat82.seq
 249999277     gbpat83.seq
 249893818     gbpat84.seq
 249864995     gbpat85.seq
 153766003     gbpat86.seq
 249999879     gbpat87.seq
 249999564     gbpat88.seq
 249929730     gbpat89.seq
 249996803     gbpat9.seq
 249824878     gbpat90.seq
 249998855     gbpat91.seq
 192933071     gbpat92.seq
 249999717     gbpat93.seq
 249999626     gbpat94.seq
 249998458     gbpat95.seq
  80116358     gbpat96.seq
 249999129     gbpat97.seq
 250000123     gbpat98.seq
 249970165     gbpat99.seq
 124461800     gbphg1.seq
 249997712     gbpln1.seq
 249999426     gbpln10.seq
 249891211     gbpln11.seq
 249809506     gbpln12.seq
  98370871     gbpln13.seq
 249995267     gbpln14.seq
 249982800     gbpln15.seq
 249994089     gbpln16.seq
 249378749     gbpln17.seq
 249941381     gbpln18.seq
 249598316     gbpln19.seq
 249803042     gbpln2.seq
 249997395     gbpln20.seq
  30471630     gbpln21.seq
 249997220     gbpln22.seq
  95121686     gbpln23.seq
 249998242     gbpln24.seq
 249999839     gbpln25.seq
 249843981     gbpln26.seq
 249998201     gbpln27.seq
 249555685     gbpln28.seq
 249997283     gbpln29.seq
 249927407     gbpln3.seq
 249998868     gbpln30.seq
 175764844     gbpln31.seq
 249998251     gbpln32.seq
 249999930     gbpln33.seq
 249997964     gbpln34.seq
 249998689     gbpln35.seq
 109972337     gbpln36.seq
 249999220     gbpln37.seq
 249998533     gbpln38.seq
 249996082     gbpln39.seq
 249919231     gbpln4.seq
 249998207     gbpln40.seq
 249999956     gbpln41.seq
 249999920     gbpln42.seq
 249998093     gbpln43.seq
 188913534     gbpln44.seq
 249928683     gbpln5.seq
 249999193     gbpln6.seq
 249997501     gbpln7.seq
  73650188     gbpln8.seq
 249998249     gbpln9.seq
 148960519     gbpri1.seq
 249958149     gbpri10.seq
 125816106     gbpri11.seq
 249966847     gbpri12.seq
 249900330     gbpri13.seq
 249899933     gbpri14.seq
 249949219     gbpri15.seq
 249911015     gbpri16.seq
 249858970     gbpri17.seq
 249821596     gbpri18.seq
 249995784     gbpri19.seq
 249873744     gbpri2.seq
 249860666     gbpri20.seq
 249996555     gbpri21.seq
 167422036     gbpri22.seq
 180128965     gbpri23.seq
 249991678     gbpri24.seq
 205132324     gbpri25.seq
 249922721     gbpri26.seq
 249875986     gbpri27.seq
 249932093     gbpri28.seq
 249916215     gbpri29.seq
 249974814     gbpri3.seq
 249936540     gbpri30.seq
 249843597     gbpri31.seq
 249828387     gbpri32.seq
 249998935     gbpri33.seq
  87386446     gbpri34.seq
 249992029     gbpri35.seq
 249998149     gbpri36.seq
 249862801     gbpri37.seq
 249998294     gbpri38.seq
 249998704     gbpri39.seq
 249922011     gbpri4.seq
 162863635     gbpri40.seq
 249974552     gbpri41.seq
 132642574     gbpri42.seq
 249754386     gbpri5.seq
 249853260     gbpri6.seq
 249844108     gbpri7.seq
 249860358     gbpri8.seq
 249964454     gbpri9.seq
    289846     gbrel.txt
 249771444     gbrod1.seq
 249789785     gbrod10.seq
  56114869     gbrod11.seq
 249879313     gbrod12.seq
 249787795     gbrod13.seq
 249998696     gbrod14.seq
 249654174     gbrod15.seq
 249957033     gbrod16.seq
 249890968     gbrod17.seq
 249980772     gbrod18.seq
 194029816     gbrod19.seq
 249771529     gbrod2.seq
 249850743     gbrod20.seq
 249766312     gbrod21.seq
 227793600     gbrod22.seq
 249998002     gbrod23.seq
 249995207     gbrod24.seq
 249817306     gbrod25.seq
 249962995     gbrod26.seq
 249999773     gbrod27.seq
 249999249     gbrod28.seq
 112339966     gbrod29.seq
 249872771     gbrod3.seq
 249819570     gbrod4.seq
 249888657     gbrod5.seq
 249923821     gbrod6.seq
 249981021     gbrod7.seq
 249720282     gbrod8.seq
 249726725     gbrod9.seq
3176962686     gbsdr1.txt
5497446847     gbsdr2.txt
2407668245     gbsdr3.txt
 148607680     gbsec.idx
 249996758     gbsts1.seq
 249997362     gbsts10.seq
 212226966     gbsts11.seq
 249996524     gbsts12.seq
 249998986     gbsts13.seq
 249998938     gbsts14.seq
 250000159     gbsts15.seq
  27394715     gbsts16.seq
 249999617     gbsts17.seq
 249999376     gbsts18.seq
 249998351     gbsts19.seq
 249999616     gbsts2.seq
 150361386     gbsts20.seq
 249998933     gbsts3.seq
 249996611     gbsts4.seq
  39428238     gbsts5.seq
 249997222     gbsts6.seq
 249997899     gbsts7.seq
 249998458     gbsts8.seq
 249997742     gbsts9.seq
 249996215     gbsyn1.seq
 249999529     gbsyn2.seq
  22374650     gbsyn3.seq
 249999370     gbtsa1.seq
  43503975     gbtsa10.seq
 249997835     gbtsa11.seq
 249999221     gbtsa12.seq
 249999375     gbtsa13.seq
 249999561     gbtsa14.seq
 249999097     gbtsa15.seq
  45492681     gbtsa16.seq
 249999206     gbtsa2.seq
 250000161     gbtsa3.seq
 249999275     gbtsa4.seq
  82919120     gbtsa5.seq
 249998556     gbtsa6.seq
 249999789     gbtsa7.seq
 249998431     gbtsa8.seq
 249998726     gbtsa9.seq
    462759     gbuna1.seq
 249999688     gbvrl1.seq
 238514453     gbvrl10.seq
 249988553     gbvrl11.seq
 249999880     gbvrl12.seq
 249997791     gbvrl13.seq
 249999469     gbvrl14.seq
 249991871     gbvrl15.seq
 155799918     gbvrl16.seq
 249996830     gbvrl2.seq
 249996223     gbvrl3.seq
 249999140     gbvrl4.seq
 160487344     gbvrl5.seq
 249997949     gbvrl6.seq
 249999168     gbvrl7.seq
 249999590     gbvrl8.seq
 249998396     gbvrl9.seq
 249840125     gbvrt1.seq
 249854869     gbvrt10.seq
 249949571     gbvrt11.seq
 185273118     gbvrt12.seq
 249999321     gbvrt13.seq
 249942265     gbvrt14.seq
 249986441     gbvrt15.seq
 249998851     gbvrt16.seq
 249999795     gbvrt17.seq
 249877382     gbvrt18.seq
 249999366     gbvrt19.seq
 249998616     gbvrt2.seq
 249777344     gbvrt20.seq
 249998906     gbvrt21.seq
 236510236     gbvrt22.seq
 249800408     gbvrt3.seq
 249999407     gbvrt4.seq
  69131368     gbvrt5.seq
 249994377     gbvrt6.seq
 249996043     gbvrt7.seq
 249899147     gbvrt8.seq
 249974514     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         54834      91602553
BCT10        61         117892388
BCT11        120        115665846
BCT12        16112      60432674
BCT13        53940      85334500
BCT14        93         110189094
BCT15        151        93915681
BCT16        61         112455059
BCT17        52         112042350
BCT18        46         112693953
BCT19        56         110572060
BCT2         80         109792269
BCT20        66         108817610
BCT21        36         96325907
BCT22        40         106881287
BCT23        58         105533856
BCT24        74         111675186
BCT25        55         110045255
BCT26        63         106845575
BCT27        55         109391288
BCT28        52         108559385
BCT29        46         110496749
BCT3         51         106988267
BCT30        95         109522868
BCT31        59         110930031
BCT32        67         108616570
BCT33        124        109249408
BCT34        34         61811577
BCT35        202        109105476
BCT36        51         109861512
BCT37        41         106434793
BCT38        55         107714064
BCT39        58         109086312
BCT4         1697       109827505
BCT40        51         109156739
BCT41        68         104105901
BCT42        52         108433973
BCT43        55         107069743
BCT44        79         108442252
BCT45        59         74586910
BCT46        70         105467816
BCT47        53         103930668
BCT48        69         101912494
BCT49        220        95539834
BCT5         36759      60775644
BCT50        385        52078320
BCT51        1589       2511823
BCT52        3176       5212972
BCT53        6347       7901828
BCT54        12648      15076611
BCT55        25628      27747115
BCT56        50520      53965661
BCT57        76540      77541041
BCT58        71917      77155410
BCT59        7988       95009357
BCT6         39033      82650253
BCT60        5192       104183730
BCT61        2776       108530633
BCT62        156        121160867
BCT63        49174      88587955
BCT64        90053      70433938
BCT65        46682      86774191
BCT7         5533       96145968
BCT8         13866      89664937
BCT9         6715       95959666
ENV1         94641      71913278
ENV10        83020      87043331
ENV11        19399      16944800
ENV12        84947      80989468
ENV13        120754     43410098
ENV14        88799      78327325
ENV15        96676      68398338
ENV16        96882      62948237
ENV17        84865      72732853
ENV18        49769      67200251
ENV19        69561      85581068
ENV2         87474      70435287
ENV20        95173      71947841
ENV21        128332     31234992
ENV22        123371     29555993
ENV23        61520      13726389
ENV24        123308     50056555
ENV25        99039      67054183
ENV26        120719     57265744
ENV27        151844     53174675
ENV28        94320      67662754
ENV29        4319       5890339
ENV3         88441      77203505
ENV30        71058      96548027
ENV31        94896      69784306
ENV32        109320     42376101
ENV33        85512      72249111
ENV34        49194      25457190
ENV35        112447     47593555
ENV36        103527     64535142
ENV37        70461      95755115
ENV38        70428      95628575
ENV39        70403      95656825
ENV4         81465      83898595
ENV40        29643      37810514
ENV5         92039      81699530
ENV6         65165      34507820
ENV7         131791     31268854
ENV8         86981      71070549
ENV9         93961      73239897
EST1         161379     62545728
EST10        172478     72305713
EST100       230629     144068607
EST101       224869     112855880
EST102       206950     104473244
EST103       164537     101271494
EST104       75084      62809200
EST105       167707     112283181
EST106       170570     112258262
EST107       114243     65475921
EST108       64121      23569706
EST109       64297      22797506
EST11        168202     72480786
EST110       64602      23650022
EST111       64524      27215843
EST112       64664      22246956
EST113       65920      26004549
EST114       63991      27873125
EST115       64553      26537268
EST116       64760      26876108
EST117       64534      25312928
EST118       61251      39241325
EST119       173441     82949917
EST12        186524     84558184
EST120       177539     85699156
EST121       155235     94507847
EST122       150297     94825434
EST123       156434     95343258
EST124       107317     63449123
EST125       206582     101061568
EST126       154242     80034718
EST127       161182     85634980
EST128       156956     90142199
EST129       154707     81207400
EST13        22588      8710214
EST130       178273     107397809
EST131       212201     116807239
EST132       173089     98374191
EST133       167533     82033368
EST134       153931     82628659
EST135       151095     92201070
EST136       159742     92192420
EST137       50341      28234603
EST138       192161     109747650
EST139       234870     103919618
EST14        222173     112104766
EST140       154869     90685480
EST141       171335     93770162
EST142       147702     87136079
EST143       138015     87798779
EST144       157720     93977410
EST145       149005     77052583
EST146       124685     65453283
EST147       124104     64464366
EST148       129966     55254280
EST149       129059     51012222
EST15        169565     107637314
EST150       130471     51983049
EST151       96032      36183619
EST152       174807     87630439
EST153       183432     83619427
EST154       158348     111343813
EST155       217287     130532982
EST156       218267     122875158
EST157       170926     91420930
EST158       145541     113672056
EST159       143973     91586944
EST16        186468     112765717
EST160       148179     86337888
EST161       149802     80317826
EST162       146214     86490428
EST163       165056     89428279
EST164       58137      36225482
EST165       157307     97521769
EST166       189648     106553308
EST167       148775     81529039
EST168       132160     70024437
EST169       178000     98698062
EST17        195017     119761221
EST170       175967     102885375
EST171       153186     94101460
EST172       173783     88441359
EST173       128144     82635751
EST174       192077     112271647
EST175       163315     93994993
EST176       105579     59668313
EST177       182002     108036562
EST178       171736     102980166
EST179       184166     131447221
EST18        194294     118712022
EST180       154546     110037445
EST181       191570     95427551
EST182       153739     117521252
EST183       149430     88948269
EST184       148087     80661666
EST185       174332     77650592
EST186       151639     83503974
EST187       161019     101940816
EST188       147879     89353658
EST189       163190     101353479
EST19        165817     114342486
EST190       130565     75428595
EST191       135318     91102543
EST192       132615     89210384
EST193       149128     91480183
EST194       132939     89149200
EST195       122305     86162464
EST196       182708     96975607
EST197       176790     97538624
EST198       176362     97743460
EST199       173604     97345838
EST2         163981     61999756
EST20        206508     108585901
EST200       171159     95892375
EST201       175327     97746722
EST202       176439     96482144
EST203       175299     96075236
EST204       194675     105471940
EST205       205153     108583684
EST206       178112     107413278
EST207       189255     107700848
EST208       199739     118338940
EST209       196059     121073623
EST21        226141     108576241
EST210       183271     121084529
EST211       185699     112748360
EST212       220715     148415122
EST213       232484     109893674
EST214       107675     82812666
EST215       152151     102584382
EST216       148206     91699595
EST217       214161     115360113
EST218       170866     113040983
EST219       97189      95684034
EST22        176350     52335598
EST220       149680     109433981
EST221       159415     95331424
EST222       146015     106186390
EST223       228094     106038594
EST224       139279     102275597
EST225       142164     101847317
EST226       136366     95420057
EST227       124540     89852912
EST228       71864      43422683
EST229       143085     92825677
EST23        131075     37717427
EST230       134744     99599483
EST231       138690     98984380
EST232       125071     85278769
EST233       139403     88591662
EST234       159213     119573006
EST235       139466     120374899
EST236       137277     109341297
EST237       165171     100770876
EST238       176444     111511775
EST239       150853     100167126
EST24        121303     39558327
EST240       180947     120324660
EST241       161728     110801612
EST242       127260     97090021
EST243       166589     101924035
EST244       237437     100731487
EST245       149860     113846625
EST246       188826     61189959
EST247       222095     55684614
EST248       206923     91586905
EST249       177476     126287790
EST25        85001      34289004
EST250       164646     104165180
EST251       180514     109932914
EST252       157007     112671993
EST253       183144     118245062
EST254       45454      25383924
EST255       190256     100195200
EST256       179284     113998405
EST257       167199     110663089
EST258       244690     112711706
EST259       288175     123745081
EST26        217934     99799444
EST260       176529     111324834
EST261       199457     41113031
EST262       248409     123865926
EST263       153290     96982346
EST264       170007     106696009
EST265       62703      37476879
EST266       177270     120418086
EST267       185029     100181339
EST268       178446     116995024
EST269       185124     104884766
EST27        223247     112255693
EST270       212844     32130241
EST271       189114     65221429
EST272       188057     108310273
EST273       183598     118928641
EST274       174949     111408807
EST275       182224     109085753
EST276       154551     91912606
EST277       68261      19855352
EST278       130979     82430272
EST279       136047     87310038
EST28        189042     86573200
EST280       162373     99254439
EST281       266460     27999631
EST282       261973     30836486
EST283       149256     107366874
EST284       167408     114266694
EST285       163627     101214339
EST286       181570     82387283
EST287       247166     44600608
EST288       167609     113195527
EST289       43975      21587004
EST29        163380     71692401
EST290       187388     112630383
EST291       154397     96408653
EST292       201752     111279853
EST293       160683     114171434
EST294       168425     102888860
EST295       191466     117569252
EST296       182174     105144170
EST297       189774     98913894
EST298       190041     66443317
EST299       189908     71400761
EST3         159991     57093499
EST30        171233     68608345
EST300       189714     70367056
EST301       85591      33346717
EST302       191074     94756630
EST303       186081     134739382
EST304       149555     86841236
EST305       155576     94680133
EST306       132629     101141025
EST307       163108     97755782
EST308       178353     102615612
EST309       153112     99145774
EST31        156215     66548079
EST310       167296     94272118
EST311       162353     109062161
EST312       149817     108528593
EST313       168876     106422017
EST314       121741     91904016
EST315       185397     156515854
EST316       176119     94772857
EST317       136214     87504484
EST318       147190     101887009
EST319       140539     92787580
EST32        170607     76286719
EST320       142907     94378372
EST321       147946     102715579
EST322       157103     103729813
EST323       177877     106159143
EST324       151937     85955874
EST325       153418     89252066
EST326       151438     109296173
EST327       165977     99578499
EST328       45938      32195771
EST329       141227     88244798
EST33        181066     74067761
EST330       157189     97982398
EST331       206938     107591529
EST332       128872     71448147
EST333       124866     81863472
EST334       136043     87585037
EST335       137815     86676839
EST336       140606     84245214
EST337       223608     88019005
EST338       182041     82462344
EST339       166987     103834225
EST34        104726     30887906
EST340       168347     103728690
EST341       139341     87525185
EST342       25384      16779623
EST343       136619     91166182
EST344       151797     97693581
EST345       186788     120438212
EST346       164559     89578279
EST347       181833     104983602
EST348       170694     127911455
EST349       73990      44196692
EST35        98065      30029260
EST350       105008     56921449
EST351       138371     82451006
EST352       137334     79147291
EST353       161092     32793712
EST354       161084     32724038
EST355       166519     70376567
EST356       143419     94039061
EST357       253779     116953467
EST358       256267     118256811
EST359       173466     99067094
EST36        98321      31217100
EST360       142175     93371957
EST361       140608     86001246
EST362       163548     98812194
EST363       200742     122609315
EST364       222654     58310040
EST365       199455     123122035
EST366       198579     108260646
EST367       124023     61241376
EST368       188745     121332456
EST369       177492     112959751
EST37        97330      29336523
EST370       154340     118808947
EST371       186728     148224164
EST372       162520     95301657
EST373       204006     115788696
EST374       176064     104023175
EST375       220234     136365688
EST376       202919     126289624
EST377       189477     108272090
EST378       164196     88907765
EST379       172085     15547614
EST38        99416      30212665
EST380       161526     13685646
EST381       159722     27283479
EST382       161214     32423271
EST383       161053     32796624
EST384       150894     82070093
EST385       181967     106788968
EST386       168728     115974461
EST387       169534     99359343
EST388       157342     108852714
EST389       142028     99041887
EST39        101379     30818317
EST390       146496     96417182
EST391       139182     92462956
EST392       155597     112218959
EST393       168237     102894143
EST394       177137     46839405
EST395       168739     51322685
EST396       159775     110402233
EST397       165274     103680269
EST398       166479     107804821
EST399       155363     91760230
EST4         173290     68227083
EST40        8039       2034297
EST400       195361     125208742
EST401       147510     97917782
EST402       134227     91978432
EST403       156250     96605296
EST404       129964     77720086
EST405       176202     95757614
EST406       166925     98418974
EST407       164147     96093401
EST408       177392     109710770
EST409       139164     89022797
EST41        101806     53501971
EST410       87753      66501397
EST411       100943     68085315
EST412       145458     83551303
EST413       131550     79124756
EST414       137884     87350013
EST415       141297     86646080
EST416       155801     95108724
EST417       160900     85081247
EST418       140373     81194995
EST419       131220     86591482
EST42        121605     51755446
EST420       191684     109440943
EST421       172783     74946766
EST422       158831     91489355
EST423       174866     113771310
EST424       176890     97098537
EST425       137862     93401196
EST426       167694     74336852
EST427       195286     85895200
EST428       213096     89988749
EST429       165937     96295839
EST43        168023     87530733
EST430       168334     59868669
EST431       22951      7063570
EST432       160700     63359561
EST433       19487      5803289
EST44        169187     68018592
EST45        169305     90560040
EST46        173403     89924239
EST47        163910     84397973
EST48        164753     87551314
EST49        159208     91792946
EST5         171211     67090000
EST50        165056     92671459
EST51        161048     95281543
EST52        153926     69506889
EST53        155460     93383533
EST54        53310      28697484
EST55        170503     68293532
EST56        161467     77497982
EST57        172744     97788962
EST58        159350     100154769
EST59        158542     103651525
EST6         176940     69309090
EST60        167005     99352452
EST61        164810     107790561
EST62        176019     77318982
EST63        173311     103489083
EST64        152408     78941061
EST65        153056     88661558
EST66        158732     94065779
EST67        112052     66345252
EST68        145178     85874072
EST69        198362     110329936
EST7         170651     73349498
EST70        205588     108472043
EST71        208518     117458063
EST72        202416     120014768
EST73        198870     115120530
EST74        153962     80835278
EST75        135595     63518838
EST76        144384     74852072
EST77        157475     107344315
EST78        153841     83972359
EST79        147179     79119544
EST8         183537     73680326
EST80        28617      24812349
EST81        186081     95835958
EST82        216897     126902313
EST83        211711     113640496
EST84        219256     103893895
EST85        205790     89779943
EST86        152221     91077999
EST87        148253     82681582
EST88        167601     85688640
EST89        157413     86340913
EST9         169212     72414395
EST90        155062     99932636
EST91        154059     106993094
EST92        105601     53524590
EST93        154408     116877013
EST94        143826     105974589
EST95        148132     108295610
EST96        141757     86804354
EST97        161399     89362504
EST98        172586     108631128
EST99        255823     156860187
GSS1         203735     89312867
GSS10        134865     64313376
GSS100       108799     56561669
GSS101       194496     123062085
GSS102       170524     113704930
GSS103       202389     118983482
GSS104       208067     136529951
GSS105       213962     141049355
GSS106       212551     142479413
GSS107       208414     147640191
GSS108       209759     145917694
GSS109       208032     148355774
GSS11        138022     73189181
GSS110       205661     149808960
GSS111       164090     122161694
GSS112       134717     85285062
GSS113       172670     80997425
GSS114       189056     84036000
GSS115       174567     151764477
GSS116       181671     123592850
GSS117       187164     152274217
GSS118       194890     128066935
GSS119       191508     135992770
GSS12        149475     74219336
GSS120       207023     114954092
GSS121       177171     118812139
GSS122       170778     144329283
GSS123       167422     116553213
GSS124       37203      33808043
GSS125       173816     158002249
GSS126       176048     156409370
GSS127       174978     158136749
GSS128       175853     157901751
GSS129       182866     148245694
GSS13        146605     70974416
GSS130       182600     155692289
GSS131       171945     135451127
GSS132       15118      7992205
GSS133       87132      64062850
GSS134       83555      62804812
GSS135       103700     48626431
GSS136       68540      58458817
GSS137       7566       6944755
GSS138       68591      57924394
GSS139       69224      56650935
GSS14        176895     88657656
GSS140       69460      56187403
GSS141       71202      55998401
GSS142       68561      51865315
GSS143       75915      58209304
GSS144       87237      74898207
GSS145       81830      44609896
GSS146       92716      45046736
GSS147       63170      47586447
GSS148       77435      61351403
GSS149       69655      58699293
GSS15        163727     97515464
GSS150       67711      62706526
GSS151       62009      53369632
GSS152       95592      42925428
GSS153       21061      4909542
GSS154       112938     70877522
GSS155       822        559311
GSS156       23226      28867035
GSS157       109026     70640916
GSS158       84262      34482404
GSS159       36103      22420221
GSS16        175166     90441155
GSS160       103304     62490220
GSS161       102329     63761256
GSS162       104268     67656826
GSS163       82099      41276456
GSS164       83102      54651503
GSS165       95717      61368951
GSS166       107327     78544150
GSS167       106327     76654534
GSS168       106058     79947480
GSS169       103996     80016519
GSS17        191954     121602060
GSS170       76372      51037934
GSS171       104574     63293376
GSS172       109868     66415305
GSS173       106198     59308808
GSS174       68379      37446454
GSS175       69628      38764072
GSS176       37097      17751555
GSS177       85481      46023427
GSS178       97119      55907586
GSS179       94982      49597190
GSS18        192387     107784318
GSS180       96286      55922591
GSS181       42132      23615490
GSS182       114638     43642267
GSS183       117085     39368203
GSS184       108676     55514545
GSS185       101471     78372335
GSS186       67717      43620427
GSS187       95891      36542252
GSS188       95417      37268709
GSS189       96671      35161518
GSS19        79331      35564705
GSS190       94285      39167432
GSS191       37736      17626556
GSS192       103939     66277823
GSS193       94551      61190929
GSS194       95128      60357048
GSS195       94773      60868501
GSS196       75675      70017159
GSS197       75117      74330280
GSS198       4473       7127270
GSS199       83736      28233267
GSS2         185158     93986421
GSS20        184918     103934584
GSS200       84219      27346468
GSS201       84926      25909272
GSS202       14851      4422302
GSS203       16547      7508221
GSS204       92599      59605439
GSS205       84775      52587038
GSS206       96115      57298136
GSS207       89290      62469270
GSS208       89113      62767967
GSS209       88958      63029497
GSS21        168364     115535222
GSS210       21475      15119823
GSS211       87995      63795538
GSS212       90217      62488977
GSS213       91852      66673784
GSS214       83705      79638020
GSS215       84165      78995211
GSS216       91236      77203952
GSS217       15869      12057888
GSS218       117650     64297121
GSS219       81406      70473025
GSS22        172518     98964085
GSS220       73127      72712270
GSS221       91890      60357860
GSS222       94787      57200301
GSS223       93517      59081345
GSS224       93900      58510429
GSS225       94714      57307691
GSS226       94279      58016121
GSS227       6701       3333254
GSS23        190834     134329562
GSS24        198893     127661504
GSS25        176449     102829993
GSS26        193640     116266021
GSS27        168456     159190910
GSS28        191294     137442271
GSS29        162603     116618245
GSS3         177961     89026656
GSS30        172562     115698507
GSS31        200167     129345778
GSS32        221139     118630930
GSS33        223185     115899748
GSS34        224450     114208328
GSS35        216176     128923158
GSS36        201824     159079302
GSS37        198403     150015153
GSS38        189993     57319565
GSS39        185306     104010708
GSS4         168924     86150339
GSS40        191734     136125816
GSS41        157614     142421518
GSS42        186790     101740811
GSS43        176698     124421667
GSS44        188594     127050408
GSS45        193883     124542251
GSS46        57723      53850839
GSS47        174600     103522630
GSS48        170232     104826922
GSS49        171036     104583514
GSS5         42124      25877776
GSS50        185795     123933273
GSS51        189260     117038843
GSS52        187856     123909880
GSS53        188263     117836371
GSS54        191344     136709640
GSS55        188764     107152615
GSS56        194826     123639400
GSS57        149330     114138287
GSS58        175581     140830302
GSS59        164259     113008522
GSS6         163999     85738573
GSS60        164059     113443898
GSS61        151080     102384497
GSS62        159488     130770090
GSS63        172167     144277925
GSS64        185099     120114537
GSS65        206709     128412224
GSS66        195995     113280884
GSS67        249648     129859751
GSS68        158567     105919279
GSS69        163662     124361769
GSS7         167871     80311711
GSS70        165186     126441929
GSS71        165133     126004628
GSS72        182426     112559129
GSS73        168262     123377228
GSS74        202841     128926662
GSS75        173121     113975290
GSS76        203751     134201714
GSS77        225093     79713130
GSS78        186921     111092645
GSS79        127472     92848908
GSS8         168295     90336284
GSS80        147793     118830103
GSS81        141515     117921505
GSS82        144999     117052702
GSS83        145381     120795570
GSS84        145218     118700931
GSS85        79295      65797975
GSS86        151559     123936550
GSS87        149675     118983441
GSS88        145849     114834242
GSS89        144700     117194813
GSS9         138182     67450953
GSS90        146534     121810308
GSS91        150312     122496365
GSS92        149484     119952550
GSS93        148063     122798524
GSS94        148165     122603607
GSS95        148721     121513729
GSS96        146688     115448618
GSS97        143833     116758008
GSS98        146799     121478785
GSS99        180819     131784426
HTC1         25057      27045808
HTC10        64097      67385497
HTC11        74560      76095719
HTC12        21439      31302476
HTC13        66997      61008541
HTC14        68336      69516375
HTC15        20854      14521356
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15981      40345967
HTC6         16068      37476179
HTC7         53837      31481114
HTC8         31133      19445871
HTC9         62284      77327447
HTG1         1318       188771164
HTG10        1298       186333849
HTG100       990        189440077
HTG101       996        189311689
HTG102       985        189405998
HTG103       1161       190529146
HTG104       30         4187142
HTG105       1090       189528150
HTG106       1040       189748285
HTG107       1394       191388699
HTG108       1301       190943512
HTG109       1620       191199764
HTG11        6          837687
HTG110       1384       191904805
HTG111       1367       191736493
HTG112       1190       189443047
HTG113       1073       184936493
HTG114       322        49161233
HTG115       1513       182381556
HTG116       991        192212231
HTG117       929        180563048
HTG118       1076       193799636
HTG119       1103       193128862
HTG12        1451       183826000
HTG120       244        45955630
HTG121       1029       189498766
HTG122       1054       192790433
HTG123       1165       191966364
HTG124       1081       192892137
HTG125       1075       193106029
HTG126       687        119947247
HTG127       1118       192671822
HTG128       1085       192382816
HTG129       1077       192462758
HTG13        875        191579912
HTG130       1124       192129858
HTG131       1049       192200516
HTG132       1069       192133132
HTG133       1067       192358596
HTG134       1129       191890252
HTG135       1183       189988586
HTG136       291        21296207
HTG14        750        192090960
HTG15        745        192095083
HTG16        784        191973539
HTG17        800        191864904
HTG18        771        191947816
HTG19        2061       170934592
HTG2         2470       186037380
HTG20        1082       187623508
HTG21        926        183819238
HTG22        785        191651908
HTG23        928        190141652
HTG24        907        190495401
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190514509
HTG29        939        189964220
HTG3         2513       185208586
HTG30        911        190941779
HTG31        841        171462419
HTG32        875        191097680
HTG33        966        189353683
HTG34        884        191021659
HTG35        866        191265313
HTG36        826        191631729
HTG37        948        189902725
HTG38        948        190267532
HTG39        940        190178969
HTG4         2550       188439001
HTG40        1048       189151703
HTG41        1099       169476970
HTG42        1257       188188838
HTG43        1169       188132191
HTG44        1150       188026157
HTG45        1118       191332771
HTG46        1269       190703866
HTG47        1174       190717160
HTG48        1130       191137302
HTG49        1047       191184441
HTG5         1283       185453274
HTG50        1021       189712765
HTG51        1061       180778979
HTG52        969        190090757
HTG53        1106       190109635
HTG54        1046       190260051
HTG55        1014       189766536
HTG56        967        189017980
HTG57        89         15545773
HTG58        1010       189344282
HTG59        1031       190037155
HTG6         1273       185124562
HTG60        1072       187359162
HTG61        1129       188210893
HTG62        997        172674612
HTG63        1086       189585086
HTG64        1065       189567157
HTG65        1169       188828767
HTG66        1178       187478964
HTG67        1283       184490539
HTG68        95         12336833
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187658245
HTG73        1030       171814917
HTG74        1118       188295824
HTG75        1103       190843621
HTG76        1137       190917883
HTG77        1182       190813322
HTG78        1102       187147429
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190062476
HTG81        1214       189987246
HTG82        1120       189706900
HTG83        958        164506501
HTG84        1228       188383308
HTG85        1251       187687552
HTG86        1141       190066830
HTG87        1147       189784126
HTG88        982        168468910
HTG89        1183       189859637
HTG9         1200       186916809
HTG90        1104       190250569
HTG91        1145       190088330
HTG92        1103       190359001
HTG93        983        162125222
HTG94        1056       190715130
HTG95        1159       191010347
HTG96        1035       189201430
HTG97        1070       189559758
HTG98        690        128563367
HTG99        1018       189641315
INV1         94012      48447829
INV10        84065      65285727
INV11        52280      41570228
INV12        85007      66389534
INV13        80982      66955330
INV14        78579      68001903
INV15        41128      38312268
INV16        8168       145023213
INV17        320        155148771
INV18        28300      118228160
INV19        10914      144751463
INV2         11327      168975649
INV20        65795      80233049
INV21        74713      61141736
INV22        69179      48796975
INV23        76617      55340985
INV24        73629      48890325
INV25        73184      48477927
INV26        33536      101164807
INV3         1317       148745999
INV4         10948      132609061
INV5         76804      74793553
INV6         56453      86911101
INV7         43488      79476215
INV8         80649      71843213
INV9         59613      85950973
MAM1         14408      163096246
MAM2         25577      149866466
MAM3         53466      91284846
MAM4         25172      158857243
MAM5         82932      72935538
MAM6         56425      106010971
MAM7         624        592790
PAT1         222551     70117001
PAT10        124661     102486094
PAT100       158877     103325984
PAT101       137417     114988187
PAT102       42311      27994848
PAT103       193712     81686401
PAT104       150217     108404022
PAT105       356051     11379688
PAT106       257211     57607099
PAT107       138161     48226925
PAT108       322021     22795469
PAT109       155639     102753887
PAT11        98306      64091632
PAT110       147988     113763745
PAT111       114442     129449149
PAT112       24454      182747194
PAT113       155370     106773179
PAT114       175439     89936083
PAT115       203659     47736667
PAT116       277827     9628431
PAT117       220409     46465135
PAT118       106723     2881242
PAT119       270386     21672571
PAT12        142068     62828851
PAT120       186752     61240505
PAT121       109806     106057338
PAT122       47510      9549213
PAT123       87302      88258781
PAT124       78470      95599150
PAT125       145247     77675877
PAT126       167500     71389679
PAT127       121469     92946412
PAT128       102948     85417075
PAT129       165536     45971024
PAT13        105882     59871683
PAT130       270022     5130418
PAT131       269978     5129582
PAT132       269978     5129582
PAT133       237888     4519872
PAT134       269396     5118524
PAT135       235715     25782943
PAT136       204521     46982512
PAT137       172616     69047046
PAT138       92561      126279067
PAT139       161868     77929551
PAT14        103650     50160806
PAT140       149903     63314632
PAT15        121150     53321659
PAT16        113145     61277722
PAT17        39141      16227175
PAT18        146771     52594264
PAT19        153705     78039102
PAT2         194539     84646173
PAT20        104995     118172564
PAT21        133557     95531331
PAT22        84591      79293837
PAT23        123578     103411046
PAT24        119401     105827243
PAT25        145704     86536632
PAT26        175212     64262656
PAT27        71105      1777625
PAT28        102171     77387698
PAT29        93958      87647590
PAT3         171982     95895030
PAT30        119943     61672014
PAT31        96649      78966375
PAT32        128386     55033955
PAT33        92203      51115202
PAT34        111299     78151838
PAT35        138103     29119101
PAT36        158499     24085905
PAT37        114684     49015396
PAT38        44863      54579873
PAT39        95734      83197609
PAT4         153735     106065154
PAT40        100230     70978875
PAT41        136206     39303264
PAT42        143780     35446924
PAT43        123733     64747040
PAT44        104353     81197501
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57193      23949203
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92817      89411310
PAT59        106528     74777923
PAT6         170642     91909261
PAT60        122361     64031080
PAT61        67409      30294382
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154801     88242556
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131199     96948597
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        93691      93465245
PAT84        116501     55463268
PAT85        2492       193913009
PAT86        79466      64446778
PAT87        342935     8573375
PAT88        188806     88519660
PAT89        111348     132068608
PAT9         129499     101202077
PAT90        3850       194703659
PAT91        131292     110979300
PAT92        158599     54826034
PAT93        224731     34113482
PAT94        250080     15844362
PAT95        180680     63680037
PAT96        51647      26043244
PAT97        114193     110462231
PAT98        137709     83282930
PAT99        164147     99343851
PHG1         5835       50389900
PLN1         59893      93434637
PLN10        37376      49320674
PLN11        38520      70358228
PLN12        13997      137695107
PLN13        7719       40899077
PLN14        17578      144865462
PLN15        17634      146278605
PLN16        17564      146392665
PLN17        24586      128619888
PLN18        5995       149202121
PLN19        1266       170315035
PLN2         28326      129239043
PLN20        14719      154649642
PLN21        6526       7649997
PLN22        67340      69773747
PLN23        28544      30822374
PLN24        77004      76377499
PLN25        65404      81456402
PLN26        40834      117421530
PLN27        12265      134420639
PLN28        15454      137992095
PLN29        73631      77778504
PLN3         1384       180537542
PLN30        75592      77865679
PLN31        74703      33315075
PLN32        80809      71231538
PLN33        77906      76031681
PLN34        80114      70257282
PLN35        81746      76462649
PLN36        46986      23812817
PLN37        101177     57686617
PLN38        80899      69787993
PLN39        46385      99205415
PLN4         1864       186929373
PLN40        52321      103780294
PLN41        80441      73360590
PLN42        79564      70315852
PLN43        79394      67078621
PLN44        39860      69755964
PLN5         1844       194316519
PLN6         2836       176787207
PLN7         74789      81980480
PLN8         22210      21438750
PLN9         73122      75864932
PRI1         23017      59659245
PRI10        1282       179569531
PRI11        750        91157824
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720991
PRI17        1137       193649117
PRI18        1098       194174732
PRI19        1166       193723867
PRI2         17777      149944025
PRI20        1750       191720179
PRI21        2717       189637245
PRI22        20867      92905838
PRI23        32483      85337154
PRI24        61439      78188797
PRI25        30604      68651823
PRI26        6598       166805290
PRI27        2120       180578492
PRI28        1602       181614925
PRI29        2027       181677828
PRI3         1436       175494049
PRI30        1973       180540078
PRI31        13166      153854033
PRI32        1298       183382382
PRI33        43204      104894423
PRI34        22128      28080220
PRI35        32190      63610035
PRI36        20224      117496077
PRI37        18686      146786473
PRI38        67149      87158653
PRI39        50310      89079896
PRI4         1288       185770995
PRI40        35866      67105796
PRI41        54460      91727105
PRI42        29658      56544421
PRI5         1317       183887466
PRI6         1181       180033988
PRI7         1249       181215462
PRI8         1215       178157174
PRI9         1359       174576633
ROD1         32058      141024546
ROD10        983        181243384
ROD11        214        40582774
ROD12        1034       185475616
ROD13        940        182704112
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185812687
ROD18        1190       190560949
ROD19        16702      116537109
ROD2         915        175257467
ROD20        20206      148569736
ROD21        1135       182044035
ROD22        1066       166284921
ROD23        13616      162602043
ROD24        38731      69924077
ROD25        21987      103756874
ROD26        1519       187758894
ROD27        136892     37803860
ROD28        82838      72249091
ROD29        31313      35776614
ROD3         907        173346851
ROD4         900        173882256
ROD5         922        174217276
ROD6         969        178320239
ROD7         966        179459673
ROD8         980        181253783
ROD9         997        181893346
STS1         85279      36761705
STS10        57907      44419978
STS11        49213      37736560
STS12        57924      43637361
STS13        64465      42926766
STS14        93303      34078508
STS15        103304     26251485
STS16        11220      3036363
STS17        102778     27232221
STS18        87018      34309974
STS19        98585      33303134
STS2         84303      49842494
STS20        55817      20848317
STS3         66925      26376700
STS4         76919      36916047
STS5         8502       4983828
STS6         54177      31603126
STS7         54081      31788805
STS8         54235      31906296
STS9         55657      37682948
SYN1         44175      73306214
SYN2         48626      68935678
SYN3         4313       7940830
TSA1         120497     38242009
TSA10        17443      8670141
TSA11        86486      70566494
TSA12        121991     38853496
TSA13        134869     35825795
TSA14        62213      80945472
TSA15        59466      91022180
TSA16        16046      15520912
TSA2         113538     41673356
TSA3         110398     41018325
TSA4         110953     45737544
TSA5         43142      10915358
TSA6         118117     60745378
TSA7         105776     72379622
TSA8         112890     59888795
TSA9         114942     56877810
UNA1         224        124411
VRL1         70075      67578303
VRL10        52981      69913280
VRL11        62618      71407166
VRL12        58360      72423043
VRL13        62700      65736002
VRL14        58983      73704212
VRL15        58119      71929049
VRL16        44466      44135322
VRL2         73389      64075691
VRL3         69926      61020769
VRL4         67741      70915656
VRL5         41383      43372148
VRL6         48351      77608996
VRL7         60845      70449778
VRL8         61014      73336368
VRL9         67135      68733300
VRT1         36159      132792593
VRT10        1256       189217442
VRT11        8274       177839690
VRT12        3992       136488828
VRT13        13096      170782830
VRT14        5352       182588855
VRT15        3937       185996611
VRT16        38062      133850025
VRT17        79948      68492856
VRT18        78399      66638493
VRT19        78248      65426031
VRT2         9076       181475706
VRT20        42037      130553649
VRT21        75716      63433702
VRT22        74576      57763063
VRT3         64730      88829307
VRT4         16665      159097094
VRT5         22780      18255145
VRT6         73011      66829312
VRT7         31735      63524393
VRT8         30664      111976676
VRT9         1203       190000786

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 182.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

16787340 15527594745   Homo sapiens
7893287   8901881284   Mus musculus
2180416   6489629823   Rattus norvegicus
2198182   5377845969   Bos taurus
3925025   5053398492   Zea mays
3220979   4807338941   Sus scrofa
1698417   3123978887   Danio rerio
228260    1352941097   Strongylocentrotus purpuratus
1279973   1222969693   Oryza sativa Japonica Group
1770010   1194612454   Nicotiana tabacum
1424245   1147209090   Xenopus (Silurana) tropicalis
1215073   1052326710   Drosophila melanogaster
2296179   1004573283   Arabidopsis thaliana
214007    1002239797   Pan troglodytes
1453357    943623915   Canis lupus familiaris
661285     914649587   Vitis vinifera
810690     893458855   Gallus gallus
1889644    893120157   Glycine max
82398      826325584   Macaca mulatta
1217091    748804606   Ciona intestinalis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 182.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 182.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,	Gert Roosen,
	Susan Schafer, Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
	Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade,	Constantin Vasilyev

User Support
	Peter Cooper, Wayne Matten, Scott McGinnis, Steve Pechous, Monica Romiti,
	Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center