Release Notes For GenBank Release 184

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2011

               NCBI-GenBank Flat File Release 184.0

                    Distribution Release Notes

 140482268 loci, 129178292958 bases, from 140482268 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 184.0
1.2 Cutoff Date
1.3 Important Changes in Release 184.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 184.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 184.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 184.0, incorporates data available to the collaborating
databases as of April 29, 2011 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 184.0

1.3.1 Organizational changes

The total number of sequence data files increased by 60 with this release:

  - the BCT division is now composed of  72 files (+4)
  - the CON division is now composed of 149 files (+1)
  - the ENV division is now composed of  40 files (-1)
  - the EST division is now composed of 445 files (+10)
  - the GSS division is now composed of 247 files (+10)
  - the INV division is now composed of  30 files (+1)
  - the PAT division is now composed of 164 files (+23)
  - the PLN division is now composed of  48 files (+2)
  - the TSA division is now composed of  30 files (+8)
  - the VRL division is now composed of  18 files (+1)
  - the VRT division is now composed of  24 files (+1)

The decrease in the number of ENV division files was caused by the
removal of nearly 100,000 uncultured bacterial sequence records from
an environmental sampling sequence project, which had been redundantly
submitted to GenBank twice.

The total number of 'index' files decreased by 18 with this release:

  - the AUT (author name)  index is now composed of  88 files (-20)
  - the JOU (journal name)  index is now composed of 12 files (+2)

The decrease in the number of AUT index files was due to both the removal
of redundantly-submitted bacterial sequence records (mentioned above), and
to corrections in the database where author names are separately stored
for the purpose of generating the gbaut* index files.

1.3.2 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 184.0. Consider gbgss145.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                            June 15 2011

                NCBI-GenBank Flat File Release 184.0

                           GSS Sequences (Part 1)

   87117 loci,    64024027 bases, from    87117 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "145" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

  The May 2011 International Nucleotide Sequence Database Collaboration annual
meeting resolved a variety of outstanding issues related to changes for the
/partial qualifier, the /inference and /experiment qualifiers, and the
/whole_replicon qualifier. In addition, some new changes for 2011 were agreed
upon. A summary of these changes will be provided via the GenBank newsgroup
within two months.
  
1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1638 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut9.idx - Index of the entries according to author name, part 9.
92. gbbct1.seq - Bacterial sequence entries, part 1.
93. gbbct10.seq - Bacterial sequence entries, part 10.
94. gbbct11.seq - Bacterial sequence entries, part 11.
95. gbbct12.seq - Bacterial sequence entries, part 12.
96. gbbct13.seq - Bacterial sequence entries, part 13.
97. gbbct14.seq - Bacterial sequence entries, part 14.
98. gbbct15.seq - Bacterial sequence entries, part 15.
99. gbbct16.seq - Bacterial sequence entries, part 16.
100. gbbct17.seq - Bacterial sequence entries, part 17.
101. gbbct18.seq - Bacterial sequence entries, part 18.
102. gbbct19.seq - Bacterial sequence entries, part 19.
103. gbbct2.seq - Bacterial sequence entries, part 2.
104. gbbct20.seq - Bacterial sequence entries, part 20.
105. gbbct21.seq - Bacterial sequence entries, part 21.
106. gbbct22.seq - Bacterial sequence entries, part 22.
107. gbbct23.seq - Bacterial sequence entries, part 23.
108. gbbct24.seq - Bacterial sequence entries, part 24.
109. gbbct25.seq - Bacterial sequence entries, part 25.
110. gbbct26.seq - Bacterial sequence entries, part 26.
111. gbbct27.seq - Bacterial sequence entries, part 27.
112. gbbct28.seq - Bacterial sequence entries, part 28.
113. gbbct29.seq - Bacterial sequence entries, part 29.
114. gbbct3.seq - Bacterial sequence entries, part 3.
115. gbbct30.seq - Bacterial sequence entries, part 30.
116. gbbct31.seq - Bacterial sequence entries, part 31.
117. gbbct32.seq - Bacterial sequence entries, part 32.
118. gbbct33.seq - Bacterial sequence entries, part 33.
119. gbbct34.seq - Bacterial sequence entries, part 34.
120. gbbct35.seq - Bacterial sequence entries, part 35.
121. gbbct36.seq - Bacterial sequence entries, part 36.
122. gbbct37.seq - Bacterial sequence entries, part 37.
123. gbbct38.seq - Bacterial sequence entries, part 38.
124. gbbct39.seq - Bacterial sequence entries, part 39.
125. gbbct4.seq - Bacterial sequence entries, part 4.
126. gbbct40.seq - Bacterial sequence entries, part 40.
127. gbbct41.seq - Bacterial sequence entries, part 41.
128. gbbct42.seq - Bacterial sequence entries, part 42.
129. gbbct43.seq - Bacterial sequence entries, part 43.
130. gbbct44.seq - Bacterial sequence entries, part 44.
131. gbbct45.seq - Bacterial sequence entries, part 45.
132. gbbct46.seq - Bacterial sequence entries, part 46.
133. gbbct47.seq - Bacterial sequence entries, part 47.
134. gbbct48.seq - Bacterial sequence entries, part 48.
135. gbbct49.seq - Bacterial sequence entries, part 49.
136. gbbct5.seq - Bacterial sequence entries, part 5.
137. gbbct50.seq - Bacterial sequence entries, part 50.
138. gbbct51.seq - Bacterial sequence entries, part 51.
139. gbbct52.seq - Bacterial sequence entries, part 52.
140. gbbct53.seq - Bacterial sequence entries, part 53.
141. gbbct54.seq - Bacterial sequence entries, part 54.
142. gbbct55.seq - Bacterial sequence entries, part 55.
143. gbbct56.seq - Bacterial sequence entries, part 56.
144. gbbct57.seq - Bacterial sequence entries, part 57.
145. gbbct58.seq - Bacterial sequence entries, part 58.
146. gbbct59.seq - Bacterial sequence entries, part 59.
147. gbbct6.seq - Bacterial sequence entries, part 6.
148. gbbct60.seq - Bacterial sequence entries, part 60.
149. gbbct61.seq - Bacterial sequence entries, part 61.
150. gbbct62.seq - Bacterial sequence entries, part 62.
151. gbbct63.seq - Bacterial sequence entries, part 63.
152. gbbct64.seq - Bacterial sequence entries, part 64.
153. gbbct65.seq - Bacterial sequence entries, part 65.
154. gbbct66.seq - Bacterial sequence entries, part 66.
155. gbbct67.seq - Bacterial sequence entries, part 67.
156. gbbct68.seq - Bacterial sequence entries, part 68.
157. gbbct69.seq - Bacterial sequence entries, part 69.
158. gbbct7.seq - Bacterial sequence entries, part 7.
159. gbbct70.seq - Bacterial sequence entries, part 70.
160. gbbct71.seq - Bacterial sequence entries, part 71.
161. gbbct72.seq - Bacterial sequence entries, part 72.
162. gbbct8.seq - Bacterial sequence entries, part 8.
163. gbbct9.seq - Bacterial sequence entries, part 9.
164. gbchg.txt - Accession numbers of entries updated since the previous release.
165. gbcon1.seq - Constructed sequence entries, part 1.
166. gbcon10.seq - Constructed sequence entries, part 10.
167. gbcon100.seq - Constructed sequence entries, part 100.
168. gbcon101.seq - Constructed sequence entries, part 101.
169. gbcon102.seq - Constructed sequence entries, part 102.
170. gbcon103.seq - Constructed sequence entries, part 103.
171. gbcon104.seq - Constructed sequence entries, part 104.
172. gbcon105.seq - Constructed sequence entries, part 105.
173. gbcon106.seq - Constructed sequence entries, part 106.
174. gbcon107.seq - Constructed sequence entries, part 107.
175. gbcon108.seq - Constructed sequence entries, part 108.
176. gbcon109.seq - Constructed sequence entries, part 109.
177. gbcon11.seq - Constructed sequence entries, part 11.
178. gbcon110.seq - Constructed sequence entries, part 110.
179. gbcon111.seq - Constructed sequence entries, part 111.
180. gbcon112.seq - Constructed sequence entries, part 112.
181. gbcon113.seq - Constructed sequence entries, part 113.
182. gbcon114.seq - Constructed sequence entries, part 114.
183. gbcon115.seq - Constructed sequence entries, part 115.
184. gbcon116.seq - Constructed sequence entries, part 116.
185. gbcon117.seq - Constructed sequence entries, part 117.
186. gbcon118.seq - Constructed sequence entries, part 118.
187. gbcon119.seq - Constructed sequence entries, part 119.
188. gbcon12.seq - Constructed sequence entries, part 12.
189. gbcon120.seq - Constructed sequence entries, part 120.
190. gbcon121.seq - Constructed sequence entries, part 121.
191. gbcon122.seq - Constructed sequence entries, part 122.
192. gbcon123.seq - Constructed sequence entries, part 123.
193. gbcon124.seq - Constructed sequence entries, part 124.
194. gbcon125.seq - Constructed sequence entries, part 125.
195. gbcon126.seq - Constructed sequence entries, part 126.
196. gbcon127.seq - Constructed sequence entries, part 127.
197. gbcon128.seq - Constructed sequence entries, part 128.
198. gbcon129.seq - Constructed sequence entries, part 129.
199. gbcon13.seq - Constructed sequence entries, part 13.
200. gbcon130.seq - Constructed sequence entries, part 130.
201. gbcon131.seq - Constructed sequence entries, part 131.
202. gbcon132.seq - Constructed sequence entries, part 132.
203. gbcon133.seq - Constructed sequence entries, part 133.
204. gbcon134.seq - Constructed sequence entries, part 134.
205. gbcon135.seq - Constructed sequence entries, part 135.
206. gbcon136.seq - Constructed sequence entries, part 136.
207. gbcon137.seq - Constructed sequence entries, part 137.
208. gbcon138.seq - Constructed sequence entries, part 138.
209. gbcon139.seq - Constructed sequence entries, part 139.
210. gbcon14.seq - Constructed sequence entries, part 14.
211. gbcon140.seq - Constructed sequence entries, part 140.
212. gbcon141.seq - Constructed sequence entries, part 141.
213. gbcon142.seq - Constructed sequence entries, part 142.
214. gbcon143.seq - Constructed sequence entries, part 143.
215. gbcon144.seq - Constructed sequence entries, part 144.
216. gbcon145.seq - Constructed sequence entries, part 145.
217. gbcon146.seq - Constructed sequence entries, part 146.
218. gbcon147.seq - Constructed sequence entries, part 147.
219. gbcon148.seq - Constructed sequence entries, part 148.
220. gbcon149.seq - Constructed sequence entries, part 149.
221. gbcon15.seq - Constructed sequence entries, part 15.
222. gbcon16.seq - Constructed sequence entries, part 16.
223. gbcon17.seq - Constructed sequence entries, part 17.
224. gbcon18.seq - Constructed sequence entries, part 18.
225. gbcon19.seq - Constructed sequence entries, part 19.
226. gbcon2.seq - Constructed sequence entries, part 2.
227. gbcon20.seq - Constructed sequence entries, part 20.
228. gbcon21.seq - Constructed sequence entries, part 21.
229. gbcon22.seq - Constructed sequence entries, part 22.
230. gbcon23.seq - Constructed sequence entries, part 23.
231. gbcon24.seq - Constructed sequence entries, part 24.
232. gbcon25.seq - Constructed sequence entries, part 25.
233. gbcon26.seq - Constructed sequence entries, part 26.
234. gbcon27.seq - Constructed sequence entries, part 27.
235. gbcon28.seq - Constructed sequence entries, part 28.
236. gbcon29.seq - Constructed sequence entries, part 29.
237. gbcon3.seq - Constructed sequence entries, part 3.
238. gbcon30.seq - Constructed sequence entries, part 30.
239. gbcon31.seq - Constructed sequence entries, part 31.
240. gbcon32.seq - Constructed sequence entries, part 32.
241. gbcon33.seq - Constructed sequence entries, part 33.
242. gbcon34.seq - Constructed sequence entries, part 34.
243. gbcon35.seq - Constructed sequence entries, part 35.
244. gbcon36.seq - Constructed sequence entries, part 36.
245. gbcon37.seq - Constructed sequence entries, part 37.
246. gbcon38.seq - Constructed sequence entries, part 38.
247. gbcon39.seq - Constructed sequence entries, part 39.
248. gbcon4.seq - Constructed sequence entries, part 4.
249. gbcon40.seq - Constructed sequence entries, part 40.
250. gbcon41.seq - Constructed sequence entries, part 41.
251. gbcon42.seq - Constructed sequence entries, part 42.
252. gbcon43.seq - Constructed sequence entries, part 43.
253. gbcon44.seq - Constructed sequence entries, part 44.
254. gbcon45.seq - Constructed sequence entries, part 45.
255. gbcon46.seq - Constructed sequence entries, part 46.
256. gbcon47.seq - Constructed sequence entries, part 47.
257. gbcon48.seq - Constructed sequence entries, part 48.
258. gbcon49.seq - Constructed sequence entries, part 49.
259. gbcon5.seq - Constructed sequence entries, part 5.
260. gbcon50.seq - Constructed sequence entries, part 50.
261. gbcon51.seq - Constructed sequence entries, part 51.
262. gbcon52.seq - Constructed sequence entries, part 52.
263. gbcon53.seq - Constructed sequence entries, part 53.
264. gbcon54.seq - Constructed sequence entries, part 54.
265. gbcon55.seq - Constructed sequence entries, part 55.
266. gbcon56.seq - Constructed sequence entries, part 56.
267. gbcon57.seq - Constructed sequence entries, part 57.
268. gbcon58.seq - Constructed sequence entries, part 58.
269. gbcon59.seq - Constructed sequence entries, part 59.
270. gbcon6.seq - Constructed sequence entries, part 6.
271. gbcon60.seq - Constructed sequence entries, part 60.
272. gbcon61.seq - Constructed sequence entries, part 61.
273. gbcon62.seq - Constructed sequence entries, part 62.
274. gbcon63.seq - Constructed sequence entries, part 63.
275. gbcon64.seq - Constructed sequence entries, part 64.
276. gbcon65.seq - Constructed sequence entries, part 65.
277. gbcon66.seq - Constructed sequence entries, part 66.
278. gbcon67.seq - Constructed sequence entries, part 67.
279. gbcon68.seq - Constructed sequence entries, part 68.
280. gbcon69.seq - Constructed sequence entries, part 69.
281. gbcon7.seq - Constructed sequence entries, part 7.
282. gbcon70.seq - Constructed sequence entries, part 70.
283. gbcon71.seq - Constructed sequence entries, part 71.
284. gbcon72.seq - Constructed sequence entries, part 72.
285. gbcon73.seq - Constructed sequence entries, part 73.
286. gbcon74.seq - Constructed sequence entries, part 74.
287. gbcon75.seq - Constructed sequence entries, part 75.
288. gbcon76.seq - Constructed sequence entries, part 76.
289. gbcon77.seq - Constructed sequence entries, part 77.
290. gbcon78.seq - Constructed sequence entries, part 78.
291. gbcon79.seq - Constructed sequence entries, part 79.
292. gbcon8.seq - Constructed sequence entries, part 8.
293. gbcon80.seq - Constructed sequence entries, part 80.
294. gbcon81.seq - Constructed sequence entries, part 81.
295. gbcon82.seq - Constructed sequence entries, part 82.
296. gbcon83.seq - Constructed sequence entries, part 83.
297. gbcon84.seq - Constructed sequence entries, part 84.
298. gbcon85.seq - Constructed sequence entries, part 85.
299. gbcon86.seq - Constructed sequence entries, part 86.
300. gbcon87.seq - Constructed sequence entries, part 87.
301. gbcon88.seq - Constructed sequence entries, part 88.
302. gbcon89.seq - Constructed sequence entries, part 89.
303. gbcon9.seq - Constructed sequence entries, part 9.
304. gbcon90.seq - Constructed sequence entries, part 90.
305. gbcon91.seq - Constructed sequence entries, part 91.
306. gbcon92.seq - Constructed sequence entries, part 92.
307. gbcon93.seq - Constructed sequence entries, part 93.
308. gbcon94.seq - Constructed sequence entries, part 94.
309. gbcon95.seq - Constructed sequence entries, part 95.
310. gbcon96.seq - Constructed sequence entries, part 96.
311. gbcon97.seq - Constructed sequence entries, part 97.
312. gbcon98.seq - Constructed sequence entries, part 98.
313. gbcon99.seq - Constructed sequence entries, part 99.
314. gbdel.txt - Accession numbers of entries deleted since the previous release.
315. gbenv1.seq - Environmental sampling sequence entries, part 1.
316. gbenv10.seq - Environmental sampling sequence entries, part 10.
317. gbenv11.seq - Environmental sampling sequence entries, part 11.
318. gbenv12.seq - Environmental sampling sequence entries, part 12.
319. gbenv13.seq - Environmental sampling sequence entries, part 13.
320. gbenv14.seq - Environmental sampling sequence entries, part 14.
321. gbenv15.seq - Environmental sampling sequence entries, part 15.
322. gbenv16.seq - Environmental sampling sequence entries, part 16.
323. gbenv17.seq - Environmental sampling sequence entries, part 17.
324. gbenv18.seq - Environmental sampling sequence entries, part 18.
325. gbenv19.seq - Environmental sampling sequence entries, part 19.
326. gbenv2.seq - Environmental sampling sequence entries, part 2.
327. gbenv20.seq - Environmental sampling sequence entries, part 20.
328. gbenv21.seq - Environmental sampling sequence entries, part 21.
329. gbenv22.seq - Environmental sampling sequence entries, part 22.
330. gbenv23.seq - Environmental sampling sequence entries, part 23.
331. gbenv24.seq - Environmental sampling sequence entries, part 24.
332. gbenv25.seq - Environmental sampling sequence entries, part 25.
333. gbenv26.seq - Environmental sampling sequence entries, part 26.
334. gbenv27.seq - Environmental sampling sequence entries, part 27.
335. gbenv28.seq - Environmental sampling sequence entries, part 28.
336. gbenv29.seq - Environmental sampling sequence entries, part 29.
337. gbenv3.seq - Environmental sampling sequence entries, part 3.
338. gbenv30.seq - Environmental sampling sequence entries, part 30.
339. gbenv31.seq - Environmental sampling sequence entries, part 31.
340. gbenv32.seq - Environmental sampling sequence entries, part 32.
341. gbenv33.seq - Environmental sampling sequence entries, part 33.
342. gbenv34.seq - Environmental sampling sequence entries, part 34.
343. gbenv35.seq - Environmental sampling sequence entries, part 35.
344. gbenv36.seq - Environmental sampling sequence entries, part 36.
345. gbenv37.seq - Environmental sampling sequence entries, part 37.
346. gbenv38.seq - Environmental sampling sequence entries, part 38.
347. gbenv39.seq - Environmental sampling sequence entries, part 39.
348. gbenv4.seq - Environmental sampling sequence entries, part 4.
349. gbenv40.seq - Environmental sampling sequence entries, part 40.
350. gbenv5.seq - Environmental sampling sequence entries, part 5.
351. gbenv6.seq - Environmental sampling sequence entries, part 6.
352. gbenv7.seq - Environmental sampling sequence entries, part 7.
353. gbenv8.seq - Environmental sampling sequence entries, part 8.
354. gbenv9.seq - Environmental sampling sequence entries, part 9.
355. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
356. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
357. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
358. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
359. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
360. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
361. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
362. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
363. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
364. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
365. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
366. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
367. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
368. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
369. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
370. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
371. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
372. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
373. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
374. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
375. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
376. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
377. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
378. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
379. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
380. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
381. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
382. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
383. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
384. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
385. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
386. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
387. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
388. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
389. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
390. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
391. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
392. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
393. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
394. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
395. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
396. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
397. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
398. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
399. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
400. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
401. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
402. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
403. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
404. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
405. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
406. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
407. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
408. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
409. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
410. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
411. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
412. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
413. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
414. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
415. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
416. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
417. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
418. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
419. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
420. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
421. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
422. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
423. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
424. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
425. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
426. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
427. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
428. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
429. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
430. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
431. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
432. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
433. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
434. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
435. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
436. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
437. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
438. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
439. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
440. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
441. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
442. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
443. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
444. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
445. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
446. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
447. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
448. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
449. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
450. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
451. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
452. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
453. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
454. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
455. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
456. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
457. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
458. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
459. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
460. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
461. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
462. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
463. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
464. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
465. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
466. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
467. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
468. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
469. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
470. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
471. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
472. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
473. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
474. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
475. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
476. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
477. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
478. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
479. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
480. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
481. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
482. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
483. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
484. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
485. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
486. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
487. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
488. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
489. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
490. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
491. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
492. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
493. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
494. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
495. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
496. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
497. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
498. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
499. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
500. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
501. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
502. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
503. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
504. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
505. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
506. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
507. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
508. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
509. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
510. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
511. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
512. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
513. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
514. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
515. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
516. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
517. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
518. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
519. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
520. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
521. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
522. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
523. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
524. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
525. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
526. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
527. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
528. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
529. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
530. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
531. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
532. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
533. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
534. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
535. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
536. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
537. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
538. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
539. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
540. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
541. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
542. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
543. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
544. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
545. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
546. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
547. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
548. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
549. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
550. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
551. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
552. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
553. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
554. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
555. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
556. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
557. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
558. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
559. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
560. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
561. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
562. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
563. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
564. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
565. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
566. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
567. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
568. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
569. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
570. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
571. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
572. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
573. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
574. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
575. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
576. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
577. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
578. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
579. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
580. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
581. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
582. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
583. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
584. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
585. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
586. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
587. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
588. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
589. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
590. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
591. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
592. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
593. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
594. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
595. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
596. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
597. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
598. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
599. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
600. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
601. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
602. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
603. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
604. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
605. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
606. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
607. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
608. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
609. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
610. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
611. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
612. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
613. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
614. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
615. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
616. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
617. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
618. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
619. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
620. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
621. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
622. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
623. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
624. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
625. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
626. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
627. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
628. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
629. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
630. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
631. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
632. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
633. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
634. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
635. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
636. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
637. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
638. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
639. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
640. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
641. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
642. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
643. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
644. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
645. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
646. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
647. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
648. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
649. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
650. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
651. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
652. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
653. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
654. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
655. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
656. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
657. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
658. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
659. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
660. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
661. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
662. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
663. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
664. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
665. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
666. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
667. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
668. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
669. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
670. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
671. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
672. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
673. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
674. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
675. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
676. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
677. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
678. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
679. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
680. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
681. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
682. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
683. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
684. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
685. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
686. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
687. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
688. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
689. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
690. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
691. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
692. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
693. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
694. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
695. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
696. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
697. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
698. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
699. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
700. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
701. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
702. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
703. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
704. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
705. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
706. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
707. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
708. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
709. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
710. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
711. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
712. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
713. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
714. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
715. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
716. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
717. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
718. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
719. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
720. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
721. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
722. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
723. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
724. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
725. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
726. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
727. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
728. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
729. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
730. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
731. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
732. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
733. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
734. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
735. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
736. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
737. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
738. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
739. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
740. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
741. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
742. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
743. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
744. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
745. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
746. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
747. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
748. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
749. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
750. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
751. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
752. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
753. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
754. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
755. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
756. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
757. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
758. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
759. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
760. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
761. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
762. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
763. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
764. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
765. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
766. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
767. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
768. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
769. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
770. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
771. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
772. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
773. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
774. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
775. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
776. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
777. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
778. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
779. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
780. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
781. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
782. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
783. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
784. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
785. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
786. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
787. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
788. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
789. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
790. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
791. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
792. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
793. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
794. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
795. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
796. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
797. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
798. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
799. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
800. gbgen.idx - Index of the entries according to gene symbols.
801. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
802. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
803. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
804. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
805. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
806. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
807. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
808. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
809. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
810. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
811. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
812. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
813. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
814. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
815. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
816. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
817. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
818. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
819. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
820. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
821. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
822. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
823. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
824. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
825. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
826. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
827. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
828. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
829. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
830. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
831. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
832. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
833. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
834. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
835. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
836. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
837. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
838. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
839. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
840. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
841. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
842. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
843. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
844. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
845. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
846. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
847. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
848. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
849. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
850. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
851. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
852. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
853. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
854. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
855. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
856. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
857. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
858. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
859. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
860. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
861. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
862. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
863. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
864. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
865. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
866. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
867. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
868. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
869. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
870. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
871. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
872. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
873. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
874. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
875. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
876. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
877. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
878. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
879. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
880. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
881. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
882. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
883. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
884. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
885. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
886. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
887. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
888. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
889. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
890. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
891. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
892. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
893. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
894. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
895. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
896. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
897. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
898. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
899. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
900. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
901. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
902. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
903. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
904. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
905. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
906. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
907. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
908. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
909. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
910. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
911. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
912. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
913. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
914. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
915. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
916. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
917. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
918. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
919. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
920. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
921. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
922. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
923. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
924. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
925. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
926. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
927. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
928. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
929. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
930. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
931. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
932. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
933. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
934. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
935. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
936. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
937. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
938. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
939. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
940. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
941. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
942. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
943. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
944. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
945. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
946. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
947. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
948. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
949. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
950. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
951. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
952. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
953. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
954. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
955. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
956. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
957. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
958. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
959. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
960. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
961. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
962. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
963. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
964. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
965. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
966. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
967. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
968. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
969. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
970. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
971. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
972. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
973. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
974. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
975. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
976. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
977. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
978. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
979. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
980. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
981. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
982. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
983. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
984. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
985. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
986. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
987. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
988. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
989. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
990. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
991. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
992. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
993. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
994. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
995. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
996. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
997. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
998. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
999. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1000. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1001. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1002. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1003. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1004. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1005. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1006. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1007. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1008. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1009. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1010. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1011. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1012. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1013. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1014. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1015. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1016. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1017. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1018. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1019. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1020. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1021. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1022. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1023. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1024. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1025. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1026. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1027. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1028. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1029. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1030. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1031. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1032. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1033. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1034. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1035. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1036. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1037. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1038. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1039. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1040. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1041. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1042. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1043. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1044. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1045. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1046. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1047. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1048. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1049. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1050. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1051. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1052. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1053. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1054. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1055. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1056. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1057. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1058. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1059. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1060. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1061. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1062. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1063. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1064. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1065. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1066. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1067. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1068. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1069. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1070. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1071. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1072. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1073. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1074. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1075. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1076. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1077. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1078. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1079. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1080. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1081. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1082. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1083. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1084. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1085. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1086. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1087. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1088. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1089. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1090. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1091. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1092. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1093. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1094. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1095. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1096. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1097. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1098. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1099. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1100. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1101. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1102. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1103. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1104. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1105. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1106. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1107. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1108. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1109. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1110. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1111. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1112. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1113. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1114. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1115. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1116. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1117. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1118. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1119. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1120. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1121. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1122. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1123. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1124. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1125. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1126. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1127. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1128. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1129. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1130. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1131. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1132. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1133. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1134. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1135. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1136. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1137. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1138. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1139. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1140. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1141. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1142. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1143. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1144. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1145. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1146. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1147. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1148. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1149. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1150. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1151. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1152. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1153. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1154. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1155. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1156. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1157. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1158. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1159. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1160. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1161. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1162. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1163. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1164. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1165. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1166. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1167. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1168. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1169. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1170. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1171. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1172. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1173. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1174. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1175. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1176. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1177. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1178. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1179. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1180. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1181. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1182. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1183. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1184. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1185. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1186. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1187. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1188. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1189. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1190. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1191. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1192. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1193. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1194. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1195. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1196. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1197. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1198. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1199. gbinv1.seq - Invertebrate sequence entries, part 1.
1200. gbinv10.seq - Invertebrate sequence entries, part 10.
1201. gbinv11.seq - Invertebrate sequence entries, part 11.
1202. gbinv12.seq - Invertebrate sequence entries, part 12.
1203. gbinv13.seq - Invertebrate sequence entries, part 13.
1204. gbinv14.seq - Invertebrate sequence entries, part 14.
1205. gbinv15.seq - Invertebrate sequence entries, part 15.
1206. gbinv16.seq - Invertebrate sequence entries, part 16.
1207. gbinv17.seq - Invertebrate sequence entries, part 17.
1208. gbinv18.seq - Invertebrate sequence entries, part 18.
1209. gbinv19.seq - Invertebrate sequence entries, part 19.
1210. gbinv2.seq - Invertebrate sequence entries, part 2.
1211. gbinv20.seq - Invertebrate sequence entries, part 20.
1212. gbinv21.seq - Invertebrate sequence entries, part 21.
1213. gbinv22.seq - Invertebrate sequence entries, part 22.
1214. gbinv23.seq - Invertebrate sequence entries, part 23.
1215. gbinv24.seq - Invertebrate sequence entries, part 24.
1216. gbinv25.seq - Invertebrate sequence entries, part 25.
1217. gbinv26.seq - Invertebrate sequence entries, part 26.
1218. gbinv27.seq - Invertebrate sequence entries, part 27.
1219. gbinv28.seq - Invertebrate sequence entries, part 28.
1220. gbinv29.seq - Invertebrate sequence entries, part 29.
1221. gbinv3.seq - Invertebrate sequence entries, part 3.
1222. gbinv30.seq - Invertebrate sequence entries, part 30.
1223. gbinv4.seq - Invertebrate sequence entries, part 4.
1224. gbinv5.seq - Invertebrate sequence entries, part 5.
1225. gbinv6.seq - Invertebrate sequence entries, part 6.
1226. gbinv7.seq - Invertebrate sequence entries, part 7.
1227. gbinv8.seq - Invertebrate sequence entries, part 8.
1228. gbinv9.seq - Invertebrate sequence entries, part 9.
1229. gbjou1.idx - Index of the entries according to journal citation, part 1.
1230. gbjou10.idx - Index of the entries according to journal citation, part 10.
1231. gbjou11.idx - Index of the entries according to journal citation, part 11.
1232. gbjou12.idx - Index of the entries according to journal citation, part 12.
1233. gbjou2.idx - Index of the entries according to journal citation, part 2.
1234. gbjou3.idx - Index of the entries according to journal citation, part 3.
1235. gbjou4.idx - Index of the entries according to journal citation, part 4.
1236. gbjou5.idx - Index of the entries according to journal citation, part 5.
1237. gbjou6.idx - Index of the entries according to journal citation, part 6.
1238. gbjou7.idx - Index of the entries according to journal citation, part 7.
1239. gbjou8.idx - Index of the entries according to journal citation, part 8.
1240. gbjou9.idx - Index of the entries according to journal citation, part 9.
1241. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1242. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1243. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1244. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1245. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1246. gbmam1.seq - Other mammalian sequence entries, part 1.
1247. gbmam2.seq - Other mammalian sequence entries, part 2.
1248. gbmam3.seq - Other mammalian sequence entries, part 3.
1249. gbmam4.seq - Other mammalian sequence entries, part 4.
1250. gbmam5.seq - Other mammalian sequence entries, part 5.
1251. gbmam6.seq - Other mammalian sequence entries, part 6.
1252. gbmam7.seq - Other mammalian sequence entries, part 7.
1253. gbnew.txt - Accession numbers of entries new since the previous release.
1254. gbpat1.seq - Patent sequence entries, part 1.
1255. gbpat10.seq - Patent sequence entries, part 10.
1256. gbpat100.seq - Patent sequence entries, part 100.
1257. gbpat101.seq - Patent sequence entries, part 101.
1258. gbpat102.seq - Patent sequence entries, part 102.
1259. gbpat103.seq - Patent sequence entries, part 103.
1260. gbpat104.seq - Patent sequence entries, part 104.
1261. gbpat105.seq - Patent sequence entries, part 105.
1262. gbpat106.seq - Patent sequence entries, part 106.
1263. gbpat107.seq - Patent sequence entries, part 107.
1264. gbpat108.seq - Patent sequence entries, part 108.
1265. gbpat109.seq - Patent sequence entries, part 109.
1266. gbpat11.seq - Patent sequence entries, part 11.
1267. gbpat110.seq - Patent sequence entries, part 110.
1268. gbpat111.seq - Patent sequence entries, part 111.
1269. gbpat112.seq - Patent sequence entries, part 112.
1270. gbpat113.seq - Patent sequence entries, part 113.
1271. gbpat114.seq - Patent sequence entries, part 114.
1272. gbpat115.seq - Patent sequence entries, part 115.
1273. gbpat116.seq - Patent sequence entries, part 116.
1274. gbpat117.seq - Patent sequence entries, part 117.
1275. gbpat118.seq - Patent sequence entries, part 118.
1276. gbpat119.seq - Patent sequence entries, part 119.
1277. gbpat12.seq - Patent sequence entries, part 12.
1278. gbpat120.seq - Patent sequence entries, part 120.
1279. gbpat121.seq - Patent sequence entries, part 121.
1280. gbpat122.seq - Patent sequence entries, part 122.
1281. gbpat123.seq - Patent sequence entries, part 123.
1282. gbpat124.seq - Patent sequence entries, part 124.
1283. gbpat125.seq - Patent sequence entries, part 125.
1284. gbpat126.seq - Patent sequence entries, part 126.
1285. gbpat127.seq - Patent sequence entries, part 127.
1286. gbpat128.seq - Patent sequence entries, part 128.
1287. gbpat129.seq - Patent sequence entries, part 129.
1288. gbpat13.seq - Patent sequence entries, part 13.
1289. gbpat130.seq - Patent sequence entries, part 130.
1290. gbpat131.seq - Patent sequence entries, part 131.
1291. gbpat132.seq - Patent sequence entries, part 132.
1292. gbpat133.seq - Patent sequence entries, part 133.
1293. gbpat134.seq - Patent sequence entries, part 134.
1294. gbpat135.seq - Patent sequence entries, part 135.
1295. gbpat136.seq - Patent sequence entries, part 136.
1296. gbpat137.seq - Patent sequence entries, part 137.
1297. gbpat138.seq - Patent sequence entries, part 138.
1298. gbpat139.seq - Patent sequence entries, part 139.
1299. gbpat14.seq - Patent sequence entries, part 14.
1300. gbpat140.seq - Patent sequence entries, part 140.
1301. gbpat141.seq - Patent sequence entries, part 141.
1302. gbpat142.seq - Patent sequence entries, part 142.
1303. gbpat143.seq - Patent sequence entries, part 143.
1304. gbpat144.seq - Patent sequence entries, part 144.
1305. gbpat145.seq - Patent sequence entries, part 145.
1306. gbpat146.seq - Patent sequence entries, part 146.
1307. gbpat147.seq - Patent sequence entries, part 147.
1308. gbpat148.seq - Patent sequence entries, part 148.
1309. gbpat149.seq - Patent sequence entries, part 149.
1310. gbpat15.seq - Patent sequence entries, part 15.
1311. gbpat150.seq - Patent sequence entries, part 150.
1312. gbpat151.seq - Patent sequence entries, part 151.
1313. gbpat152.seq - Patent sequence entries, part 152.
1314. gbpat153.seq - Patent sequence entries, part 153.
1315. gbpat154.seq - Patent sequence entries, part 154.
1316. gbpat155.seq - Patent sequence entries, part 155.
1317. gbpat156.seq - Patent sequence entries, part 156.
1318. gbpat157.seq - Patent sequence entries, part 157.
1319. gbpat158.seq - Patent sequence entries, part 158.
1320. gbpat159.seq - Patent sequence entries, part 159.
1321. gbpat16.seq - Patent sequence entries, part 16.
1322. gbpat160.seq - Patent sequence entries, part 160.
1323. gbpat161.seq - Patent sequence entries, part 161.
1324. gbpat162.seq - Patent sequence entries, part 162.
1325. gbpat163.seq - Patent sequence entries, part 163.
1326. gbpat164.seq - Patent sequence entries, part 164.
1327. gbpat17.seq - Patent sequence entries, part 17.
1328. gbpat18.seq - Patent sequence entries, part 18.
1329. gbpat19.seq - Patent sequence entries, part 19.
1330. gbpat2.seq - Patent sequence entries, part 2.
1331. gbpat20.seq - Patent sequence entries, part 20.
1332. gbpat21.seq - Patent sequence entries, part 21.
1333. gbpat22.seq - Patent sequence entries, part 22.
1334. gbpat23.seq - Patent sequence entries, part 23.
1335. gbpat24.seq - Patent sequence entries, part 24.
1336. gbpat25.seq - Patent sequence entries, part 25.
1337. gbpat26.seq - Patent sequence entries, part 26.
1338. gbpat27.seq - Patent sequence entries, part 27.
1339. gbpat28.seq - Patent sequence entries, part 28.
1340. gbpat29.seq - Patent sequence entries, part 29.
1341. gbpat3.seq - Patent sequence entries, part 3.
1342. gbpat30.seq - Patent sequence entries, part 30.
1343. gbpat31.seq - Patent sequence entries, part 31.
1344. gbpat32.seq - Patent sequence entries, part 32.
1345. gbpat33.seq - Patent sequence entries, part 33.
1346. gbpat34.seq - Patent sequence entries, part 34.
1347. gbpat35.seq - Patent sequence entries, part 35.
1348. gbpat36.seq - Patent sequence entries, part 36.
1349. gbpat37.seq - Patent sequence entries, part 37.
1350. gbpat38.seq - Patent sequence entries, part 38.
1351. gbpat39.seq - Patent sequence entries, part 39.
1352. gbpat4.seq - Patent sequence entries, part 4.
1353. gbpat40.seq - Patent sequence entries, part 40.
1354. gbpat41.seq - Patent sequence entries, part 41.
1355. gbpat42.seq - Patent sequence entries, part 42.
1356. gbpat43.seq - Patent sequence entries, part 43.
1357. gbpat44.seq - Patent sequence entries, part 44.
1358. gbpat45.seq - Patent sequence entries, part 45.
1359. gbpat46.seq - Patent sequence entries, part 46.
1360. gbpat47.seq - Patent sequence entries, part 47.
1361. gbpat48.seq - Patent sequence entries, part 48.
1362. gbpat49.seq - Patent sequence entries, part 49.
1363. gbpat5.seq - Patent sequence entries, part 5.
1364. gbpat50.seq - Patent sequence entries, part 50.
1365. gbpat51.seq - Patent sequence entries, part 51.
1366. gbpat52.seq - Patent sequence entries, part 52.
1367. gbpat53.seq - Patent sequence entries, part 53.
1368. gbpat54.seq - Patent sequence entries, part 54.
1369. gbpat55.seq - Patent sequence entries, part 55.
1370. gbpat56.seq - Patent sequence entries, part 56.
1371. gbpat57.seq - Patent sequence entries, part 57.
1372. gbpat58.seq - Patent sequence entries, part 58.
1373. gbpat59.seq - Patent sequence entries, part 59.
1374. gbpat6.seq - Patent sequence entries, part 6.
1375. gbpat60.seq - Patent sequence entries, part 60.
1376. gbpat61.seq - Patent sequence entries, part 61.
1377. gbpat62.seq - Patent sequence entries, part 62.
1378. gbpat63.seq - Patent sequence entries, part 63.
1379. gbpat64.seq - Patent sequence entries, part 64.
1380. gbpat65.seq - Patent sequence entries, part 65.
1381. gbpat66.seq - Patent sequence entries, part 66.
1382. gbpat67.seq - Patent sequence entries, part 67.
1383. gbpat68.seq - Patent sequence entries, part 68.
1384. gbpat69.seq - Patent sequence entries, part 69.
1385. gbpat7.seq - Patent sequence entries, part 7.
1386. gbpat70.seq - Patent sequence entries, part 70.
1387. gbpat71.seq - Patent sequence entries, part 71.
1388. gbpat72.seq - Patent sequence entries, part 72.
1389. gbpat73.seq - Patent sequence entries, part 73.
1390. gbpat74.seq - Patent sequence entries, part 74.
1391. gbpat75.seq - Patent sequence entries, part 75.
1392. gbpat76.seq - Patent sequence entries, part 76.
1393. gbpat77.seq - Patent sequence entries, part 77.
1394. gbpat78.seq - Patent sequence entries, part 78.
1395. gbpat79.seq - Patent sequence entries, part 79.
1396. gbpat8.seq - Patent sequence entries, part 8.
1397. gbpat80.seq - Patent sequence entries, part 80.
1398. gbpat81.seq - Patent sequence entries, part 81.
1399. gbpat82.seq - Patent sequence entries, part 82.
1400. gbpat83.seq - Patent sequence entries, part 83.
1401. gbpat84.seq - Patent sequence entries, part 84.
1402. gbpat85.seq - Patent sequence entries, part 85.
1403. gbpat86.seq - Patent sequence entries, part 86.
1404. gbpat87.seq - Patent sequence entries, part 87.
1405. gbpat88.seq - Patent sequence entries, part 88.
1406. gbpat89.seq - Patent sequence entries, part 89.
1407. gbpat9.seq - Patent sequence entries, part 9.
1408. gbpat90.seq - Patent sequence entries, part 90.
1409. gbpat91.seq - Patent sequence entries, part 91.
1410. gbpat92.seq - Patent sequence entries, part 92.
1411. gbpat93.seq - Patent sequence entries, part 93.
1412. gbpat94.seq - Patent sequence entries, part 94.
1413. gbpat95.seq - Patent sequence entries, part 95.
1414. gbpat96.seq - Patent sequence entries, part 96.
1415. gbpat97.seq - Patent sequence entries, part 97.
1416. gbpat98.seq - Patent sequence entries, part 98.
1417. gbpat99.seq - Patent sequence entries, part 99.
1418. gbphg1.seq - Phage sequence entries, part 1.
1419. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1420. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1421. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1422. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1423. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1424. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1425. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1426. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1427. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1428. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1429. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1430. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1431. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1432. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1433. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1434. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1435. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1436. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1437. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1438. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1439. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1440. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1441. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1442. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1443. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1444. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1445. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1446. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1447. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1448. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1449. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1450. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1451. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1452. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1453. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1454. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1455. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1456. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1457. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1458. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1459. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1460. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1461. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1462. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1463. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1464. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1465. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1466. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1467. gbpri1.seq - Primate sequence entries, part 1.
1468. gbpri10.seq - Primate sequence entries, part 10.
1469. gbpri11.seq - Primate sequence entries, part 11.
1470. gbpri12.seq - Primate sequence entries, part 12.
1471. gbpri13.seq - Primate sequence entries, part 13.
1472. gbpri14.seq - Primate sequence entries, part 14.
1473. gbpri15.seq - Primate sequence entries, part 15.
1474. gbpri16.seq - Primate sequence entries, part 16.
1475. gbpri17.seq - Primate sequence entries, part 17.
1476. gbpri18.seq - Primate sequence entries, part 18.
1477. gbpri19.seq - Primate sequence entries, part 19.
1478. gbpri2.seq - Primate sequence entries, part 2.
1479. gbpri20.seq - Primate sequence entries, part 20.
1480. gbpri21.seq - Primate sequence entries, part 21.
1481. gbpri22.seq - Primate sequence entries, part 22.
1482. gbpri23.seq - Primate sequence entries, part 23.
1483. gbpri24.seq - Primate sequence entries, part 24.
1484. gbpri25.seq - Primate sequence entries, part 25.
1485. gbpri26.seq - Primate sequence entries, part 26.
1486. gbpri27.seq - Primate sequence entries, part 27.
1487. gbpri28.seq - Primate sequence entries, part 28.
1488. gbpri29.seq - Primate sequence entries, part 29.
1489. gbpri3.seq - Primate sequence entries, part 3.
1490. gbpri30.seq - Primate sequence entries, part 30.
1491. gbpri31.seq - Primate sequence entries, part 31.
1492. gbpri32.seq - Primate sequence entries, part 32.
1493. gbpri33.seq - Primate sequence entries, part 33.
1494. gbpri34.seq - Primate sequence entries, part 34.
1495. gbpri35.seq - Primate sequence entries, part 35.
1496. gbpri36.seq - Primate sequence entries, part 36.
1497. gbpri37.seq - Primate sequence entries, part 37.
1498. gbpri38.seq - Primate sequence entries, part 38.
1499. gbpri39.seq - Primate sequence entries, part 39.
1500. gbpri4.seq - Primate sequence entries, part 4.
1501. gbpri40.seq - Primate sequence entries, part 40.
1502. gbpri41.seq - Primate sequence entries, part 41.
1503. gbpri42.seq - Primate sequence entries, part 42.
1504. gbpri5.seq - Primate sequence entries, part 5.
1505. gbpri6.seq - Primate sequence entries, part 6.
1506. gbpri7.seq - Primate sequence entries, part 7.
1507. gbpri8.seq - Primate sequence entries, part 8.
1508. gbpri9.seq - Primate sequence entries, part 9.
1509. gbrel.txt - Release notes (this document).
1510. gbrod1.seq - Rodent sequence entries, part 1.
1511. gbrod10.seq - Rodent sequence entries, part 10.
1512. gbrod11.seq - Rodent sequence entries, part 11.
1513. gbrod12.seq - Rodent sequence entries, part 12.
1514. gbrod13.seq - Rodent sequence entries, part 13.
1515. gbrod14.seq - Rodent sequence entries, part 14.
1516. gbrod15.seq - Rodent sequence entries, part 15.
1517. gbrod16.seq - Rodent sequence entries, part 16.
1518. gbrod17.seq - Rodent sequence entries, part 17.
1519. gbrod18.seq - Rodent sequence entries, part 18.
1520. gbrod19.seq - Rodent sequence entries, part 19.
1521. gbrod2.seq - Rodent sequence entries, part 2.
1522. gbrod20.seq - Rodent sequence entries, part 20.
1523. gbrod21.seq - Rodent sequence entries, part 21.
1524. gbrod22.seq - Rodent sequence entries, part 22.
1525. gbrod23.seq - Rodent sequence entries, part 23.
1526. gbrod24.seq - Rodent sequence entries, part 24.
1527. gbrod25.seq - Rodent sequence entries, part 25.
1528. gbrod26.seq - Rodent sequence entries, part 26.
1529. gbrod27.seq - Rodent sequence entries, part 27.
1530. gbrod28.seq - Rodent sequence entries, part 28.
1531. gbrod29.seq - Rodent sequence entries, part 29.
1532. gbrod3.seq - Rodent sequence entries, part 3.
1533. gbrod4.seq - Rodent sequence entries, part 4.
1534. gbrod5.seq - Rodent sequence entries, part 5.
1535. gbrod6.seq - Rodent sequence entries, part 6.
1536. gbrod7.seq - Rodent sequence entries, part 7.
1537. gbrod8.seq - Rodent sequence entries, part 8.
1538. gbrod9.seq - Rodent sequence entries, part 9.
1539. gbsdr1.txt - Short directory of the data bank, part 1.
1540. gbsdr2.txt - Short directory of the data bank, part 2.
1541. gbsdr3.txt - Short directory of the data bank, part 3.
1542. gbsec.idx - Index of the entries according to secondary accession number.
1543. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1544. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1545. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1546. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1547. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1548. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1549. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1550. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1551. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1552. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1553. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1554. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1555. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1556. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1557. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1558. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1559. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1560. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1561. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1562. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1563. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1564. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1565. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1566. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1567. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1568. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1569. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1570. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1571. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1572. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1573. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1574. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1575. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1576. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1577. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1578. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1579. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1580. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1581. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1582. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1583. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1584. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1585. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1586. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1587. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1588. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1589. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1590. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1591. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1592. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1593. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1594. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1595. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1596. gbuna1.seq - Unannotated sequence entries, part 1.
1597. gbvrl1.seq - Viral sequence entries, part 1.
1598. gbvrl10.seq - Viral sequence entries, part 10.
1599. gbvrl11.seq - Viral sequence entries, part 11.
1600. gbvrl12.seq - Viral sequence entries, part 12.
1601. gbvrl13.seq - Viral sequence entries, part 13.
1602. gbvrl14.seq - Viral sequence entries, part 14.
1603. gbvrl15.seq - Viral sequence entries, part 15.
1604. gbvrl16.seq - Viral sequence entries, part 16.
1605. gbvrl17.seq - Viral sequence entries, part 17.
1606. gbvrl18.seq - Viral sequence entries, part 18.
1607. gbvrl2.seq - Viral sequence entries, part 2.
1608. gbvrl3.seq - Viral sequence entries, part 3.
1609. gbvrl4.seq - Viral sequence entries, part 4.
1610. gbvrl5.seq - Viral sequence entries, part 5.
1611. gbvrl6.seq - Viral sequence entries, part 6.
1612. gbvrl7.seq - Viral sequence entries, part 7.
1613. gbvrl8.seq - Viral sequence entries, part 8.
1614. gbvrl9.seq - Viral sequence entries, part 9.
1615. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1616. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1617. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1618. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1619. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1620. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1621. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1622. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1623. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1624. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1625. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1626. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1627. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1628. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1629. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1630. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1631. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1632. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1633. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1634. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1635. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1636. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1637. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1638. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 184.0 flatfiles require roughly 506 GB (sequence
files only) or 543 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1744585798     gbacc1.idx
2305583775     gbacc2.idx
 793808175     gbacc3.idx
 184373159     gbaut1.idx
 184525575     gbaut10.idx
 228396590     gbaut11.idx
 183776782     gbaut12.idx
 185229802     gbaut13.idx
 183753662     gbaut14.idx
 196420235     gbaut15.idx
 239591371     gbaut16.idx
 183679887     gbaut17.idx
 235561927     gbaut18.idx
 183777852     gbaut19.idx
 215028881     gbaut2.idx
 188226875     gbaut20.idx
 249272155     gbaut21.idx
 210753027     gbaut22.idx
 184256904     gbaut23.idx
 209942860     gbaut24.idx
 183885531     gbaut25.idx
 187104119     gbaut26.idx
 184141290     gbaut27.idx
 184127620     gbaut28.idx
 184221514     gbaut29.idx
 208006023     gbaut3.idx
 183837398     gbaut30.idx
 189760007     gbaut31.idx
 185903720     gbaut32.idx
 185549787     gbaut33.idx
 241909374     gbaut34.idx
 185069539     gbaut35.idx
 210393203     gbaut36.idx
 185787981     gbaut37.idx
 185522868     gbaut38.idx
 184116366     gbaut39.idx
 183932287     gbaut4.idx
 197890955     gbaut40.idx
 196441218     gbaut41.idx
 184675043     gbaut42.idx
 185520617     gbaut43.idx
 185324316     gbaut44.idx
 184195507     gbaut45.idx
 245503486     gbaut46.idx
 209535984     gbaut47.idx
 188245912     gbaut48.idx
 219285229     gbaut49.idx
 199782531     gbaut5.idx
 184193058     gbaut50.idx
 187205705     gbaut51.idx
 192287700     gbaut52.idx
 185860218     gbaut53.idx
 205547020     gbaut54.idx
 184086175     gbaut55.idx
 185104779     gbaut56.idx
 184065939     gbaut57.idx
 184710298     gbaut58.idx
 183820420     gbaut59.idx
 188416935     gbaut6.idx
 184465849     gbaut60.idx
 189526462     gbaut61.idx
 255533694     gbaut62.idx
 184927794     gbaut63.idx
 183831045     gbaut64.idx
 201868105     gbaut65.idx
 184162734     gbaut66.idx
 185560065     gbaut67.idx
 183778703     gbaut68.idx
 219245755     gbaut69.idx
 183938906     gbaut7.idx
 217081533     gbaut70.idx
 211291998     gbaut71.idx
 183857052     gbaut72.idx
 185549647     gbaut73.idx
 183976985     gbaut74.idx
 183964236     gbaut75.idx
 194758704     gbaut76.idx
 183739413     gbaut77.idx
 210945311     gbaut78.idx
 196031235     gbaut79.idx
 185585482     gbaut8.idx
 197217280     gbaut80.idx
 245223968     gbaut81.idx
 186000546     gbaut82.idx
 184009548     gbaut83.idx
 183787831     gbaut84.idx
 185378662     gbaut85.idx
 184575339     gbaut86.idx
 189509006     gbaut87.idx
 103022657     gbaut88.idx
 184069411     gbaut9.idx
 244435676     gbbct1.seq
 249634003     gbbct10.seq
 245177103     gbbct11.seq
 213157070     gbbct12.seq
 243124731     gbbct13.seq
 249864964     gbbct14.seq
 245549914     gbbct15.seq
 248696898     gbbct16.seq
 247986940     gbbct17.seq
 249284896     gbbct18.seq
 247284383     gbbct19.seq
 248910307     gbbct2.seq
 239678256     gbbct20.seq
 217808759     gbbct21.seq
 242806493     gbbct22.seq
 241491847     gbbct23.seq
 248678554     gbbct24.seq
 247892628     gbbct25.seq
 249390239     gbbct26.seq
 244188289     gbbct27.seq
 247135774     gbbct28.seq
 249999671     gbbct29.seq
 249285281     gbbct3.seq
 249760572     gbbct30.seq
 249791977     gbbct31.seq
 242939806     gbbct32.seq
 243142050     gbbct33.seq
 149253431     gbbct34.seq
 243879336     gbbct35.seq
 246112207     gbbct36.seq
 246758272     gbbct37.seq
 244987919     gbbct38.seq
 247971314     gbbct39.seq
 249960430     gbbct4.seq
 249448502     gbbct40.seq
 244563567     gbbct41.seq
 245404165     gbbct42.seq
 249009345     gbbct43.seq
 248344094     gbbct44.seq
 233311074     gbbct45.seq
  42209814     gbbct46.seq
 245564828     gbbct47.seq
 239384024     gbbct48.seq
 247999958     gbbct49.seq
 165629355     gbbct5.seq
 247353060     gbbct50.seq
 248649010     gbbct51.seq
 231242719     gbbct52.seq
 245388315     gbbct53.seq
 243082648     gbbct54.seq
 247320412     gbbct55.seq
 242484526     gbbct56.seq
   6881041     gbbct57.seq
  14090959     gbbct58.seq
  23156612     gbbct59.seq
 242131627     gbbct6.seq
  45089017     gbbct60.seq
  87756290     gbbct61.seq
 169947444     gbbct62.seq
 250000166     gbbct63.seq
 249998743     gbbct64.seq
 247817902     gbbct65.seq
 249165800     gbbct66.seq
 247988089     gbbct67.seq
 247693790     gbbct68.seq
 249999904     gbbct69.seq
 247969547     gbbct7.seq
 249998410     gbbct70.seq
 250000246     gbbct71.seq
 219910865     gbbct72.seq
 248625850     gbbct8.seq
 241464028     gbbct9.seq
  39773770     gbchg.txt
 249999249     gbcon1.seq
 249996514     gbcon10.seq
 249995660     gbcon100.seq
 249998605     gbcon101.seq
 249998936     gbcon102.seq
 250000223     gbcon103.seq
 156342446     gbcon104.seq
 249996812     gbcon105.seq
 249993767     gbcon106.seq
 249992301     gbcon107.seq
 249998322     gbcon108.seq
  71615782     gbcon109.seq
 249998969     gbcon11.seq
 249997862     gbcon110.seq
 249998650     gbcon111.seq
 208522809     gbcon112.seq
 250000256     gbcon113.seq
 250000098     gbcon114.seq
 249995503     gbcon115.seq
 249706533     gbcon116.seq
 163127783     gbcon117.seq
 249779275     gbcon118.seq
 249998717     gbcon119.seq
 248683455     gbcon12.seq
 105265679     gbcon120.seq
 249997002     gbcon121.seq
 249998975     gbcon122.seq
 249999596     gbcon123.seq
 249668049     gbcon124.seq
  26282865     gbcon125.seq
 249999604     gbcon126.seq
 249838518     gbcon127.seq
 249924254     gbcon128.seq
 249999929     gbcon129.seq
 247344551     gbcon13.seq
 249998814     gbcon130.seq
 218016237     gbcon131.seq
 249999839     gbcon132.seq
 249985338     gbcon133.seq
 249819716     gbcon134.seq
 249993762     gbcon135.seq
 249999846     gbcon136.seq
 248313325     gbcon137.seq
 250000042     gbcon138.seq
 249556201     gbcon139.seq
 249998806     gbcon14.seq
 103932155     gbcon140.seq
 249184635     gbcon141.seq
 249999310     gbcon142.seq
 249999305     gbcon143.seq
 249990998     gbcon144.seq
 249997627     gbcon145.seq
 249995212     gbcon146.seq
 249987113     gbcon147.seq
 158061339     gbcon148.seq
  21084201     gbcon149.seq
  60349545     gbcon15.seq
 249821933     gbcon16.seq
 249996499     gbcon17.seq
 155322820     gbcon18.seq
 250000142     gbcon19.seq
 248150040     gbcon2.seq
 248022413     gbcon20.seq
 122899685     gbcon21.seq
 249998506     gbcon22.seq
 120044016     gbcon23.seq
 249996870     gbcon24.seq
 249774546     gbcon25.seq
 249999078     gbcon26.seq
 249996506     gbcon27.seq
 201045147     gbcon28.seq
 249999800     gbcon29.seq
 249834404     gbcon3.seq
 249997309     gbcon30.seq
 249999857     gbcon31.seq
 249999952     gbcon32.seq
 247968337     gbcon33.seq
 234568834     gbcon34.seq
 249999237     gbcon35.seq
 249996869     gbcon36.seq
 249995921     gbcon37.seq
 249996351     gbcon38.seq
 249999450     gbcon39.seq
 249977151     gbcon4.seq
 249997210     gbcon40.seq
  61183731     gbcon41.seq
 249997486     gbcon42.seq
 249994070     gbcon43.seq
 249999391     gbcon44.seq
 249997743     gbcon45.seq
 249994859     gbcon46.seq
  43089049     gbcon47.seq
 249993995     gbcon48.seq
 249996310     gbcon49.seq
 249993232     gbcon5.seq
 249994442     gbcon50.seq
 249997248     gbcon51.seq
 250000078     gbcon52.seq
  36404971     gbcon53.seq
 249993185     gbcon54.seq
 249998119     gbcon55.seq
 249995170     gbcon56.seq
 249998154     gbcon57.seq
 249998078     gbcon58.seq
 152679523     gbcon59.seq
 249991519     gbcon6.seq
 249999955     gbcon60.seq
 249999066     gbcon61.seq
 249997558     gbcon62.seq
 249998625     gbcon63.seq
 183609322     gbcon64.seq
 249999870     gbcon65.seq
 249997967     gbcon66.seq
 249997138     gbcon67.seq
 249995207     gbcon68.seq
 245488804     gbcon69.seq
 249996976     gbcon7.seq
 250000182     gbcon70.seq
 249998695     gbcon71.seq
 249998372     gbcon72.seq
 249996966     gbcon73.seq
 250000007     gbcon74.seq
  96627683     gbcon75.seq
 249993448     gbcon76.seq
 249995119     gbcon77.seq
 249997383     gbcon78.seq
 249995948     gbcon79.seq
   1609283     gbcon8.seq
 249999042     gbcon80.seq
  62682749     gbcon81.seq
 249997771     gbcon82.seq
 249996653     gbcon83.seq
 249999445     gbcon84.seq
 249999590     gbcon85.seq
 249998149     gbcon86.seq
  21674116     gbcon87.seq
 249998140     gbcon88.seq
 249997503     gbcon89.seq
 249997708     gbcon9.seq
 249996940     gbcon90.seq
 249995720     gbcon91.seq
 197881888     gbcon92.seq
 249993974     gbcon93.seq
 249996060     gbcon94.seq
 249999726     gbcon95.seq
 249998645     gbcon96.seq
 249996901     gbcon97.seq
 133265984     gbcon98.seq
 249994222     gbcon99.seq
   1962170     gbdel.txt
 249999877     gbenv1.seq
 249999127     gbenv10.seq
  52921709     gbenv11.seq
 249999384     gbenv12.seq
 249999044     gbenv13.seq
 249998276     gbenv14.seq
 249998107     gbenv15.seq
 249999400     gbenv16.seq
 249996627     gbenv17.seq
 224401793     gbenv18.seq
 249999614     gbenv19.seq
 249998771     gbenv2.seq
 250000199     gbenv20.seq
 250000225     gbenv21.seq
 250000001     gbenv22.seq
 126816814     gbenv23.seq
 249999737     gbenv24.seq
 249999544     gbenv25.seq
 249998971     gbenv26.seq
 249999094     gbenv27.seq
 249999469     gbenv28.seq
  77124601     gbenv29.seq
 249997481     gbenv3.seq
 249998069     gbenv30.seq
 249995998     gbenv31.seq
 249998733     gbenv32.seq
 249998623     gbenv33.seq
 114090066     gbenv34.seq
 249999257     gbenv35.seq
 249998393     gbenv36.seq
 249999509     gbenv37.seq
 249999375     gbenv38.seq
 249998190     gbenv39.seq
 249998802     gbenv4.seq
 114712432     gbenv40.seq
 249999253     gbenv5.seq
 163362868     gbenv6.seq
 249998988     gbenv7.seq
 249997718     gbenv8.seq
 249999549     gbenv9.seq
 524292008     gbest1.seq
 524290121     gbest10.seq
 524289473     gbest100.seq
 524291194     gbest101.seq
 524290705     gbest102.seq
 524289530     gbest103.seq
 355895480     gbest104.seq
 524291053     gbest105.seq
 524290540     gbest106.seq
 497384462     gbest107.seq
 388467303     gbest108.seq
 387586957     gbest109.seq
 524289121     gbest11.seq
 383137103     gbest110.seq
 384254099     gbest111.seq
 384329608     gbest112.seq
 381682912     gbest113.seq
 391882873     gbest114.seq
 387827426     gbest115.seq
 386113420     gbest116.seq
 384277010     gbest117.seq
 411766482     gbest118.seq
 524289447     gbest119.seq
 524290795     gbest12.seq
 524288954     gbest120.seq
 524291702     gbest121.seq
 524289404     gbest122.seq
 524292066     gbest123.seq
 464355782     gbest124.seq
 524291080     gbest125.seq
 524291183     gbest126.seq
 524289144     gbest127.seq
 524289798     gbest128.seq
 524289466     gbest129.seq
 156673626     gbest13.seq
 524289858     gbest130.seq
 524290242     gbest131.seq
 524289918     gbest132.seq
 524291108     gbest133.seq
 524290031     gbest134.seq
 524290555     gbest135.seq
 524288939     gbest136.seq
 272993637     gbest137.seq
 524290385     gbest138.seq
 524289283     gbest139.seq
 524289575     gbest14.seq
 524289755     gbest140.seq
 524289462     gbest141.seq
 524291658     gbest142.seq
 524290434     gbest143.seq
 524290148     gbest144.seq
 524291996     gbest145.seq
 524291299     gbest146.seq
 524291451     gbest147.seq
 524290210     gbest148.seq
 524292180     gbest149.seq
 524289177     gbest15.seq
 524291181     gbest150.seq
 477418254     gbest151.seq
 524290283     gbest152.seq
 524289929     gbest153.seq
 524290844     gbest154.seq
 524289027     gbest155.seq
 524290690     gbest156.seq
 524289239     gbest157.seq
 524293077     gbest158.seq
 524288936     gbest159.seq
 524289434     gbest16.seq
 499451197     gbest160.seq
 524290756     gbest161.seq
 524290260     gbest162.seq
 524290335     gbest163.seq
 244185744     gbest164.seq
 524291229     gbest165.seq
 524289302     gbest166.seq
 524290366     gbest167.seq
 524290635     gbest168.seq
 524289065     gbest169.seq
 524290723     gbest17.seq
 524292896     gbest170.seq
 524289962     gbest171.seq
 524290257     gbest172.seq
 524291475     gbest173.seq
 524290335     gbest174.seq
 524291664     gbest175.seq
 524294404     gbest176.seq
 524288756     gbest177.seq
  99711849     gbest178.seq
 524290053     gbest179.seq
 524289098     gbest18.seq
 524289908     gbest180.seq
 524288820     gbest181.seq
 524289436     gbest182.seq
 524291717     gbest183.seq
 524289828     gbest184.seq
 524289839     gbest185.seq
 524290988     gbest186.seq
 524290587     gbest187.seq
 524292517     gbest188.seq
 524289364     gbest189.seq
 524291796     gbest19.seq
 524289357     gbest190.seq
 457287312     gbest191.seq
 524291908     gbest192.seq
 524294182     gbest193.seq
 524290912     gbest194.seq
 524288832     gbest195.seq
 524295936     gbest196.seq
 524290833     gbest197.seq
 524290429     gbest198.seq
 524289684     gbest199.seq
 524289694     gbest2.seq
 524288736     gbest20.seq
 524288861     gbest200.seq
 524290274     gbest201.seq
 524290882     gbest202.seq
 524290219     gbest203.seq
 524289680     gbest204.seq
  96657532     gbest205.seq
 524290582     gbest206.seq
 524289800     gbest207.seq
 524288898     gbest208.seq
 524289220     gbest209.seq
 524289255     gbest21.seq
 524289702     gbest210.seq
 524290395     gbest211.seq
 524288970     gbest212.seq
 524289238     gbest213.seq
 524289699     gbest214.seq
 524290025     gbest215.seq
 428858965     gbest216.seq
 524292312     gbest217.seq
 524290823     gbest218.seq
 524289581     gbest219.seq
 511752444     gbest22.seq
 524289362     gbest220.seq
 524291110     gbest221.seq
 524291469     gbest222.seq
 524291966     gbest223.seq
 524290001     gbest224.seq
 524290569     gbest225.seq
 524292431     gbest226.seq
 524291516     gbest227.seq
 524290556     gbest228.seq
 524289992     gbest229.seq
 500415838     gbest23.seq
 374816979     gbest230.seq
 524290419     gbest231.seq
 524292023     gbest232.seq
 524290299     gbest233.seq
 524290719     gbest234.seq
 524290974     gbest235.seq
 524289211     gbest236.seq
 524291370     gbest237.seq
 524290774     gbest238.seq
 524289057     gbest239.seq
 509312736     gbest24.seq
 524289952     gbest240.seq
 524289100     gbest241.seq
 524290256     gbest242.seq
 524289812     gbest243.seq
 524291098     gbest244.seq
  45257507     gbest245.seq
 524290847     gbest246.seq
 524290983     gbest247.seq
 524289154     gbest248.seq
 524290595     gbest249.seq
 320401330     gbest25.seq
 524289061     gbest250.seq
 524289687     gbest251.seq
 524289661     gbest252.seq
 524291677     gbest253.seq
 524289536     gbest254.seq
 524292249     gbest255.seq
 524290943     gbest256.seq
 239399070     gbest257.seq
 524290160     gbest258.seq
 524288973     gbest259.seq
 524290613     gbest26.seq
 524289499     gbest260.seq
 524291085     gbest261.seq
 524288758     gbest262.seq
 524289118     gbest263.seq
 524290899     gbest264.seq
 524289270     gbest265.seq
 524288860     gbest266.seq
 524290199     gbest267.seq
 288487884     gbest268.seq
 524290200     gbest269.seq
 524289817     gbest27.seq
 524289655     gbest270.seq
 524288901     gbest271.seq
 524290460     gbest272.seq
 524290950     gbest273.seq
 524291723     gbest274.seq
 524291444     gbest275.seq
 524291049     gbest276.seq
 524290570     gbest277.seq
 524289579     gbest278.seq
 524289567     gbest279.seq
 524290576     gbest28.seq
 295023248     gbest280.seq
 524289732     gbest281.seq
 524290854     gbest282.seq
 524290336     gbest283.seq
 524288803     gbest284.seq
 524290454     gbest285.seq
 524291145     gbest286.seq
 524288751     gbest287.seq
 524291430     gbest288.seq
 524289392     gbest289.seq
 524289334     gbest29.seq
 524291418     gbest290.seq
 524289169     gbest291.seq
 229998897     gbest292.seq
 524289566     gbest293.seq
 524290600     gbest294.seq
 524290637     gbest295.seq
 524289091     gbest296.seq
 524290617     gbest297.seq
 524290786     gbest298.seq
 524290072     gbest299.seq
 497701912     gbest3.seq
 524291411     gbest30.seq
 524289993     gbest300.seq
 479534122     gbest301.seq
 485199296     gbest302.seq
 486544620     gbest303.seq
 313975983     gbest304.seq
 524288914     gbest305.seq
 524289430     gbest306.seq
 524289983     gbest307.seq
 524291152     gbest308.seq
 524290282     gbest309.seq
 524289379     gbest31.seq
 524290541     gbest310.seq
 524288930     gbest311.seq
 524291231     gbest312.seq
 524291250     gbest313.seq
 524291265     gbest314.seq
 524290094     gbest315.seq
 524288889     gbest316.seq
 503962422     gbest317.seq
 524288982     gbest318.seq
 524289890     gbest319.seq
 524290914     gbest32.seq
 524289511     gbest320.seq
 524292144     gbest321.seq
 524292072     gbest322.seq
 524291498     gbest323.seq
 524290192     gbest324.seq
 524291977     gbest325.seq
 524289756     gbest326.seq
 524292099     gbest327.seq
 524289573     gbest328.seq
 524292097     gbest329.seq
 524289377     gbest33.seq
 524289000     gbest330.seq
 265935598     gbest331.seq
 524291210     gbest332.seq
 524289128     gbest333.seq
 524289370     gbest334.seq
 524293366     gbest335.seq
 524291045     gbest336.seq
 524290194     gbest337.seq
 524292117     gbest338.seq
 524289878     gbest339.seq
 519112548     gbest34.seq
 524290542     gbest340.seq
 524291404     gbest341.seq
 524290002     gbest342.seq
 524288925     gbest343.seq
 524288732     gbest344.seq
 341016054     gbest345.seq
 524290081     gbest346.seq
 524290692     gbest347.seq
 524290338     gbest348.seq
 524291764     gbest349.seq
 492709808     gbest35.seq
 524289542     gbest350.seq
 524289838     gbest351.seq
 524292697     gbest352.seq
 524288878     gbest353.seq
 524292119     gbest354.seq
 524292032     gbest355.seq
 524290475     gbest356.seq
 524289491     gbest357.seq
 524289694     gbest358.seq
 502728352     gbest359.seq
 494453282     gbest36.seq
 524289914     gbest360.seq
 524288950     gbest361.seq
 524290852     gbest362.seq
 524290860     gbest363.seq
 524288888     gbest364.seq
 524290765     gbest365.seq
 524289559     gbest366.seq
 524289519     gbest367.seq
 524290337     gbest368.seq
 524289273     gbest369.seq
 493351895     gbest37.seq
 524289854     gbest370.seq
  10698765     gbest371.seq
 524293044     gbest372.seq
 524290306     gbest373.seq
 491193296     gbest374.seq
 524288893     gbest375.seq
 524289275     gbest376.seq
 524288938     gbest377.seq
 524289334     gbest378.seq
 524290297     gbest379.seq
 487989331     gbest38.seq
 524290619     gbest380.seq
 524290003     gbest381.seq
 434431337     gbest382.seq
 524291809     gbest383.seq
 524289242     gbest384.seq
 524288990     gbest385.seq
 524289777     gbest386.seq
 524289846     gbest387.seq
 524290918     gbest388.seq
 524290513     gbest389.seq
 493321514     gbest39.seq
 524288867     gbest390.seq
 524288778     gbest391.seq
 524292092     gbest392.seq
 524290451     gbest393.seq
 524291346     gbest394.seq
 212091178     gbest395.seq
 524290064     gbest396.seq
 524289397     gbest397.seq
 524290159     gbest398.seq
 524291035     gbest399.seq
 524288944     gbest4.seq
 113414773     gbest40.seq
 524289671     gbest400.seq
 524290040     gbest401.seq
 524289655     gbest402.seq
 524290525     gbest403.seq
 524289386     gbest404.seq
 524288939     gbest405.seq
 524290832     gbest406.seq
 524290072     gbest407.seq
 463530242     gbest408.seq
 524290995     gbest409.seq
 524290880     gbest41.seq
 524290906     gbest410.seq
 524288879     gbest411.seq
 524289527     gbest412.seq
 524291809     gbest413.seq
 524290129     gbest414.seq
 524290478     gbest415.seq
 524291164     gbest416.seq
 524292714     gbest417.seq
 524289969     gbest418.seq
 524291154     gbest419.seq
 524292268     gbest42.seq
 524290032     gbest420.seq
 524289760     gbest421.seq
 524291859     gbest422.seq
 155553427     gbest423.seq
 524290991     gbest424.seq
 524291097     gbest425.seq
 524291383     gbest426.seq
 524289678     gbest427.seq
 524289164     gbest428.seq
 524291584     gbest429.seq
 524289990     gbest43.seq
 524289481     gbest430.seq
 524290101     gbest431.seq
 524289848     gbest432.seq
 524291008     gbest433.seq
 524289311     gbest434.seq
 524289333     gbest435.seq
 217796253     gbest436.seq
 524289207     gbest437.seq
 524288869     gbest438.seq
 524290759     gbest439.seq
 524288988     gbest44.seq
 524289709     gbest440.seq
 524290435     gbest441.seq
 524291060     gbest442.seq
 524289172     gbest443.seq
 524289982     gbest444.seq
  60184772     gbest445.seq
 524290658     gbest45.seq
 524288845     gbest46.seq
 524289123     gbest47.seq
 524289436     gbest48.seq
 524289748     gbest49.seq
 524289625     gbest5.seq
 524289890     gbest50.seq
 524291850     gbest51.seq
 524290597     gbest52.seq
 524291261     gbest53.seq
 272068884     gbest54.seq
 524291144     gbest55.seq
 524290818     gbest56.seq
 524291908     gbest57.seq
 524291081     gbest58.seq
 524291678     gbest59.seq
 524288762     gbest6.seq
 524292209     gbest60.seq
 524291507     gbest61.seq
 524289150     gbest62.seq
 524291761     gbest63.seq
 524289276     gbest64.seq
 524291181     gbest65.seq
 524292615     gbest66.seq
 464737740     gbest67.seq
 524290473     gbest68.seq
 524289458     gbest69.seq
 524292257     gbest7.seq
 524291062     gbest70.seq
 524289828     gbest71.seq
 524289375     gbest72.seq
 524290343     gbest73.seq
 524289878     gbest74.seq
 524291258     gbest75.seq
 524290111     gbest76.seq
 524291654     gbest77.seq
 524289345     gbest78.seq
 524290253     gbest79.seq
 524289253     gbest8.seq
 204010212     gbest80.seq
 524289535     gbest81.seq
 524290774     gbest82.seq
 524289969     gbest83.seq
 524289114     gbest84.seq
 524292008     gbest85.seq
 524291274     gbest86.seq
 524289505     gbest87.seq
 524291711     gbest88.seq
 524292145     gbest89.seq
 524291518     gbest9.seq
 524290843     gbest90.seq
 524292149     gbest91.seq
 448520661     gbest92.seq
 524289420     gbest93.seq
 524292516     gbest94.seq
 524289074     gbest95.seq
 524289287     gbest96.seq
 524290631     gbest97.seq
 524290221     gbest98.seq
 524290454     gbest99.seq
 159004539     gbgen.idx
 524291296     gbgss1.seq
 524291442     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524290642     gbgss103.seq
 413690581     gbgss104.seq
 524290849     gbgss105.seq
 524290737     gbgss106.seq
 524290652     gbgss107.seq
 524290428     gbgss108.seq
 524289801     gbgss109.seq
 524292161     gbgss11.seq
 524290704     gbgss110.seq
 524290354     gbgss111.seq
 524288843     gbgss112.seq
 524290376     gbgss113.seq
 524290223     gbgss114.seq
 524291222     gbgss115.seq
  55466571     gbgss116.seq
 524289667     gbgss117.seq
 524288912     gbgss118.seq
 524291610     gbgss119.seq
 524289997     gbgss12.seq
 524288966     gbgss120.seq
 524289281     gbgss121.seq
 524291002     gbgss122.seq
 524291088     gbgss123.seq
 524290117     gbgss124.seq
 524289105     gbgss125.seq
 524290798     gbgss126.seq
 524289417     gbgss127.seq
 524291668     gbgss128.seq
 234347164     gbgss129.seq
 524289269     gbgss13.seq
 524288857     gbgss130.seq
 524290772     gbgss131.seq
 524290752     gbgss132.seq
 524289619     gbgss133.seq
 524289444     gbgss134.seq
 524289783     gbgss135.seq
 524291175     gbgss136.seq
 524289612     gbgss137.seq
 524289682     gbgss138.seq
 515994577     gbgss139.seq
 524292326     gbgss14.seq
 516001972     gbgss140.seq
  84811264     gbgss141.seq
 524289677     gbgss142.seq
 524289037     gbgss143.seq
 233296092     gbgss144.seq
 249998289     gbgss145.seq
 249999820     gbgss146.seq
 249999194     gbgss147.seq
 250000011     gbgss148.seq
  28487295     gbgss149.seq
 524292107     gbgss15.seq
 249997137     gbgss150.seq
 250000033     gbgss151.seq
 249998542     gbgss152.seq
 249998333     gbgss153.seq
 224919493     gbgss154.seq
 249998415     gbgss155.seq
 249998761     gbgss156.seq
 249998880     gbgss157.seq
 249997750     gbgss158.seq
 189046598     gbgss159.seq
 524289973     gbgss16.seq
 249999433     gbgss160.seq
 249998390     gbgss161.seq
 249999267     gbgss162.seq
 249998392     gbgss163.seq
 249998723     gbgss164.seq
  76677866     gbgss165.seq
 249997579     gbgss166.seq
   2077145     gbgss167.seq
  79542394     gbgss168.seq
 249999009     gbgss169.seq
 524289030     gbgss17.seq
 250000259     gbgss170.seq
  87380505     gbgss171.seq
 249999685     gbgss172.seq
 249998355     gbgss173.seq
 249998984     gbgss174.seq
 202719103     gbgss175.seq
 249999232     gbgss176.seq
 249999013     gbgss177.seq
 249998851     gbgss178.seq
 246250899     gbgss179.seq
 524289291     gbgss18.seq
 249999268     gbgss180.seq
 249997406     gbgss181.seq
 249999279     gbgss182.seq
 243520281     gbgss183.seq
 249999336     gbgss184.seq
 249997150     gbgss185.seq
 249998209     gbgss186.seq
 249997376     gbgss187.seq
 122294651     gbgss188.seq
 249998013     gbgss189.seq
 314779838     gbgss19.seq
 250000031     gbgss190.seq
 249999974     gbgss191.seq
 249998152     gbgss192.seq
  94058788     gbgss193.seq
 249998892     gbgss194.seq
 249999850     gbgss195.seq
 249998239     gbgss196.seq
 249999582     gbgss197.seq
 171078309     gbgss198.seq
 249999236     gbgss199.seq
 524290030     gbgss2.seq
 524288952     gbgss20.seq
 249997993     gbgss200.seq
 249998006     gbgss201.seq
 249999353     gbgss202.seq
  95926739     gbgss203.seq
 249999461     gbgss204.seq
 249999350     gbgss205.seq
 249998406     gbgss206.seq
 249998619     gbgss207.seq
 249999398     gbgss208.seq
 249999995     gbgss209.seq
 524289034     gbgss21.seq
  17245248     gbgss210.seq
 249999424     gbgss211.seq
 249999963     gbgss212.seq
 249997369     gbgss213.seq
  43648880     gbgss214.seq
  52862187     gbgss215.seq
 249997605     gbgss216.seq
 249998837     gbgss217.seq
 249998038     gbgss218.seq
 249998260     gbgss219.seq
 524291398     gbgss22.seq
  30266487     gbgss220.seq
 249997466     gbgss221.seq
 249997580     gbgss222.seq
 249998996     gbgss223.seq
 249999984     gbgss224.seq
  28042636     gbgss225.seq
 249997655     gbgss226.seq
 249998570     gbgss227.seq
 249999046     gbgss228.seq
 250000051     gbgss229.seq
 524291130     gbgss23.seq
 249998160     gbgss230.seq
 249998166     gbgss231.seq
 178904694     gbgss232.seq
 249999812     gbgss233.seq
 249998926     gbgss234.seq
 249999095     gbgss235.seq
 220154622     gbgss236.seq
 250000034     gbgss237.seq
 249997956     gbgss238.seq
 250000074     gbgss239.seq
 524291392     gbgss24.seq
 249998729     gbgss240.seq
 195288113     gbgss241.seq
 249999561     gbgss242.seq
 249998751     gbgss243.seq
 249999600     gbgss244.seq
 249999029     gbgss245.seq
 249999714     gbgss246.seq
  16550601     gbgss247.seq
 524290581     gbgss25.seq
 524289330     gbgss26.seq
 524289646     gbgss27.seq
 524292079     gbgss28.seq
 524289825     gbgss29.seq
 524291456     gbgss3.seq
 524290682     gbgss30.seq
  39016581     gbgss31.seq
 524290022     gbgss32.seq
 524290380     gbgss33.seq
 524290510     gbgss34.seq
 524289912     gbgss35.seq
 524291284     gbgss36.seq
 524290416     gbgss37.seq
 524289394     gbgss38.seq
 509111345     gbgss39.seq
 524289321     gbgss4.seq
 524292915     gbgss40.seq
 524291774     gbgss41.seq
 524289856     gbgss42.seq
  28766945     gbgss43.seq
 524288942     gbgss44.seq
 524289151     gbgss45.seq
 524291004     gbgss46.seq
 524290935     gbgss47.seq
 209349659     gbgss48.seq
 524291863     gbgss49.seq
 168340015     gbgss5.seq
 524291582     gbgss50.seq
 524290401     gbgss51.seq
 524290464     gbgss52.seq
 524290548     gbgss53.seq
 524290213     gbgss54.seq
 524289963     gbgss55.seq
 524289945     gbgss56.seq
 524290863     gbgss57.seq
 524291284     gbgss58.seq
 524290900     gbgss59.seq
 524290951     gbgss6.seq
   5856233     gbgss60.seq
 524291834     gbgss61.seq
 524290410     gbgss62.seq
 524289010     gbgss63.seq
 456972183     gbgss64.seq
 524291037     gbgss65.seq
 524291022     gbgss66.seq
 524290625     gbgss67.seq
 524289969     gbgss68.seq
 524289927     gbgss69.seq
 524290958     gbgss7.seq
 524291431     gbgss70.seq
 524291342     gbgss71.seq
 524290946     gbgss72.seq
 524289514     gbgss73.seq
 524288792     gbgss74.seq
 524289875     gbgss75.seq
 524289789     gbgss76.seq
  32025220     gbgss77.seq
 524289945     gbgss78.seq
 524291935     gbgss79.seq
 524292289     gbgss8.seq
 524289482     gbgss80.seq
 524290066     gbgss81.seq
 524289701     gbgss82.seq
 524291196     gbgss83.seq
 524290880     gbgss84.seq
 524289902     gbgss85.seq
 524291820     gbgss86.seq
 524289216     gbgss87.seq
 524290299     gbgss88.seq
 369802312     gbgss89.seq
 524290754     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249992912     gbhtc1.seq
 249998856     gbhtc10.seq
 249999002     gbhtc11.seq
  79453856     gbhtc12.seq
 249998828     gbhtc13.seq
 249999492     gbhtc14.seq
  60864263     gbhtc15.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  83873876     gbhtc8.seq
 249999621     gbhtc9.seq
 249904748     gbhtg1.seq
 249863408     gbhtg10.seq
 249917503     gbhtg100.seq
 249825680     gbhtg101.seq
 249884880     gbhtg102.seq
 249914920     gbhtg103.seq
   5504377     gbhtg104.seq
 249493570     gbhtg105.seq
 249906711     gbhtg106.seq
 249802366     gbhtg107.seq
 249927339     gbhtg108.seq
 249969806     gbhtg109.seq
   1107147     gbhtg11.seq
 249886695     gbhtg110.seq
 249979070     gbhtg111.seq
 249738901     gbhtg112.seq
 249971341     gbhtg113.seq
 135273309     gbhtg114.seq
 249974240     gbhtg115.seq
 249957856     gbhtg116.seq
 249971769     gbhtg117.seq
 249933365     gbhtg118.seq
 249934502     gbhtg119.seq
 249658387     gbhtg12.seq
  56361781     gbhtg120.seq
 249966899     gbhtg121.seq
 249781560     gbhtg122.seq
 249950401     gbhtg123.seq
 249920865     gbhtg124.seq
 249795533     gbhtg125.seq
 144610325     gbhtg126.seq
 249917701     gbhtg127.seq
 249779904     gbhtg128.seq
 249839664     gbhtg129.seq
 249699749     gbhtg13.seq
 249881938     gbhtg130.seq
 249974266     gbhtg131.seq
 249692111     gbhtg132.seq
 249984575     gbhtg133.seq
 249804411     gbhtg134.seq
 249829371     gbhtg135.seq
   6125701     gbhtg136.seq
 249765870     gbhtg14.seq
 249760883     gbhtg15.seq
 249872612     gbhtg16.seq
 249845979     gbhtg17.seq
 249699084     gbhtg18.seq
 249902187     gbhtg19.seq
 249994630     gbhtg2.seq
 249996789     gbhtg20.seq
 237247303     gbhtg21.seq
 249760624     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761207     gbhtg26.seq
 249891641     gbhtg27.seq
 249956307     gbhtg28.seq
 249848514     gbhtg29.seq
 249950135     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249924803     gbhtg33.seq
 249929437     gbhtg34.seq
 249919058     gbhtg35.seq
 249852033     gbhtg36.seq
 249814604     gbhtg37.seq
 249767419     gbhtg38.seq
 249627604     gbhtg39.seq
 249984089     gbhtg4.seq
 249839800     gbhtg40.seq
 224338811     gbhtg41.seq
 249998331     gbhtg42.seq
 249936527     gbhtg43.seq
 249894895     gbhtg44.seq
 249909173     gbhtg45.seq
 250000253     gbhtg46.seq
 249478757     gbhtg47.seq
 249731618     gbhtg48.seq
 249737498     gbhtg49.seq
 249882044     gbhtg5.seq
 249913135     gbhtg50.seq
 236749582     gbhtg51.seq
 249784840     gbhtg52.seq
 249916972     gbhtg53.seq
 249931672     gbhtg54.seq
 249971361     gbhtg55.seq
 249934905     gbhtg56.seq
  18928260     gbhtg57.seq
 249846592     gbhtg58.seq
 250000116     gbhtg59.seq
 249898460     gbhtg6.seq
 249917026     gbhtg60.seq
 249939524     gbhtg61.seq
 227541388     gbhtg62.seq
 249902652     gbhtg63.seq
 249986757     gbhtg64.seq
 249918193     gbhtg65.seq
 249883760     gbhtg66.seq
 249966605     gbhtg67.seq
  16805116     gbhtg68.seq
 249960711     gbhtg69.seq
 249933725     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249936542     gbhtg72.seq
 225956317     gbhtg73.seq
 249814083     gbhtg74.seq
 249953172     gbhtg75.seq
 249844720     gbhtg76.seq
 249976422     gbhtg77.seq
 245029378     gbhtg78.seq
 249883367     gbhtg79.seq
 249933567     gbhtg8.seq
 249988504     gbhtg80.seq
 249985054     gbhtg81.seq
 249923601     gbhtg82.seq
 216520297     gbhtg83.seq
 249912287     gbhtg84.seq
 249753930     gbhtg85.seq
 249833379     gbhtg86.seq
 249821739     gbhtg87.seq
 221421599     gbhtg88.seq
 249843050     gbhtg89.seq
 249923766     gbhtg9.seq
 249970890     gbhtg90.seq
 249817508     gbhtg91.seq
 249995281     gbhtg92.seq
 212086188     gbhtg93.seq
 249819427     gbhtg94.seq
 249984776     gbhtg95.seq
 249786991     gbhtg96.seq
 249842265     gbhtg97.seq
 169279701     gbhtg98.seq
 249744688     gbhtg99.seq
 249975649     gbinv1.seq
 249998497     gbinv10.seq
 159608888     gbinv11.seq
 249998061     gbinv12.seq
 249999944     gbinv13.seq
 249993237     gbinv14.seq
 142097929     gbinv15.seq
 247564683     gbinv16.seq
 249927786     gbinv17.seq
 249993408     gbinv18.seq
 247888188     gbinv19.seq
 249989384     gbinv2.seq
 249996920     gbinv20.seq
 249998377     gbinv21.seq
 249999007     gbinv22.seq
 129228728     gbinv23.seq
 249997659     gbinv24.seq
 249998522     gbinv25.seq
 249998326     gbinv26.seq
 249997290     gbinv27.seq
 249999021     gbinv28.seq
 249995408     gbinv29.seq
 223356339     gbinv3.seq
 109561142     gbinv30.seq
 249998319     gbinv4.seq
 250000005     gbinv5.seq
 249998312     gbinv6.seq
 212454102     gbinv7.seq
 249997648     gbinv8.seq
 249997951     gbinv9.seq
 144439520     gbjou1.idx
 263488954     gbjou10.idx
 217035997     gbjou11.idx
   9332606     gbjou12.idx
 194968190     gbjou2.idx
 142011534     gbjou3.idx
 260097317     gbjou4.idx
 268908301     gbjou5.idx
 278963118     gbjou6.idx
 273469269     gbjou7.idx
 302435587     gbjou8.idx
 294051201     gbjou9.idx
 315994625     gbkey1.idx
 179965997     gbkey2.idx
 199564226     gbkey3.idx
 279117246     gbkey4.idx
 135662815     gbkey5.idx
 249948586     gbmam1.seq
 249998556     gbmam2.seq
 249930114     gbmam3.seq
 249998403     gbmam4.seq
 249998009     gbmam5.seq
 249999805     gbmam6.seq
  89328623     gbmam7.seq
  80217546     gbnew.txt
 249999737     gbpat1.seq
 249999443     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192934308     gbpat107.seq
 249999808     gbpat108.seq
 249999627     gbpat109.seq
 179524671     gbpat11.seq
 249999287     gbpat110.seq
  80117336     gbpat111.seq
 249999537     gbpat112.seq
 249999264     gbpat113.seq
 249980515     gbpat114.seq
 249999878     gbpat115.seq
 249849703     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 249999327     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 249995349     gbpat13.seq
 249997452     gbpat130.seq
 249996753     gbpat131.seq
 250000045     gbpat132.seq
 249999866     gbpat133.seq
  49825422     gbpat134.seq
 250000124     gbpat135.seq
 249999983     gbpat136.seq
 250000132     gbpat137.seq
  86031991     gbpat138.seq
 249999922     gbpat139.seq
 249999709     gbpat14.seq
 249999621     gbpat140.seq
 250000060     gbpat141.seq
  63529069     gbpat142.seq
 249998134     gbpat143.seq
 249996113     gbpat144.seq
 249999931     gbpat145.seq
 249999808     gbpat146.seq
 250000003     gbpat147.seq
 249997374     gbpat148.seq
 222093634     gbpat149.seq
 249996499     gbpat15.seq
 250000249     gbpat150.seq
 249999893     gbpat151.seq
 249999893     gbpat152.seq
 220539897     gbpat153.seq
 249999753     gbpat154.seq
 249998760     gbpat155.seq
 249999466     gbpat156.seq
  11331927     gbpat157.seq
 249997013     gbpat158.seq
 249997795     gbpat159.seq
 249999171     gbpat16.seq
 249999486     gbpat160.seq
 249905267     gbpat161.seq
 249999814     gbpat162.seq
 249999930     gbpat163.seq
   8794991     gbpat164.seq
  65866387     gbpat17.seq
 250000027     gbpat18.seq
 249999801     gbpat19.seq
 249999883     gbpat2.seq
 249999076     gbpat20.seq
 249995026     gbpat21.seq
 185815053     gbpat22.seq
 249999667     gbpat23.seq
 249837974     gbpat24.seq
 249999411     gbpat25.seq
 250000091     gbpat26.seq
  71180933     gbpat27.seq
 249983485     gbpat28.seq
 249999685     gbpat29.seq
 250000133     gbpat3.seq
 249997897     gbpat30.seq
 249999652     gbpat31.seq
 249998555     gbpat32.seq
 180165298     gbpat33.seq
 249997844     gbpat34.seq
 249999933     gbpat35.seq
 249999058     gbpat36.seq
 249999871     gbpat37.seq
 130526044     gbpat38.seq
 249995253     gbpat39.seq
 249998802     gbpat4.seq
 249979830     gbpat40.seq
 249999229     gbpat41.seq
 249999035     gbpat42.seq
 250000221     gbpat43.seq
 249813658     gbpat44.seq
 249999190     gbpat45.seq
 249999707     gbpat46.seq
 171260250     gbpat47.seq
 249999855     gbpat48.seq
 249998527     gbpat49.seq
  71788701     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164688772     gbpat56.seq
 249881382     gbpat57.seq
 249999652     gbpat58.seq
 249998856     gbpat59.seq
 249999527     gbpat6.seq
 249999026     gbpat60.seq
 134923851     gbpat61.seq
 249998246     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999455     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249999790     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244402927     gbpat72.seq
 248968678     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999937     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249996454     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249999823     gbpat82.seq
 249999342     gbpat83.seq
  93329421     gbpat84.seq
 249153671     gbpat85.seq
 249998903     gbpat86.seq
 250000182     gbpat87.seq
 249999344     gbpat88.seq
 249999504     gbpat89.seq
 249997995     gbpat9.seq
 249998993     gbpat90.seq
 145287217     gbpat91.seq
 249999016     gbpat92.seq
 249998980     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196964910     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 133889827     gbphg1.seq
 249999553     gbpln1.seq
 249993376     gbpln10.seq
 249994594     gbpln11.seq
 249885016     gbpln12.seq
 214287486     gbpln13.seq
 249998215     gbpln14.seq
 249985349     gbpln15.seq
 249996352     gbpln16.seq
 249408418     gbpln17.seq
 249980127     gbpln18.seq
 249606502     gbpln19.seq
 249998800     gbpln2.seq
 249997413     gbpln20.seq
  32429297     gbpln21.seq
 249998035     gbpln22.seq
  97520053     gbpln23.seq
 249998630     gbpln24.seq
 249997382     gbpln25.seq
 247086229     gbpln26.seq
 195754294     gbpln27.seq
 247675171     gbpln28.seq
 248393733     gbpln29.seq
 249938067     gbpln3.seq
 249999306     gbpln30.seq
 249999636     gbpln31.seq
 249998924     gbpln32.seq
  96193793     gbpln33.seq
 249998604     gbpln34.seq
 249999760     gbpln35.seq
 249999374     gbpln36.seq
 249895573     gbpln37.seq
 112428086     gbpln38.seq
 249999616     gbpln39.seq
 249856198     gbpln4.seq
 249997602     gbpln40.seq
 249997908     gbpln41.seq
 249941176     gbpln42.seq
 242692694     gbpln43.seq
 249998417     gbpln44.seq
 249999447     gbpln45.seq
 249999656     gbpln46.seq
 249999466     gbpln47.seq
 181430390     gbpln48.seq
 249917311     gbpln5.seq
 249510533     gbpln6.seq
 249980320     gbpln7.seq
 129976479     gbpln8.seq
 249998104     gbpln9.seq
 148950419     gbpri1.seq
 249865688     gbpri10.seq
 127325880     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902427     gbpri16.seq
 249853720     gbpri17.seq
 249795954     gbpri18.seq
 249857339     gbpri19.seq
 249858560     gbpri2.seq
 249966588     gbpri20.seq
 249904105     gbpri21.seq
 199921494     gbpri22.seq
 179365263     gbpri23.seq
 249996873     gbpri24.seq
 206003648     gbpri25.seq
 249813409     gbpri26.seq
 249931747     gbpri27.seq
 249985513     gbpri28.seq
 249932528     gbpri29.seq
 249761366     gbpri3.seq
 249827018     gbpri30.seq
 249979716     gbpri31.seq
 249791846     gbpri32.seq
 249998672     gbpri33.seq
  85927953     gbpri34.seq
 249993971     gbpri35.seq
 249993798     gbpri36.seq
 249976728     gbpri37.seq
 249992459     gbpri38.seq
 250000162     gbpri39.seq
 249860679     gbpri4.seq
 175862490     gbpri40.seq
 249999674     gbpri41.seq
 200435448     gbpri42.seq
 249912180     gbpri5.seq
 249946672     gbpri6.seq
 249851316     gbpri7.seq
 249923382     gbpri8.seq
 249886895     gbpri9.seq
    300648     gbrel.txt
 249840408     gbrod1.seq
 249952616     gbrod10.seq
  60961015     gbrod11.seq
 249871284     gbrod12.seq
 249784533     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249886642     gbrod17.seq
 249831745     gbrod18.seq
 223628852     gbrod19.seq
 249941906     gbrod2.seq
 249687397     gbrod20.seq
 249816207     gbrod21.seq
 227955389     gbrod22.seq
 249999880     gbrod23.seq
 249991809     gbrod24.seq
 249839571     gbrod25.seq
 249814218     gbrod26.seq
 249999589     gbrod27.seq
 249999623     gbrod28.seq
 134715339     gbrod29.seq
 249786577     gbrod3.seq
 249743057     gbrod4.seq
 249987585     gbrod5.seq
 249985583     gbrod6.seq
 249746791     gbrod7.seq
 249760313     gbrod8.seq
 249867062     gbrod9.seq
3575852370     gbsdr1.txt
5599361247     gbsdr2.txt
2586789021     gbsdr3.txt
 149054696     gbsec.idx
 249997033     gbsts1.seq
 249997368     gbsts10.seq
 210872286     gbsts11.seq
 249996524     gbsts12.seq
 249999993     gbsts13.seq
 249998580     gbsts14.seq
 249998056     gbsts15.seq
  22922975     gbsts16.seq
 249999107     gbsts17.seq
 249997856     gbsts18.seq
 250000230     gbsts19.seq
 249998336     gbsts2.seq
 146205836     gbsts20.seq
 249999523     gbsts3.seq
 249996467     gbsts4.seq
  38698462     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249996997     gbsts9.seq
 249999461     gbsyn1.seq
 249996480     gbsyn2.seq
  30632416     gbsyn3.seq
 249999766     gbtsa1.seq
 243632786     gbtsa10.seq
 249997835     gbtsa11.seq
 249999221     gbtsa12.seq
 249999134     gbtsa13.seq
 249998282     gbtsa14.seq
 167230959     gbtsa15.seq
 249998694     gbtsa16.seq
 249998042     gbtsa17.seq
 249998579     gbtsa18.seq
 250000159     gbtsa19.seq
 249998185     gbtsa2.seq
  93761497     gbtsa20.seq
 249998605     gbtsa21.seq
 249999182     gbtsa22.seq
 249997042     gbtsa23.seq
 249999495     gbtsa24.seq
 103257235     gbtsa25.seq
 249999367     gbtsa26.seq
 250000160     gbtsa27.seq
 249999704     gbtsa28.seq
 249998402     gbtsa29.seq
 249999791     gbtsa3.seq
  16245355     gbtsa30.seq
 249998820     gbtsa4.seq
  82943435     gbtsa5.seq
 249999101     gbtsa6.seq
 249998558     gbtsa7.seq
 250000063     gbtsa8.seq
 249998408     gbtsa9.seq
    486530     gbuna1.seq
 249996930     gbvrl1.seq
 249998458     gbvrl10.seq
  37701157     gbvrl11.seq
 249997947     gbvrl12.seq
 249998980     gbvrl13.seq
 249998823     gbvrl14.seq
 249998979     gbvrl15.seq
 249999945     gbvrl16.seq
 249999954     gbvrl17.seq
 103193489     gbvrl18.seq
 249998770     gbvrl2.seq
 249999838     gbvrl3.seq
 249998326     gbvrl4.seq
 173248746     gbvrl5.seq
 249999766     gbvrl6.seq
 249999850     gbvrl7.seq
 249998287     gbvrl8.seq
 249999575     gbvrl9.seq
 249702338     gbvrt1.seq
 249855727     gbvrt10.seq
 249950363     gbvrt11.seq
 185412106     gbvrt12.seq
 249995062     gbvrt13.seq
 249948900     gbvrt14.seq
 249862622     gbvrt15.seq
 249998300     gbvrt16.seq
 249998311     gbvrt17.seq
 249997581     gbvrt18.seq
  95970738     gbvrt19.seq
 249996978     gbvrt2.seq
 249978853     gbvrt20.seq
 249998822     gbvrt21.seq
 250000056     gbvrt22.seq
 249997384     gbvrt23.seq
  37539965     gbvrt24.seq
 249804768     gbvrt3.seq
 249993473     gbvrt4.seq
  81539769     gbvrt5.seq
 249996058     gbvrt6.seq
 249996561     gbvrt7.seq
 249951682     gbvrt8.seq
 249975416     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         57868      87999564
BCT10        61         117892388
BCT11        120        115665846
BCT12        16131      89851177
BCT13        53938      85393265
BCT14        93         110189094
BCT15        151        93915681
BCT16        61         112455059
BCT17        52         112042350
BCT18        46         114233015
BCT19        58         114976109
BCT2         79         110915939
BCT20        66         108817610
BCT21        36         96325907
BCT22        40         106881287
BCT23        58         105533856
BCT24        74         111675186
BCT25        55         110045255
BCT26        63         106845575
BCT27        55         109391288
BCT28        52         108559385
BCT29        46         110496749
BCT3         55         112957780
BCT30        95         109522868
BCT31        59         110966729
BCT32        67         108616570
BCT33        123        106326491
BCT34        35         64734494
BCT35        202        109105476
BCT36        51         109861512
BCT37        41         108044754
BCT38        53         106012438
BCT39        58         108356780
BCT4         1695       109790801
BCT40        47         111678360
BCT41        84         106541161
BCT42        48         107804860
BCT43        56         108200690
BCT44        74         108235330
BCT45        89         103751179
BCT46        3          19351707
BCT47        67         107603750
BCT48        60         101650984
BCT49        47         106810333
BCT5         36668      60774727
BCT50        58         106248224
BCT51        57         110408706
BCT52        49         100887372
BCT53        40         103040731
BCT54        69         108722619
BCT55        227        104020950
BCT56        426        93880787
BCT57        1589       2511823
BCT58        3179       5215895
BCT59        6347       7901828
BCT6         39039      82659238
BCT60        12648      15076611
BCT61        25628      27748212
BCT62        50524      53976025
BCT63        76551      77435779
BCT64        71912      77219978
BCT65        8274       95944425
BCT66        5238       104231813
BCT67        2963       109148933
BCT68        173        121167011
BCT69        12464      107226504
BCT7         5533       96145966
BCT70        87813      70082482
BCT71        77776      79734313
BCT72        41760      80013880
BCT8         13866      89679026
BCT9         6715       95967872
ENV1         93809      72055863
ENV10        82991      87020013
ENV11        19073      16784927
ENV12        84894      80972564
ENV13        120708     43404632
ENV14        88775      78252990
ENV15        96751      67974930
ENV16        96478      63158106
ENV17        86986      71162249
ENV18        57891      78165337
ENV19        69532      85606513
ENV2         87781      70438827
ENV20        94305      72060603
ENV21        128620     31367039
ENV22        123354     29532069
ENV23        63056      14104745
ENV24        123225     49908858
ENV25        98576      67524378
ENV26        120518     57220263
ENV27        140039     51733043
ENV28        100671     64906038
ENV29        26471      25182836
ENV3         92138      76003209
ENV30        71058      96548027
ENV31        95283      69110297
ENV32        108351     43155100
ENV33        86683      70753171
ENV34        51257      28261502
ENV35        112132     47684503
ENV36        104995     60436423
ENV37        77746      88467262
ENV38        70411      95649981
ENV39        95534      67328221
ENV4         77986      85266222
ENV40        46119      29114143
ENV5         93093      80642586
ENV6         69596      39376221
ENV7         131791     31268854
ENV8         86960      71051171
ENV9         93953      73218646
EST1         158932     61578479
EST10        167474     72175818
EST100       226242     140246726
EST101       227611     115480092
EST102       201381     104747807
EST103       171804     101004881
EST104       102136     80258286
EST105       165129     110876586
EST106       168479     110411595
EST107       116979     68034525
EST108       63862      23524265
EST109       64110      22728823
EST11        169519     73967719
EST110       64334      23423852
EST111       64294      27229289
EST112       64310      21909415
EST113       65711      25951956
EST114       63772      27851479
EST115       64287      26251017
EST116       64524      26960420
EST117       64245      25130351
EST118       61224      38061977
EST119       162258     77041045
EST12        166830     70071306
EST120       174890     86182700
EST121       158356     92880226
EST122       149630     95735188
EST123       153459     89563495
EST124       126147     78380533
EST125       202981     99396916
EST126       153457     79462145
EST127       158034     84359330
EST128       155594     89073775
EST129       149671     79525719
EST13        72718      34892939
EST130       174606     101477814
EST131       200144     116340383
EST132       182346     99491444
EST133       162808     84303979
EST134       158376     80382256
EST135       146304     89303609
EST136       142026     85584918
EST137       93527      49245874
EST138       188163     107244964
EST139       232229     101981184
EST14        217651     109271608
EST140       152936     89657549
EST141       168238     91530760
EST142       146978     87189366
EST143       137588     86847873
EST144       157593     95363296
EST145       146219     76533496
EST146       123462     64407246
EST147       121770     65835257
EST148       129198     54534999
EST149       127613     50728665
EST15        168587     105333694
EST150       128330     51062564
EST151       119677     45521332
EST152       171986     86430334
EST153       180120     80439385
EST154       154652     109509674
EST155       211711     129313137
EST156       215417     119836578
EST157       174374     93015187
EST158       147083     111956571
EST159       134267     83214809
EST16        178924     112370151
EST160       157154     97888824
EST161       149749     80064762
EST162       142410     81979467
EST163       168525     94464916
EST164       72521      43368942
EST165       154665     96054210
EST166       188742     105985555
EST167       142786     78197488
EST168       135318     71833323
EST169       168658     94073647
EST17        195339     112911344
EST170       179414     103159775
EST171       150825     94205146
EST172       171509     83647523
EST173       130013     86659069
EST174       183038     107939927
EST175       164540     93004024
EST176       112197     66457662
EST177       164153     93659447
EST178       34085      21483956
EST179       169059     101124782
EST18        190569     121501907
EST180       181509     127722112
EST181       148912     106516949
EST182       190661     99288938
EST183       152807     115931499
EST184       144007     86850521
EST185       145430     82982109
EST186       177747     71902674
EST187       149456     84355930
EST188       155114     97049904
EST189       162588     99760556
EST19        159265     114057604
EST190       142258     88351966
EST191       162350     94428817
EST192       133731     89930790
EST193       131190     88371690
EST194       145029     89344881
EST195       134001     89297062
EST196       123920     87002971
EST197       173305     92470487
EST198       173992     95868586
EST199       173450     96322633
EST2         161860     61550624
EST20        187058     99421404
EST200       171169     96064787
EST201       168255     94202121
EST202       172251     95874272
EST203       173459     95043222
EST204       174008     95565513
EST205       32233      17534410
EST206       191227     103858647
EST207       202331     106570886
EST208       174713     105328784
EST209       183797     103921186
EST21        217117     106462571
EST210       197120     118558493
EST211       195593     116489265
EST212       182869     121394518
EST213       174204     105007302
EST214       214299     146884559
EST215       237560     107488677
EST216       139124     108029211
EST217       150565     101297591
EST218       146701     90947330
EST219       206034     111631974
EST22        198695     65860008
EST220       171814     113686510
EST221       99875      91365298
EST222       142711     110418596
EST223       160863     94617232
EST224       145624     106223024
EST225       216467     100676095
EST226       144137     101915534
EST227       137853     96878906
EST228       140437     100755932
EST229       121104     86082198
EST23        140922     40078873
EST230       95805      61686268
EST231       141422     91717040
EST232       133066     98067561
EST233       137716     98123377
EST234       123939     84425383
EST235       132794     86788995
EST236       158087     116669566
EST237       143328     117077284
EST238       133633     113051730
EST239       154944     95483104
EST24        103789     28103816
EST240       177912     112819931
EST241       146319     92388094
EST242       179493     112570962
EST243       164530     122404886
EST244       140464     104138577
EST245       11705      9500689
EST246       164693     100597463
EST247       231282     97020604
EST248       152021     113246958
EST249       179419     65087767
EST25        121796     51015487
EST250       216990     50007314
EST251       212361     82234935
EST252       171164     131302317
EST253       165245     101375460
EST254       169210     107799020
EST255       164301     111357063
EST256       166656     117173515
EST257       86629      44453365
EST258       187512     98332328
EST259       176381     111583866
EST26        213567     97258803
EST260       165323     109202259
EST261       233184     110653173
EST262       278267     120118401
EST263       183353     111837668
EST264       187454     36843044
EST265       259314     124364773
EST266       151663     94583792
EST267       161054     105005877
EST268       96494      56244218
EST269       174016     118526642
EST27        219253     110171680
EST270       183485     98654593
EST271       172344     113472160
EST272       182182     105397664
EST273       207950     36613608
EST274       190872     56178112
EST275       185643     105860375
EST276       187424     118286598
EST277       173051     113343606
EST278       179931     102631036
EST279       156426     104367755
EST28        190323     88450994
EST280       111516     37313275
EST281       129555     81585185
EST282       132940     85982390
EST283       156239     100459712
EST284       259869     27441140
EST285       263840     24257669
EST286       146343     106020945
EST287       168767     109367714
EST288       161509     102904660
EST289       155909     91010941
EST29        157926     68874306
EST290       264419     32074529
EST291       165084     108392677
EST292       73969      42948433
EST293       184832     111067401
EST294       149333     91164816
EST295       195312     109640168
EST296       164260     114832022
EST297       162091     104387601
EST298       189125     113894357
EST299       179374     100267217
EST3         153644     54437600
EST30        171504     69596093
EST300       181442     103313526
EST301       188346     64338770
EST302       187450     69747936
EST303       187275     70834548
EST304       122473     47083480
EST305       187165     91816749
EST306       182049     133320602
EST307       149687     86290360
EST308       154216     90751159
EST309       128797     100374966
EST31        149159     63314614
EST310       157127     97918248
EST311       172529     98498655
EST312       155612     98074379
EST313       169533     97150928
EST314       158495     105996654
EST315       145080     101554644
EST316       165232     106396705
EST317       154049     113701600
EST318       182352     153683681
EST319       172875     94163560
EST32        168250     76099748
EST320       134252     85114473
EST321       144113     99222681
EST322       140714     93904056
EST323       139828     91385264
EST324       145668     101535241
EST325       151004     101274766
EST326       179186     106331072
EST327       149680     86806219
EST328       151775     86259602
EST329       155050     112493356
EST33        174123     66771010
EST330       158742     94856521
EST331       74761      49707976
EST332       139390     87217577
EST333       153677     95410475
EST334       205437     106064885
EST335       114387     62904518
EST336       103270     65681916
EST337       132595     88707193
EST338       138913     87899067
EST339       122870     75659148
EST34        122424     42971214
EST340       217072     83001433
EST341       182055     85862918
EST342       157164     95454744
EST343       177906     108830271
EST344       151011     90200367
EST345       83517      54926174
EST346       134781     90089544
EST347       146868     95491506
EST348       186721     116635577
EST349       158549     90451852
EST35        97395      29886072
EST350       174785     100209117
EST351       175935     129652055
EST352       80735      48870466
EST353       86623      48668343
EST354       145949     84235584
EST355       131101     77330770
EST356       158106     41728790
EST357       158949     31632436
EST358       157290     50558200
EST359       182715     119111357
EST36        97796      30593215
EST360       247436     114257674
EST361       250785     114853872
EST362       175599     99401219
EST363       142319     92326415
EST364       137895     86156989
EST365       156678     93385778
EST366       195449     120079464
EST367       222300     58913708
EST368       185769     113372399
EST369       212661     121452946
EST37        96710      29344141
EST370       144239     69700517
EST371       4166       1880704
EST372       192226     120602385
EST373       165815     104820800
EST374       163028     124834549
EST375       180776     147165632
EST376       156976     90019826
EST377       198342     111515365
EST378       189864     106827241
EST379       187404     111439512
EST38        98631      29841320
EST380       209048     133722977
EST381       208662     126032853
EST382       174580     129817457
EST383       202422     151469056
EST384       188201     103652327
EST385       171451     50596792
EST386       165336     13125001
EST387       155665     18283686
EST388       158495     32720105
EST389       158488     32733827
EST39        99466      31211469
EST390       155742     49971771
EST391       158359     92838382
EST392       177073     117246021
EST393       167499     104925078
EST394       162835     108373683
EST395       58434      37011347
EST396       141615     98809186
EST397       147165     102057191
EST398       159625     101558205
EST399       155052     112409777
EST4         170812     67108330
EST40        23473      5987285
EST400       165184     101083942
EST401       173262     49565196
EST402       166902     45086243
EST403       158149     108040045
EST404       159443     103419492
EST405       171339     110025038
EST406       144300     86146807
EST407       194474     115930786
EST408       135256     94234264
EST409       133831     91274717
EST41        100925     53085613
EST410       140192     91581582
EST411       153285     92661118
EST412       171377     95973814
EST413       177856     98574177
EST414       152606     91760874
EST415       177087     108941181
EST416       141344     88562266
EST417       103160     72967315
EST418       99701      67955367
EST419       120010     72942519
EST42        119775     50954107
EST420       143693     84116749
EST421       129995     79398405
EST422       138073     92071602
EST423       43497      23077956
EST424       150359     91687699
EST425       164836     88361253
EST426       193427     115200586
EST427       123880     80044910
EST428       193082     107425652
EST429       167228     73026626
EST43        164285     85729653
EST430       151155     86137672
EST431       173739     112882113
EST432       172767     94219563
EST433       136125     92746040
EST434       178831     72956813
EST435       187473     80916049
EST436       85708      35840197
EST437       205860     87010336
EST438       213237     116482767
EST439       183916     114424286
EST44        166519     67567635
EST440       175104     108782851
EST441       149036     102167111
EST442       149675     95705436
EST443       168367     58806444
EST444       158501     62468094
EST445       23862      7375741
EST45        166232     87668208
EST46        170516     87030468
EST47        162175     87651846
EST48        162709     82183452
EST49        157539     91107785
EST5         168996     66194437
EST50        161286     90953835
EST51        158819     98458800
EST52        157153     69409609
EST53        150561     82911356
EST54        81506      49855975
EST55        167810     67437990
EST56        160478     76559548
EST57        169036     93244265
EST58        156511     101556332
EST59        157518     100126737
EST6         171504     66930687
EST60        163279     100734063
EST61        160644     106131678
EST62        172742     73908709
EST63        173098     101006837
EST64        151292     80215211
EST65        151220     84186361
EST66        158892     99316107
EST67        137479     78915258
EST68        143240     84922517
EST69        196186     109253618
EST7         169775     72697086
EST70        198126     103953949
EST71        211365     118555009
EST72        192281     113476242
EST73        193706     114094453
EST74        160342     86278224
EST75        133181     62204678
EST76        137021     68781156
EST77        158506     108081737
EST78        155586     85626440
EST79        144511     78802218
EST8         179411     72878020
EST80        55934      37684094
EST81        182786     94238257
EST82        211431     123438760
EST83        213918     114879198
EST84        209610     98597600
EST85        208703     91048217
EST86        148593     90296846
EST87        144385     83799968
EST88        162629     81147372
EST89        159993     80847510
EST9         168509     69274895
EST90        152211     103118766
EST91        152437     99421204
EST92        133249     75476526
EST93        152415     115351352
EST94        141961     104565652
EST95        145449     105524103
EST96        139304     88076011
EST97        153213     86334490
EST98        174567     107209432
EST99        243917     149475955
GSS1         200065     87618868
GSS10        132040     60283372
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167238     128921102
GSS104       149783     82569304
GSS105       191527     120854119
GSS106       167754     112128998
GSS107       197330     115526115
GSS108       205012     134790946
GSS109       209809     138230024
GSS11        137026     73963307
GSS110       207577     140850185
GSS111       206236     142442852
GSS112       205252     143735676
GSS113       205173     143941544
GSS114       202120     146640193
GSS115       182320     139878966
GSS116       18374      10853427
GSS117       132848     84052151
GSS118       169611     80019194
GSS119       185717     80451589
GSS12        147892     75892162
GSS120       170455     148555237
GSS121       178389     121690874
GSS122       184689     149588588
GSS123       191663     124231606
GSS124       187042     137242702
GSS125       191042     125969607
GSS126       189842     96322354
GSS127       166122     152379462
GSS128       164222     116013846
GSS129       74198      50089663
GSS13        145409     68614697
GSS130       171037     155484916
GSS131       172774     154164468
GSS132       172083     155542955
GSS133       173759     154345682
GSS134       174370     152390350
GSS135       183822     145923124
GSS136       179510     145497392
GSS137       163809     112574762
GSS138       221300     81367276
GSS139       265738     40935252
GSS14        169811     84778686
GSS140       265734     40946510
GSS141       43700      6697365
GSS142       259296     57807938
GSS143       241895     68223975
GSS144       89187      49159213
GSS145       87117      64024027
GSS146       83555      62806406
GSS147       103687     48624686
GSS148       68564      58466330
GSS149       7626       6989548
GSS15        161103     97665015
GSS150       68591      57924394
GSS151       69224      56650935
GSS152       69460      56187403
GSS153       71202      55998401
GSS154       68561      51865315
GSS155       75915      58209304
GSS156       87237      74898207
GSS157       81830      44609896
GSS158       92677      45029689
GSS159       63209      47603494
GSS16        172837     87031541
GSS160       77435      61351403
GSS161       69655      58699293
GSS162       67711      62706526
GSS163       62009      53369632
GSS164       95592      42925428
GSS165       21061      4909542
GSS166       112938     70877522
GSS167       822        559311
GSS168       23226      28867035
GSS169       109043     70652585
GSS17        183525     113506663
GSS170       84533      34668223
GSS171       35815      22222733
GSS172       103304     62490220
GSS173       102329     63761256
GSS174       104268     67656826
GSS175       82099      41276456
GSS176       83102      54651503
GSS177       95673      61335435
GSS178       107323     78547443
GSS179       106375     76684757
GSS18        192359     114303278
GSS180       106058     79947480
GSS181       103996     80016519
GSS182       76374      51039123
GSS183       104572     63292187
GSS184       109868     66415305
GSS185       106205     59313311
GSS186       68379      37446344
GSS187       69561      38732329
GSS188       37157      17778905
GSS189       85481      46023427
GSS19        114051     52089836
GSS190       97119      55907586
GSS191       94982      49597190
GSS192       96286      55922591
GSS193       42132      23615490
GSS194       114638     43642267
GSS195       117085     39368203
GSS196       108676     55514545
GSS197       101471     78372335
GSS198       67717      43620427
GSS199       95891      36542252
GSS2         182294     92190805
GSS20        181789     101771260
GSS200       95417      37268709
GSS201       96671      35161518
GSS202       94285      39167432
GSS203       37736      17626556
GSS204       103939     66277823
GSS205       94551      61190929
GSS206       95128      60357048
GSS207       94773      60868501
GSS208       75675      70017159
GSS209       75117      74330280
GSS21        166208     114173594
GSS210       4473       7127270
GSS211       83736      28233267
GSS212       84219      27346468
GSS213       84926      25909272
GSS214       14851      4422302
GSS215       16547      7508221
GSS216       92648      59635081
GSS217       84624      52490775
GSS218       94061      50735685
GSS219       88579      48354065
GSS22        169506     97609042
GSS220       10731      5841916
GSS221       90648      56882510
GSS222       89662      61882079
GSS223       88553      63641206
GSS224       89283      62505584
GSS225       9890       7129098
GSS226       87995      63795538
GSS227       90217      62488977
GSS228       94638      59913510
GSS229       74308      63032786
GSS23        187251     126687349
GSS230       84243      78882674
GSS231       83029      80585163
GSS232       70505      52672246
GSS233       117650     64297121
GSS234       108874     55446727
GSS235       107533     52125503
GSS236       96658      43251344
GSS237       109801     49060015
GSS238       98194      46325477
GSS239       73059      72225597
GSS24        194057     130219707
GSS240       76682      71142435
GSS241       72980      46435649
GSS242       94787      57200301
GSS243       93517      59081345
GSS244       93900      58510429
GSS245       94714      57307691
GSS246       94279      58016121
GSS247       6701       3333254
GSS25        177481     105207105
GSS26        185884     107785085
GSS27        170583     151385030
GSS28        190501     146251023
GSS29        151128     106428647
GSS3         174947     87827485
GSS30        192461     132146551
GSS31        13682      8806511
GSS32        196017     127304082
GSS33        216657     116234308
GSS34        218576     113599632
GSS35        219719     112026888
GSS36        213961     121893034
GSS37        198561     156434502
GSS38        194991     146802828
GSS39        197249     73382791
GSS4         167154     85100946
GSS40        185072     97679213
GSS41        189780     125956632
GSS42        170343     158772213
GSS43        9065       5893881
GSS44        183999     100320381
GSS45        173031     121666603
GSS46        185089     124654949
GSS47        190835     122398659
GSS48        70734      62565384
GSS49        171799     101963548
GSS5         53442      31615955
GSS50        167647     103037030
GSS51        167798     102616122
GSS52        184194     121477291
GSS53        184774     116632196
GSS54        181686     122485290
GSS55        187531     113994336
GSS56        189392     134519036
GSS57        178947     104938173
GSS58        195715     120562907
GSS59        179925     133347062
GSS6         161617     84471320
GSS60        1898       1718384
GSS61        172927     139004649
GSS62        161633     111556933
GSS63        161679     111560086
GSS64        158740     107545551
GSS65        156768     129062324
GSS66        170185     142553826
GSS67        179844     117096102
GSS68        204956     127989095
GSS69        193312     110751728
GSS7         165323     79361698
GSS70        244049     126053657
GSS71        160164     106280071
GSS72        159390     119843139
GSS73        162663     124539223
GSS74        162628     124600532
GSS75        175121     108963120
GSS76        190291     140108442
GSS77        12971      7538114
GSS78        199135     126616367
GSS79        170370     111603100
GSS8         165782     88979927
GSS80        200718     131518447
GSS81        214948     86011305
GSS82        187080     100057507
GSS83        131104     91989085
GSS84        146939     117974637
GSS85        139562     116979023
GSS86        142823     114217730
GSS87        143960     119802766
GSS88        141946     115786817
GSS89        104815     87300351
GSS9         137999     67157686
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        64111      67397424
HTC11        74630      76211206
HTC12        21349      31170896
HTC13        66997      61008541
HTC14        68335      69516000
HTC15        22003      15289999
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         62290      77331613
HTG1         1318       188771164
HTG10        1298       186333849
HTG100       990        189440077
HTG101       996        189310369
HTG102       985        189405998
HTG103       1161       190529146
HTG104       30         4187142
HTG105       1090       189522880
HTG106       1040       189758928
HTG107       1394       191388699
HTG108       1301       190943512
HTG109       1620       191205597
HTG11        6          837687
HTG110       1385       191892180
HTG111       1292       192301514
HTG112       1297       189651930
HTG113       1060       185653516
HTG114       629        101857856
HTG115       1513       182381556
HTG116       992        192258010
HTG117       929        180600602
HTG118       1076       193795486
HTG119       1103       193114123
HTG12        1451       183826000
HTG120       232        43675540
HTG121       1029       189547972
HTG122       1053       192637550
HTG123       1165       192104964
HTG124       1082       193002672
HTG125       1079       192982070
HTG126       636        111615589
HTG127       1121       192664147
HTG128       1081       192356827
HTG129       1078       192401949
HTG13        875        191579912
HTG130       1135       192146132
HTG131       1039       192291101
HTG132       1074       192029023
HTG133       1056       192460538
HTG134       1141       191368556
HTG135       1280       187597174
HTG136       64         4636333
HTG14        753        192058598
HTG15        745        191952430
HTG16        786        192030578
HTG17        798        191870220
HTG18        774        191882457
HTG19        2069       170825721
HTG2         2470       186037380
HTG20        1096       187418197
HTG21        888        180107836
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190511648
HTG29        939        189964220
HTG3         2513       185208586
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189503995
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191697068
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2550       188439001
HTG40        1049       189067496
HTG41        1089       167518469
HTG42        1257       188188838
HTG43        1169       188132191
HTG44        1150       188026157
HTG45        1118       191332771
HTG46        1269       190703866
HTG47        1174       190717160
HTG48        1130       191137302
HTG49        1047       191184441
HTG5         1283       185453274
HTG50        1024       189658759
HTG51        1054       180030553
HTG52        969        190090757
HTG53        1106       190158225
HTG54        1046       190278289
HTG55        1014       189831932
HTG56        969        189155086
HTG57        82         14402517
HTG58        1010       189344282
HTG59        1031       190037155
HTG6         1273       185124562
HTG60        1072       187359162
HTG61        1129       188210893
HTG62        997        172674612
HTG63        1086       189585086
HTG64        1065       189567157
HTG65        1169       188828767
HTG66        1178       187478964
HTG67        1283       184490539
HTG68        95         12336833
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187658245
HTG73        1023       170809051
HTG74        1118       188295824
HTG75        1103       190843621
HTG76        1136       190816822
HTG77        1182       190887841
HTG78        1099       186602762
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190062476
HTG81        1214       189987246
HTG82        1120       189706900
HTG83        958        164506501
HTG84        1228       188383308
HTG85        1251       187687552
HTG86        1142       189936537
HTG87        1145       189669894
HTG88        981        168316109
HTG89        1183       189859637
HTG9         1200       186916809
HTG90        1104       190250569
HTG91        1145       190090446
HTG92        1104       190500681
HTG93        981        161863115
HTG94        1056       190715130
HTG95        1159       191053096
HTG96        1034       189071731
HTG97        1070       189559758
HTG98        690        128563367
HTG99        1018       189641315
INV1         94105      48358518
INV10        83888      65316908
INV11        53165      42301869
INV12        85016      66304270
INV13        80889      67010964
INV14        78399      68053388
INV15        43271      39803712
INV16        8168       145023213
INV17        320        155148771
INV18        28268      118189299
INV19        14190      140156143
INV2         13509      166390856
INV20        35502      121146294
INV21        78229      57051000
INV22        73818      62927787
INV23        36784      23995121
INV24        78033      56695694
INV25        73916      49072741
INV26        74865      50627615
INV27        72441      49494854
INV28        71903      47573166
INV29        56277      73100531
INV3         1429       154345747
INV30        9422       48274498
INV4         10911      132549432
INV5         76746      74818709
INV6         56481      86936780
INV7         43549      79487453
INV8         80631      71824074
INV9         59388      86021212
MAM1         14817      162818538
MAM2         23857      152410734
MAM3         55148      88433877
MAM4         17690      170595231
MAM5         78768      74315662
MAM6         56656      114247092
MAM7         28068      23424555
PAT1         222548     70116882
PAT10        124490     102559093
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224731     34113482
PAT109       250080     15844362
PAT11        98582      64113569
PAT110       180680     63680037
PAT111       51647      26043244
PAT112       114191     110462189
PAT113       137703     83280548
PAT114       164155     99346275
PAT115       158877     103325984
PAT116       137417     114988187
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142065     62828791
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105888     59875034
PAT130       44618      171217879
PAT131       32863      178783372
PAT132       101779     136605525
PAT133       185919     90675669
PAT134       40991      10533134
PAT135       203659     47736667
PAT136       277827     9628431
PAT137       220409     46465135
PAT138       106723     2881242
PAT139       270386     21672571
PAT14        103650     50160806
PAT140       186752     61240505
PAT141       109806     106057338
PAT142       47510      9549213
PAT143       87299      88249520
PAT144       78465      95588128
PAT145       145203     77694924
PAT146       167502     71382965
PAT147       121478     92946121
PAT148       102970     85396699
PAT149       165555     45999641
PAT15        121150     53321659
PAT150       270022     5130418
PAT151       269978     5129582
PAT152       269978     5129582
PAT153       237888     4519872
PAT154       269396     5118524
PAT155       235715     25782943
PAT156       204520     46982479
PAT157       11012      386670
PAT158       165317     74871979
PAT159       91688      126658582
PAT16        113145     61277722
PAT160       172595     71660689
PAT161       176373     73735662
PAT162       90005      126442546
PAT163       161045     78412777
PAT164       5451       2786631
PAT17        39141      16227175
PAT18        146771     52594264
PAT19        153705     78039102
PAT2         194541     84646269
PAT20        104995     118172564
PAT21        133550     95503155
PAT22        84598      79322013
PAT23        123566     103406367
PAT24        119412     105655419
PAT25        145492     86671235
PAT26        175170     64298181
PAT27        71360      1784000
PAT28        102171     77387698
PAT29        93958      87647590
PAT3         171983     95895053
PAT30        119942     61671615
PAT31        96648      78966734
PAT32        128385     55032969
PAT33        92206      51116228
PAT34        111299     78151838
PAT35        138103     29119101
PAT36        158499     24085905
PAT37        114684     49015396
PAT38        44863      54579873
PAT39        95734      83197609
PAT4         153735     106065154
PAT40        100230     70978875
PAT41        136206     39303264
PAT42        143780     35446924
PAT43        123733     64747040
PAT44        104353     81197501
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57193      23949203
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92812      89404206
PAT59        106517     74781811
PAT6         170642     91909261
PAT60        122361     64031080
PAT61        67425      30297598
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154786     88238970
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131210     96924023
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        93691      93465245
PAT84        34070      33980300
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164903     19209995
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129398     101135301
PAT90        175304     3330776
PAT91        101387     1926353
PAT92        169171     12412246
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140780     2674820
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6010       54287813
PLN1         59893      93478848
PLN10        37384      49321439
PLN11        40299      65748766
PLN12        22455      124054133
PLN13        21102      99347489
PLN14        17578      144865462
PLN15        17634      146278605
PLN16        17564      146392665
PLN17        24586      128622194
PLN18        6000       149205408
PLN19        1266       170315035
PLN2         32516      124586090
PLN20        14362      155620121
PLN21        6893       8116708
PLN22        67273      69787754
PLN23        29373      31550432
PLN24        77010      76401076
PLN25        65434      81419582
PLN26        41006      115887323
PLN27        32         71904925
PLN28        828        90039722
PLN29        24837      128290004
PLN3         1364       179434193
PLN30        22393      130882948
PLN31        77409      75365215
PLN32        99030      57861332
PLN33        27175      28515711
PLN34        80705      71328623
PLN35        78006      75876424
PLN36        80042      70388776
PLN37        81922      75966126
PLN38        47486      24741812
PLN39        101386     57355746
PLN4         1861       186095662
PLN40        80556      70099451
PLN41        45787      99189301
PLN42        17616      144051825
PLN43        61498      91644320
PLN44        82026      72182691
PLN45        78515      71898437
PLN46        84035      62141119
PLN47        75812      73927711
PLN48        37694      67061947
PLN5         1844       194307946
PLN6         1797       192283335
PLN7         58435      93138241
PLN8         39967      38104243
PLN9         73118      75865576
PRI1         23016      59646733
PRI10        1278       179364533
PRI11        760        92321122
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193649117
PRI18        1098       194157243
PRI19        1165       193624176
PRI2         18071      149564618
PRI20        1751       191797566
PRI21        2705       189576657
PRI22        21110      117963601
PRI23        32189      85194360
PRI24        61520      78165289
PRI25        30701      68932580
PRI26        6591       166738065
PRI27        2118       180651014
PRI28        1602       181630351
PRI29        2026       181733036
PRI3         1434       175236111
PRI30        1967       180488471
PRI31        13163      154018852
PRI32        1296       183210240
PRI33        43528      104497904
PRI34        21723      27586271
PRI35        32189      63608729
PRI36        20251      117460287
PRI37        18661      146846887
PRI38        66810      86782670
PRI39        49678      89403265
PRI4         1286       185640768
PRI40        38730      71447417
PRI41        56809      86902576
PRI42        44847      82692307
PRI5         1320       184150058
PRI6         1182       180046846
PRI7         1247       181145824
PRI8         1214       178287408
PRI9         1362       174588443
ROD1         32234      140799970
ROD10        987        181481529
ROD11        232        44057446
ROD12        1034       185475616
ROD13        940        182704112
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185812687
ROD18        1190       190433525
ROD19        16848      137787519
ROD2         915        175393752
ROD20        20213      148416187
ROD21        1135       182126583
ROD22        1067       166443935
ROD23        13615      162601089
ROD24        38730      69919496
ROD25        21989      103762409
ROD26        1519       187646657
ROD27        133914     37772022
ROD28        84400      70219346
ROD29        37777      42828777
ROD3         905        173299235
ROD4         900        173792415
ROD5         923        174315076
ROD6         966        178209811
ROD7         968        179457909
ROD8         979        181267813
ROD9         994        181774273
STS1         85281      36762778
STS10        57907      44419975
STS11        48899      37494991
STS12        57924      43637361
STS13        64508      42945539
STS14        94031      34249403
STS15        104277     26529909
STS16        9476       2568271
STS17        103611     27476228
STS18        86930      34448685
STS19        99734      33367534
STS2         84353      49850244
STS20        54198      20560211
STS3         67110      26414958
STS4         76828      36949991
STS5         8356       4902803
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55727      37775857
SYN1         44165      73396773
SYN2         48685      68947579
SYN3         5842       10961296
TSA1         120497     38242009
TSA10        114745     46902618
TSA11        86486      70566494
TSA12        121991     38853496
TSA13        134868     35825115
TSA14        60971      79702835
TSA15        39395      53450233
TSA16        88109      76513628
TSA17        105624     51396283
TSA18        103747     54301544
TSA19        107474     46456288
TSA2         113528     41669914
TSA20        31302      21267476
TSA21        69303      60110081
TSA22        91420      63773811
TSA23        82796      86084394
TSA24        90673      68550984
TSA25        37158      30293914
TSA26        118273     46635529
TSA27        90618      69209954
TSA28        94274      69902690
TSA29        93641      71486117
TSA3         110398     41017904
TSA30        6422       3949605
TSA4         110951     45737363
TSA5         43154      10919402
TSA6         112617     59544561
TSA7         95600      66338635
TSA8         105789     68711723
TSA9         106966     66829062
UNA1         239        125912
VRL1         68929      68423438
VRL10        55870      73247652
VRL11        9424       11321394
VRL12        62663      71300528
VRL13        58322      72592353
VRL14        62724      65431464
VRL15        59581      72969504
VRL16        58363      71484601
VRL17        58937      75344007
VRL18        29705      27525261
VRL2         73813      64007445
VRL3         69467      61217254
VRL4         68065      70354123
VRL5         44835      46897999
VRL6         48308      77572131
VRL7         56023      71496840
VRL8         63404      71384181
VRL9         66789      68756692
VRT1         37747      129977466
VRT10        1256       189217442
VRT11        8274       177839690
VRT12        3993       136596069
VRT13        13095      170781188
VRT14        5353       182590497
VRT15        3933       185932353
VRT16        37736      134386262
VRT17        79862      68489713
VRT18        78479      66474161
VRT19        29983      24362251
VRT2         6878       185291420
VRT20        69550      80551884
VRT21        49822      116403022
VRT22        75854      63478254
VRT23        76543      60322130
VRT24        11400      10789674
VRT3         66895      85202097
VRT4         12596      164092518
VRT5         27001      21326854
VRT6         73007      66822336
VRT7         31734      63524549
VRT8         30670      111983994
VRT9         1203       190000786

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 184.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

19212713 15779269456   Homo sapiens
9058978   9032978610   Mus musculus
2186632   6501046598   Rattus norvegicus
2199019   5381035749   Bos taurus
3925973   5054346444   Zea mays
3221535   4797711307   Sus scrofa
1705068   3127769453   Danio rerio
228264    1352945341   Strongylocentrotus purpuratus
1342034   1250435330   Oryza sativa Japonica Group
1770154   1194814175   Nicotiana tabacum
1424323   1147234009   Xenopus (Silurana) tropicalis
2320917   1136991872   Arabidopsis thaliana
1223998   1058262648   Drosophila melanogaster
214215    1002723209   Pan troglodytes
1454123    944022415   Canis lupus familiaris
662423     915245634   Vitis vinifera
811468     895067303   Gallus gallus
1890104    894979019   Glycine max
82695      827070417   Macaca mulatta
738269     760148243   Solanum lycopersicum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 184.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 184.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Gert Roosen, Susan Schafer,
	Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
	Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade,	Constantin Vasilyev

User Support
	Peter Cooper, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center