Release Notes For GenBank Release 185

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2011

               NCBI-GenBank Flat File Release 185.0

                    Distribution Release Notes

 142284608 loci, 130671233801 bases, from 142284608 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 185.0
1.2 Cutoff Date
1.3 Important Changes in Release 185.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 185.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 185.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 185.0, incorporates data available to the collaborating
databases as of August 14, 2011 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 185.0

1.3.1 Organizational changes

The total number of sequence data files increased by 19 with this release:

  - the BCT division is now composed of  75 files (+3)
  - the ENV division is now composed of  42 files (+2)
  - the EST division is now composed of 447 files (+2)
  - the GSS division is now composed of 248 files (+1)
  - the HTG division is now composed of 135 files (-1)
  - the INV division is now composed of  31 files (+1)
  - the PAT division is now composed of 168 files (+4)
  - the PLN division is now composed of  50 files (+2)
  - the TSA division is now composed of  35 files (+5)

On rare occasions, the number of HTG files decreases when a significant
number of HTG records 'graduate' to Phase 3, at which point they move to
a non-HTG division.

The total number of 'index' files increased by 2 with this release:

  - the AUT (author name) index is now composed of 89 files (+1)
  - the KEY (keyword)     index is now composed of  6 files (+1)

1.3.2 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 185.0. Consider gbgss146.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                          August 15 2011

                NCBI-GenBank Flat File Release 185.0

                           GSS Sequences (Part 1)

   87126 loci,    64015147 bases, from    87126 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "146" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Implementation of /whole_replicon qualifier abandoned

  The introduction of a /whole_replicon qualifier was approved by the
International Nucleotide Sequence Database Collaboration during their
annual collaborative meeting in May 2010. However, implementation of the
new qualifer proved more difficult than expected, with a growing and
complex list of conditions under which /whole_replicon would *not* be
appropriate. Rather than continue to define what /whole_replicon is
not intended for, the INSDC has decided to make use of improved submission
processes which allow users to explicitly identify the "genome-level"
molecules (eg, chromosomes) that should be shown in the topmost view
of an organism's genome. Furthermore, given the implementation of
BioProject databases within the INSD, the exchange of project data 
among the INSD members will include provision for indicating, explicitly,
the sequence records which represent "genome-level" molecules. With
these plans in place, it was agreed to abandon plans for the 
/whole_replicon qualifier at the May 2011 INSDC annual meeting.

1.4.2 New centromere and telomere features

  Telomeres and centromeres are essential features of chromosomes and
disrupting their structure affects the viability and life span of an
organism. Centromeric sequence varies from a compact, non-repetitive,
less than 150 base pair region in S. cerevisiae to a highly repetitive 
and complex region of several hundred thousands of base pairs in
eukaryote genomes. The sequence at the telomeric ends is unique compared
to the rest of the chromosome and protects the chromosome ends from
recombination, fusion to other chromosomes or degradation by nucleases.
Currently telomere and centromere features may be under-annotated since
there are no specific feature keys for them, hence the INSDC approved
the creation of two new features at the May 2011 INSDC annual meeting:

Feature Key          centromere
Definition           region of biological interest identified as a centromere 
                     and which have been experimentally characterized;

Optional qualifiers  /note="text"
Comment              the centromere feature describes the interval of DNA 
                     that corresponds to a region where chromatids are held 
                     and a kinetochore is formed; 

Feature Key          telomere
Definition           region of biological interest identified as a telomere 
                     and which have been experimentally characterized;

Optional qualifiers  /note="text"
                     /rpt_unit_seq
                     /rpt_unit_range
                     /rpt_type
                     /mobile_element
Comment              the telomere feature describes the interval of DNA 
                     that corresponds to a specific structure at the end of   
                     the linear eukaryotic chromosome which is required for 
                     the integrity and maintenance of the end; this region is 
                     unique compared to the rest of the chromosome and
                     represent the physical end of the chromosome;

  These two features are intended for use when the centromere or telomere
have been actually been sequenced. These two new features will be legal as
of the GenBank Release 186.0 (October 15 2011).

1.4.3 New assembly_gap feature, and /gap_type and /linkage_evidence qualifiers

  Complete genomes are often submitted to the INSDC via a small (or large)
set of independent sequence records, which can be assembled into chromosomes
and/or scaffolds. The CON-division records representing these scaffolds
and chromosomes are usually built using information provided in "AGP files"
provided by the submitter. See:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genome/assembly/agp/AGP_Update.shtml

  The AGP 2.0 specification includes provisions for a variety of different
gap types, as well as information about whether a gap between two
scaffold or chromosome components is an unspanned gap or a spanned gap.
There is also biological gap-types: telomere, centromere and repeat.
AGP 2.0 also supports terminology to describe the type of evidence used
to establish the linkage connecting the components on either side of a
spanned gap within a scaffold or chromosome. Unfortunately, there is no
mechanism to represent any of this information in the Feature Table.

  To address this, the INSDC has decided to implement an assembly_gap
feature, and /gap_type and /linkage_evidence qualifiers, all of which
will be legal as of October 15 2011 (GenBank Release 186.0). 

  Preliminary definitions of the two new qualifiers are as follows:

Qualifier       /gap_type=
Definition      kind of gap connecting components, or the type of biological gaps
Value format    "TYPE"
Example         /gap_type="between scaffolds" 
                /gap_type="within scaffold"
Comment         The qualifier is just for gap features. TYPE is a controlled 
                vocabulary:
	
                "between scaffolds"
                "within scaffold"
                "telomere"
                "centromere"
                "short arm"
                "heterochromatin"
                "repeat within scaffold"
                "repeat between scaffolds"


Qualifier       /linkage_evidence=
Definition      kind of evidence establishing linkage across a gap
Value format    "TYPE"
Example         /linkage_evidence="paired-ends" 
                /linkage_evidence="within_clone"
Comment         The qualifier is just for gap features of type "within 
                scaffold" or "repeat within scaffold". TYPE is a controlled 
                vocabulary, from the new AGP Specification version 2.0 :

"paired_ends"   - paired sequences from the two ends of a DNA fragment.
"align_genus"   - alignment to a reference genome within the same genus.
"align_xgenus"  - alignment to a reference genome within another genus.
"align_trnscpt" - alignment to a transcript from the same species.
"within_clone"  - sequence on both sides of the gap is derived from the 
                  same clone, but the gap is not spanned by paired-ends. 
                  The adjacent sequence contigs have unknown order and 
                  orientation.
"clone_contig"  - linkage is provided by a clone contig in the tiling path 
                  (TPF). For example, a gap where there is a known clone, but 
                  there is not yet sequence for that clone.
"map"           - linkage asserted using a non-sequence based map such as RH, 
                  linkage, fingerprint or optical.
"strobe"        - strobe sequencing (PacBio).
"unspecified"   - used when converting old AGPs that lack a field for linkage 
                  evidence into the new format.

  Because there are existing CON-division records with gaps that are not
based on information derived from an AGP file, it was agreed that a new
feature should be introduced that will make use of these new qualifiers:

	assembly_gap

  A complete definition for this feature is not yet available, but we will
inform GenBank users as soon as it is finalized. Both /gap_type and
/linkage_evidence are expected to be mandatory for the assembly_gap feature.

  The new centromere and telomere features (see Section 1.4.2) should 
only be used when the actual sequence of a centromere/telomere has been
determined. If this is not the case, then an assembly_gap feature with
a /gap_type of "centromere" or "telomere" should be used instead.
  
1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1659 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbbct1.seq - Bacterial sequence entries, part 1.
94. gbbct10.seq - Bacterial sequence entries, part 10.
95. gbbct11.seq - Bacterial sequence entries, part 11.
96. gbbct12.seq - Bacterial sequence entries, part 12.
97. gbbct13.seq - Bacterial sequence entries, part 13.
98. gbbct14.seq - Bacterial sequence entries, part 14.
99. gbbct15.seq - Bacterial sequence entries, part 15.
100. gbbct16.seq - Bacterial sequence entries, part 16.
101. gbbct17.seq - Bacterial sequence entries, part 17.
102. gbbct18.seq - Bacterial sequence entries, part 18.
103. gbbct19.seq - Bacterial sequence entries, part 19.
104. gbbct2.seq - Bacterial sequence entries, part 2.
105. gbbct20.seq - Bacterial sequence entries, part 20.
106. gbbct21.seq - Bacterial sequence entries, part 21.
107. gbbct22.seq - Bacterial sequence entries, part 22.
108. gbbct23.seq - Bacterial sequence entries, part 23.
109. gbbct24.seq - Bacterial sequence entries, part 24.
110. gbbct25.seq - Bacterial sequence entries, part 25.
111. gbbct26.seq - Bacterial sequence entries, part 26.
112. gbbct27.seq - Bacterial sequence entries, part 27.
113. gbbct28.seq - Bacterial sequence entries, part 28.
114. gbbct29.seq - Bacterial sequence entries, part 29.
115. gbbct3.seq - Bacterial sequence entries, part 3.
116. gbbct30.seq - Bacterial sequence entries, part 30.
117. gbbct31.seq - Bacterial sequence entries, part 31.
118. gbbct32.seq - Bacterial sequence entries, part 32.
119. gbbct33.seq - Bacterial sequence entries, part 33.
120. gbbct34.seq - Bacterial sequence entries, part 34.
121. gbbct35.seq - Bacterial sequence entries, part 35.
122. gbbct36.seq - Bacterial sequence entries, part 36.
123. gbbct37.seq - Bacterial sequence entries, part 37.
124. gbbct38.seq - Bacterial sequence entries, part 38.
125. gbbct39.seq - Bacterial sequence entries, part 39.
126. gbbct4.seq - Bacterial sequence entries, part 4.
127. gbbct40.seq - Bacterial sequence entries, part 40.
128. gbbct41.seq - Bacterial sequence entries, part 41.
129. gbbct42.seq - Bacterial sequence entries, part 42.
130. gbbct43.seq - Bacterial sequence entries, part 43.
131. gbbct44.seq - Bacterial sequence entries, part 44.
132. gbbct45.seq - Bacterial sequence entries, part 45.
133. gbbct46.seq - Bacterial sequence entries, part 46.
134. gbbct47.seq - Bacterial sequence entries, part 47.
135. gbbct48.seq - Bacterial sequence entries, part 48.
136. gbbct49.seq - Bacterial sequence entries, part 49.
137. gbbct5.seq - Bacterial sequence entries, part 5.
138. gbbct50.seq - Bacterial sequence entries, part 50.
139. gbbct51.seq - Bacterial sequence entries, part 51.
140. gbbct52.seq - Bacterial sequence entries, part 52.
141. gbbct53.seq - Bacterial sequence entries, part 53.
142. gbbct54.seq - Bacterial sequence entries, part 54.
143. gbbct55.seq - Bacterial sequence entries, part 55.
144. gbbct56.seq - Bacterial sequence entries, part 56.
145. gbbct57.seq - Bacterial sequence entries, part 57.
146. gbbct58.seq - Bacterial sequence entries, part 58.
147. gbbct59.seq - Bacterial sequence entries, part 59.
148. gbbct6.seq - Bacterial sequence entries, part 6.
149. gbbct60.seq - Bacterial sequence entries, part 60.
150. gbbct61.seq - Bacterial sequence entries, part 61.
151. gbbct62.seq - Bacterial sequence entries, part 62.
152. gbbct63.seq - Bacterial sequence entries, part 63.
153. gbbct64.seq - Bacterial sequence entries, part 64.
154. gbbct65.seq - Bacterial sequence entries, part 65.
155. gbbct66.seq - Bacterial sequence entries, part 66.
156. gbbct67.seq - Bacterial sequence entries, part 67.
157. gbbct68.seq - Bacterial sequence entries, part 68.
158. gbbct69.seq - Bacterial sequence entries, part 69.
159. gbbct7.seq - Bacterial sequence entries, part 7.
160. gbbct70.seq - Bacterial sequence entries, part 70.
161. gbbct71.seq - Bacterial sequence entries, part 71.
162. gbbct72.seq - Bacterial sequence entries, part 72.
163. gbbct73.seq - Bacterial sequence entries, part 73.
164. gbbct74.seq - Bacterial sequence entries, part 74.
165. gbbct75.seq - Bacterial sequence entries, part 75.
166. gbbct8.seq - Bacterial sequence entries, part 8.
167. gbbct9.seq - Bacterial sequence entries, part 9.
168. gbchg.txt - Accession numbers of entries updated since the previous release.
169. gbcon1.seq - Constructed sequence entries, part 1.
170. gbcon10.seq - Constructed sequence entries, part 10.
171. gbcon100.seq - Constructed sequence entries, part 100.
172. gbcon101.seq - Constructed sequence entries, part 101.
173. gbcon102.seq - Constructed sequence entries, part 102.
174. gbcon103.seq - Constructed sequence entries, part 103.
175. gbcon104.seq - Constructed sequence entries, part 104.
176. gbcon105.seq - Constructed sequence entries, part 105.
177. gbcon106.seq - Constructed sequence entries, part 106.
178. gbcon107.seq - Constructed sequence entries, part 107.
179. gbcon108.seq - Constructed sequence entries, part 108.
180. gbcon109.seq - Constructed sequence entries, part 109.
181. gbcon11.seq - Constructed sequence entries, part 11.
182. gbcon110.seq - Constructed sequence entries, part 110.
183. gbcon111.seq - Constructed sequence entries, part 111.
184. gbcon112.seq - Constructed sequence entries, part 112.
185. gbcon113.seq - Constructed sequence entries, part 113.
186. gbcon114.seq - Constructed sequence entries, part 114.
187. gbcon115.seq - Constructed sequence entries, part 115.
188. gbcon116.seq - Constructed sequence entries, part 116.
189. gbcon117.seq - Constructed sequence entries, part 117.
190. gbcon118.seq - Constructed sequence entries, part 118.
191. gbcon119.seq - Constructed sequence entries, part 119.
192. gbcon12.seq - Constructed sequence entries, part 12.
193. gbcon120.seq - Constructed sequence entries, part 120.
194. gbcon121.seq - Constructed sequence entries, part 121.
195. gbcon122.seq - Constructed sequence entries, part 122.
196. gbcon123.seq - Constructed sequence entries, part 123.
197. gbcon124.seq - Constructed sequence entries, part 124.
198. gbcon125.seq - Constructed sequence entries, part 125.
199. gbcon126.seq - Constructed sequence entries, part 126.
200. gbcon127.seq - Constructed sequence entries, part 127.
201. gbcon128.seq - Constructed sequence entries, part 128.
202. gbcon129.seq - Constructed sequence entries, part 129.
203. gbcon13.seq - Constructed sequence entries, part 13.
204. gbcon130.seq - Constructed sequence entries, part 130.
205. gbcon131.seq - Constructed sequence entries, part 131.
206. gbcon132.seq - Constructed sequence entries, part 132.
207. gbcon133.seq - Constructed sequence entries, part 133.
208. gbcon134.seq - Constructed sequence entries, part 134.
209. gbcon135.seq - Constructed sequence entries, part 135.
210. gbcon136.seq - Constructed sequence entries, part 136.
211. gbcon137.seq - Constructed sequence entries, part 137.
212. gbcon138.seq - Constructed sequence entries, part 138.
213. gbcon139.seq - Constructed sequence entries, part 139.
214. gbcon14.seq - Constructed sequence entries, part 14.
215. gbcon140.seq - Constructed sequence entries, part 140.
216. gbcon141.seq - Constructed sequence entries, part 141.
217. gbcon142.seq - Constructed sequence entries, part 142.
218. gbcon143.seq - Constructed sequence entries, part 143.
219. gbcon144.seq - Constructed sequence entries, part 144.
220. gbcon145.seq - Constructed sequence entries, part 145.
221. gbcon146.seq - Constructed sequence entries, part 146.
222. gbcon147.seq - Constructed sequence entries, part 147.
223. gbcon148.seq - Constructed sequence entries, part 148.
224. gbcon149.seq - Constructed sequence entries, part 149.
225. gbcon15.seq - Constructed sequence entries, part 15.
226. gbcon16.seq - Constructed sequence entries, part 16.
227. gbcon17.seq - Constructed sequence entries, part 17.
228. gbcon18.seq - Constructed sequence entries, part 18.
229. gbcon19.seq - Constructed sequence entries, part 19.
230. gbcon2.seq - Constructed sequence entries, part 2.
231. gbcon20.seq - Constructed sequence entries, part 20.
232. gbcon21.seq - Constructed sequence entries, part 21.
233. gbcon22.seq - Constructed sequence entries, part 22.
234. gbcon23.seq - Constructed sequence entries, part 23.
235. gbcon24.seq - Constructed sequence entries, part 24.
236. gbcon25.seq - Constructed sequence entries, part 25.
237. gbcon26.seq - Constructed sequence entries, part 26.
238. gbcon27.seq - Constructed sequence entries, part 27.
239. gbcon28.seq - Constructed sequence entries, part 28.
240. gbcon29.seq - Constructed sequence entries, part 29.
241. gbcon3.seq - Constructed sequence entries, part 3.
242. gbcon30.seq - Constructed sequence entries, part 30.
243. gbcon31.seq - Constructed sequence entries, part 31.
244. gbcon32.seq - Constructed sequence entries, part 32.
245. gbcon33.seq - Constructed sequence entries, part 33.
246. gbcon34.seq - Constructed sequence entries, part 34.
247. gbcon35.seq - Constructed sequence entries, part 35.
248. gbcon36.seq - Constructed sequence entries, part 36.
249. gbcon37.seq - Constructed sequence entries, part 37.
250. gbcon38.seq - Constructed sequence entries, part 38.
251. gbcon39.seq - Constructed sequence entries, part 39.
252. gbcon4.seq - Constructed sequence entries, part 4.
253. gbcon40.seq - Constructed sequence entries, part 40.
254. gbcon41.seq - Constructed sequence entries, part 41.
255. gbcon42.seq - Constructed sequence entries, part 42.
256. gbcon43.seq - Constructed sequence entries, part 43.
257. gbcon44.seq - Constructed sequence entries, part 44.
258. gbcon45.seq - Constructed sequence entries, part 45.
259. gbcon46.seq - Constructed sequence entries, part 46.
260. gbcon47.seq - Constructed sequence entries, part 47.
261. gbcon48.seq - Constructed sequence entries, part 48.
262. gbcon49.seq - Constructed sequence entries, part 49.
263. gbcon5.seq - Constructed sequence entries, part 5.
264. gbcon50.seq - Constructed sequence entries, part 50.
265. gbcon51.seq - Constructed sequence entries, part 51.
266. gbcon52.seq - Constructed sequence entries, part 52.
267. gbcon53.seq - Constructed sequence entries, part 53.
268. gbcon54.seq - Constructed sequence entries, part 54.
269. gbcon55.seq - Constructed sequence entries, part 55.
270. gbcon56.seq - Constructed sequence entries, part 56.
271. gbcon57.seq - Constructed sequence entries, part 57.
272. gbcon58.seq - Constructed sequence entries, part 58.
273. gbcon59.seq - Constructed sequence entries, part 59.
274. gbcon6.seq - Constructed sequence entries, part 6.
275. gbcon60.seq - Constructed sequence entries, part 60.
276. gbcon61.seq - Constructed sequence entries, part 61.
277. gbcon62.seq - Constructed sequence entries, part 62.
278. gbcon63.seq - Constructed sequence entries, part 63.
279. gbcon64.seq - Constructed sequence entries, part 64.
280. gbcon65.seq - Constructed sequence entries, part 65.
281. gbcon66.seq - Constructed sequence entries, part 66.
282. gbcon67.seq - Constructed sequence entries, part 67.
283. gbcon68.seq - Constructed sequence entries, part 68.
284. gbcon69.seq - Constructed sequence entries, part 69.
285. gbcon7.seq - Constructed sequence entries, part 7.
286. gbcon70.seq - Constructed sequence entries, part 70.
287. gbcon71.seq - Constructed sequence entries, part 71.
288. gbcon72.seq - Constructed sequence entries, part 72.
289. gbcon73.seq - Constructed sequence entries, part 73.
290. gbcon74.seq - Constructed sequence entries, part 74.
291. gbcon75.seq - Constructed sequence entries, part 75.
292. gbcon76.seq - Constructed sequence entries, part 76.
293. gbcon77.seq - Constructed sequence entries, part 77.
294. gbcon78.seq - Constructed sequence entries, part 78.
295. gbcon79.seq - Constructed sequence entries, part 79.
296. gbcon8.seq - Constructed sequence entries, part 8.
297. gbcon80.seq - Constructed sequence entries, part 80.
298. gbcon81.seq - Constructed sequence entries, part 81.
299. gbcon82.seq - Constructed sequence entries, part 82.
300. gbcon83.seq - Constructed sequence entries, part 83.
301. gbcon84.seq - Constructed sequence entries, part 84.
302. gbcon85.seq - Constructed sequence entries, part 85.
303. gbcon86.seq - Constructed sequence entries, part 86.
304. gbcon87.seq - Constructed sequence entries, part 87.
305. gbcon88.seq - Constructed sequence entries, part 88.
306. gbcon89.seq - Constructed sequence entries, part 89.
307. gbcon9.seq - Constructed sequence entries, part 9.
308. gbcon90.seq - Constructed sequence entries, part 90.
309. gbcon91.seq - Constructed sequence entries, part 91.
310. gbcon92.seq - Constructed sequence entries, part 92.
311. gbcon93.seq - Constructed sequence entries, part 93.
312. gbcon94.seq - Constructed sequence entries, part 94.
313. gbcon95.seq - Constructed sequence entries, part 95.
314. gbcon96.seq - Constructed sequence entries, part 96.
315. gbcon97.seq - Constructed sequence entries, part 97.
316. gbcon98.seq - Constructed sequence entries, part 98.
317. gbcon99.seq - Constructed sequence entries, part 99.
318. gbdel.txt - Accession numbers of entries deleted since the previous release.
319. gbenv1.seq - Environmental sampling sequence entries, part 1.
320. gbenv10.seq - Environmental sampling sequence entries, part 10.
321. gbenv11.seq - Environmental sampling sequence entries, part 11.
322. gbenv12.seq - Environmental sampling sequence entries, part 12.
323. gbenv13.seq - Environmental sampling sequence entries, part 13.
324. gbenv14.seq - Environmental sampling sequence entries, part 14.
325. gbenv15.seq - Environmental sampling sequence entries, part 15.
326. gbenv16.seq - Environmental sampling sequence entries, part 16.
327. gbenv17.seq - Environmental sampling sequence entries, part 17.
328. gbenv18.seq - Environmental sampling sequence entries, part 18.
329. gbenv19.seq - Environmental sampling sequence entries, part 19.
330. gbenv2.seq - Environmental sampling sequence entries, part 2.
331. gbenv20.seq - Environmental sampling sequence entries, part 20.
332. gbenv21.seq - Environmental sampling sequence entries, part 21.
333. gbenv22.seq - Environmental sampling sequence entries, part 22.
334. gbenv23.seq - Environmental sampling sequence entries, part 23.
335. gbenv24.seq - Environmental sampling sequence entries, part 24.
336. gbenv25.seq - Environmental sampling sequence entries, part 25.
337. gbenv26.seq - Environmental sampling sequence entries, part 26.
338. gbenv27.seq - Environmental sampling sequence entries, part 27.
339. gbenv28.seq - Environmental sampling sequence entries, part 28.
340. gbenv29.seq - Environmental sampling sequence entries, part 29.
341. gbenv3.seq - Environmental sampling sequence entries, part 3.
342. gbenv30.seq - Environmental sampling sequence entries, part 30.
343. gbenv31.seq - Environmental sampling sequence entries, part 31.
344. gbenv32.seq - Environmental sampling sequence entries, part 32.
345. gbenv33.seq - Environmental sampling sequence entries, part 33.
346. gbenv34.seq - Environmental sampling sequence entries, part 34.
347. gbenv35.seq - Environmental sampling sequence entries, part 35.
348. gbenv36.seq - Environmental sampling sequence entries, part 36.
349. gbenv37.seq - Environmental sampling sequence entries, part 37.
350. gbenv38.seq - Environmental sampling sequence entries, part 38.
351. gbenv39.seq - Environmental sampling sequence entries, part 39.
352. gbenv4.seq - Environmental sampling sequence entries, part 4.
353. gbenv40.seq - Environmental sampling sequence entries, part 40.
354. gbenv41.seq - Environmental sampling sequence entries, part 41.
355. gbenv42.seq - Environmental sampling sequence entries, part 42.
356. gbenv5.seq - Environmental sampling sequence entries, part 5.
357. gbenv6.seq - Environmental sampling sequence entries, part 6.
358. gbenv7.seq - Environmental sampling sequence entries, part 7.
359. gbenv8.seq - Environmental sampling sequence entries, part 8.
360. gbenv9.seq - Environmental sampling sequence entries, part 9.
361. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
362. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
363. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
364. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
365. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
366. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
367. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
368. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
369. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
370. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
371. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
372. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
373. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
374. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
375. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
376. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
377. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
378. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
379. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
380. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
381. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
382. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
383. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
384. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
385. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
386. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
387. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
388. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
389. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
390. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
391. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
392. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
393. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
394. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
395. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
396. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
397. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
398. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
399. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
400. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
401. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
402. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
403. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
404. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
405. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
406. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
407. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
408. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
409. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
410. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
411. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
412. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
413. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
414. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
415. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
416. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
417. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
418. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
419. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
420. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
421. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
422. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
423. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
424. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
425. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
426. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
427. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
428. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
429. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
430. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
431. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
432. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
433. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
434. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
435. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
436. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
437. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
438. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
439. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
440. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
441. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
442. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
443. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
444. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
445. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
446. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
447. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
448. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
449. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
450. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
451. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
452. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
453. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
454. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
455. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
456. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
457. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
458. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
459. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
460. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
461. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
462. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
463. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
464. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
465. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
466. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
467. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
468. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
469. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
470. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
471. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
472. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
473. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
474. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
475. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
476. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
477. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
478. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
479. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
480. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
481. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
482. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
483. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
484. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
485. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
486. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
487. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
488. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
489. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
490. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
491. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
492. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
493. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
494. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
495. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
496. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
497. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
498. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
499. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
500. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
501. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
502. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
503. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
504. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
505. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
506. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
507. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
508. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
509. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
510. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
511. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
512. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
513. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
514. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
515. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
516. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
517. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
518. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
519. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
520. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
521. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
522. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
523. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
524. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
525. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
526. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
527. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
528. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
529. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
530. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
531. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
532. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
533. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
534. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
535. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
536. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
537. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
538. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
539. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
540. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
541. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
542. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
543. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
544. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
545. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
546. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
547. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
548. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
549. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
550. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
551. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
552. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
553. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
554. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
555. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
556. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
557. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
558. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
559. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
560. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
561. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
562. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
563. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
564. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
565. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
566. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
567. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
568. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
569. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
570. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
571. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
572. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
573. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
574. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
575. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
576. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
577. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
578. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
579. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
580. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
581. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
582. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
583. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
584. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
585. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
586. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
587. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
588. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
589. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
590. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
591. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
592. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
593. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
594. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
595. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
596. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
597. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
598. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
599. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
600. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
601. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
602. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
603. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
604. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
605. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
606. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
607. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
608. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
609. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
610. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
611. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
612. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
613. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
614. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
615. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
616. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
617. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
618. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
619. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
620. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
621. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
622. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
623. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
624. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
625. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
626. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
627. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
628. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
629. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
630. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
631. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
632. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
633. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
634. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
635. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
636. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
637. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
638. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
639. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
640. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
641. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
642. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
643. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
644. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
645. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
646. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
647. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
648. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
649. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
650. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
651. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
652. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
653. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
654. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
655. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
656. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
657. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
658. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
659. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
660. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
661. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
662. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
663. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
664. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
665. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
666. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
667. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
668. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
669. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
670. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
671. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
672. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
673. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
674. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
675. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
676. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
677. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
678. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
679. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
680. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
681. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
682. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
683. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
684. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
685. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
686. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
687. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
688. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
689. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
690. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
691. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
692. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
693. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
694. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
695. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
696. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
697. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
698. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
699. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
700. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
701. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
702. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
703. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
704. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
705. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
706. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
707. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
708. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
709. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
710. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
711. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
712. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
713. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
714. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
715. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
716. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
717. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
718. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
719. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
720. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
721. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
722. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
723. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
724. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
725. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
726. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
727. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
728. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
729. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
730. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
731. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
732. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
733. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
734. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
735. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
736. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
737. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
738. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
739. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
740. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
741. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
742. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
743. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
744. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
745. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
746. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
747. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
748. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
749. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
750. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
751. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
752. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
753. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
754. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
755. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
756. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
757. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
758. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
759. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
760. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
761. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
762. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
763. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
764. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
765. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
766. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
767. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
768. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
769. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
770. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
771. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
772. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
773. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
774. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
775. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
776. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
777. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
778. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
779. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
780. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
781. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
782. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
783. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
784. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
785. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
786. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
787. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
788. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
789. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
790. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
791. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
792. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
793. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
794. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
795. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
796. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
797. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
798. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
799. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
800. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
801. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
802. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
803. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
804. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
805. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
806. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
807. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
808. gbgen.idx - Index of the entries according to gene symbols.
809. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
810. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
811. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
812. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
813. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
814. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
815. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
816. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
817. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
818. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
819. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
820. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
821. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
822. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
823. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
824. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
825. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
826. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
827. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
828. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
829. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
830. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
831. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
832. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
833. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
834. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
835. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
836. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
837. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
838. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
839. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
840. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
841. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
842. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
843. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
844. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
845. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
846. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
847. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
848. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
849. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
850. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
851. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
852. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
853. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
854. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
855. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
856. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
857. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
858. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
859. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
860. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
861. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
862. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
863. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
864. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
865. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
866. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
867. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
868. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
869. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
870. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
871. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
872. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
873. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
874. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
875. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
876. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
877. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
878. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
879. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
880. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
881. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
882. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
883. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
884. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
885. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
886. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
887. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
888. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
889. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
890. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
891. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
892. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
893. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
894. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
895. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
896. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
897. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
898. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
899. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
900. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
901. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
902. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
903. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
904. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
905. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
906. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
907. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
908. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
909. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
910. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
911. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
912. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
913. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
914. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
915. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
916. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
917. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
918. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
919. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
920. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
921. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
922. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
923. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
924. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
925. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
926. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
927. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
928. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
929. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
930. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
931. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
932. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
933. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
934. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
935. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
936. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
937. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
938. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
939. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
940. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
941. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
942. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
943. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
944. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
945. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
946. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
947. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
948. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
949. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
950. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
951. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
952. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
953. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
954. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
955. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
956. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
957. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
958. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
959. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
960. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
961. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
962. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
963. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
964. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
965. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
966. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
967. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
968. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
969. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
970. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
971. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
972. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
973. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
974. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
975. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
976. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
977. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
978. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
979. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
980. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
981. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
982. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
983. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
984. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
985. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
986. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
987. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
988. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
989. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
990. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
991. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
992. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
993. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
994. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
995. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
996. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
997. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
998. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
999. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1000. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1001. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1002. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1003. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1004. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1005. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1006. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1007. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1008. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1009. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1010. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1011. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1012. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1013. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1014. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1015. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1016. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1017. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1018. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1019. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1020. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1021. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1022. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1023. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1024. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1025. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1026. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1027. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1028. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1029. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1030. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1031. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1032. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1033. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1034. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1035. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1036. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1037. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1038. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1039. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1040. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1041. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1042. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1043. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1044. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1045. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1046. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1047. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1048. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1049. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1050. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1051. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1052. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1053. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1054. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1055. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1056. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1057. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1058. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1059. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1060. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1061. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1062. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1063. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1064. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1065. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1066. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1067. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1068. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1069. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1070. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1071. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1072. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1073. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1074. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1075. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1076. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1077. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1078. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1079. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1080. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1081. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1082. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1083. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1084. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1085. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1086. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1087. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1088. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1089. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1090. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1091. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1092. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1093. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1094. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1095. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1096. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1097. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1098. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1099. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1100. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1101. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1102. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1103. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1104. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1105. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1106. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1107. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1108. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1109. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1110. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1111. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1112. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1113. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1114. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1115. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1116. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1117. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1118. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1119. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1120. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1121. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1122. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1123. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1124. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1125. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1126. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1127. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1128. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1129. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1130. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1131. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1132. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1133. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1134. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1135. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1136. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1137. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1138. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1139. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1140. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1141. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1142. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1143. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1144. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1145. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1146. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1147. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1148. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1149. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1150. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1151. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1152. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1153. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1154. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1155. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1156. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1157. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1158. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1159. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1160. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1161. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1162. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1163. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1164. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1165. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1166. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1167. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1168. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1169. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1170. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1171. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1172. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1173. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1174. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1175. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1176. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1177. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1178. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1179. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1180. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1181. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1182. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1183. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1184. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1185. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1186. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1187. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1188. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1189. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1190. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1191. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1192. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1193. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1194. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1195. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1196. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1197. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1198. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1199. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1200. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1201. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1202. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1203. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1204. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1205. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1206. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1207. gbinv1.seq - Invertebrate sequence entries, part 1.
1208. gbinv10.seq - Invertebrate sequence entries, part 10.
1209. gbinv11.seq - Invertebrate sequence entries, part 11.
1210. gbinv12.seq - Invertebrate sequence entries, part 12.
1211. gbinv13.seq - Invertebrate sequence entries, part 13.
1212. gbinv14.seq - Invertebrate sequence entries, part 14.
1213. gbinv15.seq - Invertebrate sequence entries, part 15.
1214. gbinv16.seq - Invertebrate sequence entries, part 16.
1215. gbinv17.seq - Invertebrate sequence entries, part 17.
1216. gbinv18.seq - Invertebrate sequence entries, part 18.
1217. gbinv19.seq - Invertebrate sequence entries, part 19.
1218. gbinv2.seq - Invertebrate sequence entries, part 2.
1219. gbinv20.seq - Invertebrate sequence entries, part 20.
1220. gbinv21.seq - Invertebrate sequence entries, part 21.
1221. gbinv22.seq - Invertebrate sequence entries, part 22.
1222. gbinv23.seq - Invertebrate sequence entries, part 23.
1223. gbinv24.seq - Invertebrate sequence entries, part 24.
1224. gbinv25.seq - Invertebrate sequence entries, part 25.
1225. gbinv26.seq - Invertebrate sequence entries, part 26.
1226. gbinv27.seq - Invertebrate sequence entries, part 27.
1227. gbinv28.seq - Invertebrate sequence entries, part 28.
1228. gbinv29.seq - Invertebrate sequence entries, part 29.
1229. gbinv3.seq - Invertebrate sequence entries, part 3.
1230. gbinv30.seq - Invertebrate sequence entries, part 30.
1231. gbinv31.seq - Invertebrate sequence entries, part 31.
1232. gbinv4.seq - Invertebrate sequence entries, part 4.
1233. gbinv5.seq - Invertebrate sequence entries, part 5.
1234. gbinv6.seq - Invertebrate sequence entries, part 6.
1235. gbinv7.seq - Invertebrate sequence entries, part 7.
1236. gbinv8.seq - Invertebrate sequence entries, part 8.
1237. gbinv9.seq - Invertebrate sequence entries, part 9.
1238. gbjou1.idx - Index of the entries according to journal citation, part 1.
1239. gbjou10.idx - Index of the entries according to journal citation, part 10.
1240. gbjou11.idx - Index of the entries according to journal citation, part 11.
1241. gbjou12.idx - Index of the entries according to journal citation, part 12.
1242. gbjou2.idx - Index of the entries according to journal citation, part 2.
1243. gbjou3.idx - Index of the entries according to journal citation, part 3.
1244. gbjou4.idx - Index of the entries according to journal citation, part 4.
1245. gbjou5.idx - Index of the entries according to journal citation, part 5.
1246. gbjou6.idx - Index of the entries according to journal citation, part 6.
1247. gbjou7.idx - Index of the entries according to journal citation, part 7.
1248. gbjou8.idx - Index of the entries according to journal citation, part 8.
1249. gbjou9.idx - Index of the entries according to journal citation, part 9.
1250. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1251. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1252. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1253. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1254. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1255. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1256. gbmam1.seq - Other mammalian sequence entries, part 1.
1257. gbmam2.seq - Other mammalian sequence entries, part 2.
1258. gbmam3.seq - Other mammalian sequence entries, part 3.
1259. gbmam4.seq - Other mammalian sequence entries, part 4.
1260. gbmam5.seq - Other mammalian sequence entries, part 5.
1261. gbmam6.seq - Other mammalian sequence entries, part 6.
1262. gbmam7.seq - Other mammalian sequence entries, part 7.
1263. gbnew.txt - Accession numbers of entries new since the previous release.
1264. gbpat1.seq - Patent sequence entries, part 1.
1265. gbpat10.seq - Patent sequence entries, part 10.
1266. gbpat100.seq - Patent sequence entries, part 100.
1267. gbpat101.seq - Patent sequence entries, part 101.
1268. gbpat102.seq - Patent sequence entries, part 102.
1269. gbpat103.seq - Patent sequence entries, part 103.
1270. gbpat104.seq - Patent sequence entries, part 104.
1271. gbpat105.seq - Patent sequence entries, part 105.
1272. gbpat106.seq - Patent sequence entries, part 106.
1273. gbpat107.seq - Patent sequence entries, part 107.
1274. gbpat108.seq - Patent sequence entries, part 108.
1275. gbpat109.seq - Patent sequence entries, part 109.
1276. gbpat11.seq - Patent sequence entries, part 11.
1277. gbpat110.seq - Patent sequence entries, part 110.
1278. gbpat111.seq - Patent sequence entries, part 111.
1279. gbpat112.seq - Patent sequence entries, part 112.
1280. gbpat113.seq - Patent sequence entries, part 113.
1281. gbpat114.seq - Patent sequence entries, part 114.
1282. gbpat115.seq - Patent sequence entries, part 115.
1283. gbpat116.seq - Patent sequence entries, part 116.
1284. gbpat117.seq - Patent sequence entries, part 117.
1285. gbpat118.seq - Patent sequence entries, part 118.
1286. gbpat119.seq - Patent sequence entries, part 119.
1287. gbpat12.seq - Patent sequence entries, part 12.
1288. gbpat120.seq - Patent sequence entries, part 120.
1289. gbpat121.seq - Patent sequence entries, part 121.
1290. gbpat122.seq - Patent sequence entries, part 122.
1291. gbpat123.seq - Patent sequence entries, part 123.
1292. gbpat124.seq - Patent sequence entries, part 124.
1293. gbpat125.seq - Patent sequence entries, part 125.
1294. gbpat126.seq - Patent sequence entries, part 126.
1295. gbpat127.seq - Patent sequence entries, part 127.
1296. gbpat128.seq - Patent sequence entries, part 128.
1297. gbpat129.seq - Patent sequence entries, part 129.
1298. gbpat13.seq - Patent sequence entries, part 13.
1299. gbpat130.seq - Patent sequence entries, part 130.
1300. gbpat131.seq - Patent sequence entries, part 131.
1301. gbpat132.seq - Patent sequence entries, part 132.
1302. gbpat133.seq - Patent sequence entries, part 133.
1303. gbpat134.seq - Patent sequence entries, part 134.
1304. gbpat135.seq - Patent sequence entries, part 135.
1305. gbpat136.seq - Patent sequence entries, part 136.
1306. gbpat137.seq - Patent sequence entries, part 137.
1307. gbpat138.seq - Patent sequence entries, part 138.
1308. gbpat139.seq - Patent sequence entries, part 139.
1309. gbpat14.seq - Patent sequence entries, part 14.
1310. gbpat140.seq - Patent sequence entries, part 140.
1311. gbpat141.seq - Patent sequence entries, part 141.
1312. gbpat142.seq - Patent sequence entries, part 142.
1313. gbpat143.seq - Patent sequence entries, part 143.
1314. gbpat144.seq - Patent sequence entries, part 144.
1315. gbpat145.seq - Patent sequence entries, part 145.
1316. gbpat146.seq - Patent sequence entries, part 146.
1317. gbpat147.seq - Patent sequence entries, part 147.
1318. gbpat148.seq - Patent sequence entries, part 148.
1319. gbpat149.seq - Patent sequence entries, part 149.
1320. gbpat15.seq - Patent sequence entries, part 15.
1321. gbpat150.seq - Patent sequence entries, part 150.
1322. gbpat151.seq - Patent sequence entries, part 151.
1323. gbpat152.seq - Patent sequence entries, part 152.
1324. gbpat153.seq - Patent sequence entries, part 153.
1325. gbpat154.seq - Patent sequence entries, part 154.
1326. gbpat155.seq - Patent sequence entries, part 155.
1327. gbpat156.seq - Patent sequence entries, part 156.
1328. gbpat157.seq - Patent sequence entries, part 157.
1329. gbpat158.seq - Patent sequence entries, part 158.
1330. gbpat159.seq - Patent sequence entries, part 159.
1331. gbpat16.seq - Patent sequence entries, part 16.
1332. gbpat160.seq - Patent sequence entries, part 160.
1333. gbpat161.seq - Patent sequence entries, part 161.
1334. gbpat162.seq - Patent sequence entries, part 162.
1335. gbpat163.seq - Patent sequence entries, part 163.
1336. gbpat164.seq - Patent sequence entries, part 164.
1337. gbpat165.seq - Patent sequence entries, part 165.
1338. gbpat166.seq - Patent sequence entries, part 166.
1339. gbpat167.seq - Patent sequence entries, part 167.
1340. gbpat168.seq - Patent sequence entries, part 168.
1341. gbpat17.seq - Patent sequence entries, part 17.
1342. gbpat18.seq - Patent sequence entries, part 18.
1343. gbpat19.seq - Patent sequence entries, part 19.
1344. gbpat2.seq - Patent sequence entries, part 2.
1345. gbpat20.seq - Patent sequence entries, part 20.
1346. gbpat21.seq - Patent sequence entries, part 21.
1347. gbpat22.seq - Patent sequence entries, part 22.
1348. gbpat23.seq - Patent sequence entries, part 23.
1349. gbpat24.seq - Patent sequence entries, part 24.
1350. gbpat25.seq - Patent sequence entries, part 25.
1351. gbpat26.seq - Patent sequence entries, part 26.
1352. gbpat27.seq - Patent sequence entries, part 27.
1353. gbpat28.seq - Patent sequence entries, part 28.
1354. gbpat29.seq - Patent sequence entries, part 29.
1355. gbpat3.seq - Patent sequence entries, part 3.
1356. gbpat30.seq - Patent sequence entries, part 30.
1357. gbpat31.seq - Patent sequence entries, part 31.
1358. gbpat32.seq - Patent sequence entries, part 32.
1359. gbpat33.seq - Patent sequence entries, part 33.
1360. gbpat34.seq - Patent sequence entries, part 34.
1361. gbpat35.seq - Patent sequence entries, part 35.
1362. gbpat36.seq - Patent sequence entries, part 36.
1363. gbpat37.seq - Patent sequence entries, part 37.
1364. gbpat38.seq - Patent sequence entries, part 38.
1365. gbpat39.seq - Patent sequence entries, part 39.
1366. gbpat4.seq - Patent sequence entries, part 4.
1367. gbpat40.seq - Patent sequence entries, part 40.
1368. gbpat41.seq - Patent sequence entries, part 41.
1369. gbpat42.seq - Patent sequence entries, part 42.
1370. gbpat43.seq - Patent sequence entries, part 43.
1371. gbpat44.seq - Patent sequence entries, part 44.
1372. gbpat45.seq - Patent sequence entries, part 45.
1373. gbpat46.seq - Patent sequence entries, part 46.
1374. gbpat47.seq - Patent sequence entries, part 47.
1375. gbpat48.seq - Patent sequence entries, part 48.
1376. gbpat49.seq - Patent sequence entries, part 49.
1377. gbpat5.seq - Patent sequence entries, part 5.
1378. gbpat50.seq - Patent sequence entries, part 50.
1379. gbpat51.seq - Patent sequence entries, part 51.
1380. gbpat52.seq - Patent sequence entries, part 52.
1381. gbpat53.seq - Patent sequence entries, part 53.
1382. gbpat54.seq - Patent sequence entries, part 54.
1383. gbpat55.seq - Patent sequence entries, part 55.
1384. gbpat56.seq - Patent sequence entries, part 56.
1385. gbpat57.seq - Patent sequence entries, part 57.
1386. gbpat58.seq - Patent sequence entries, part 58.
1387. gbpat59.seq - Patent sequence entries, part 59.
1388. gbpat6.seq - Patent sequence entries, part 6.
1389. gbpat60.seq - Patent sequence entries, part 60.
1390. gbpat61.seq - Patent sequence entries, part 61.
1391. gbpat62.seq - Patent sequence entries, part 62.
1392. gbpat63.seq - Patent sequence entries, part 63.
1393. gbpat64.seq - Patent sequence entries, part 64.
1394. gbpat65.seq - Patent sequence entries, part 65.
1395. gbpat66.seq - Patent sequence entries, part 66.
1396. gbpat67.seq - Patent sequence entries, part 67.
1397. gbpat68.seq - Patent sequence entries, part 68.
1398. gbpat69.seq - Patent sequence entries, part 69.
1399. gbpat7.seq - Patent sequence entries, part 7.
1400. gbpat70.seq - Patent sequence entries, part 70.
1401. gbpat71.seq - Patent sequence entries, part 71.
1402. gbpat72.seq - Patent sequence entries, part 72.
1403. gbpat73.seq - Patent sequence entries, part 73.
1404. gbpat74.seq - Patent sequence entries, part 74.
1405. gbpat75.seq - Patent sequence entries, part 75.
1406. gbpat76.seq - Patent sequence entries, part 76.
1407. gbpat77.seq - Patent sequence entries, part 77.
1408. gbpat78.seq - Patent sequence entries, part 78.
1409. gbpat79.seq - Patent sequence entries, part 79.
1410. gbpat8.seq - Patent sequence entries, part 8.
1411. gbpat80.seq - Patent sequence entries, part 80.
1412. gbpat81.seq - Patent sequence entries, part 81.
1413. gbpat82.seq - Patent sequence entries, part 82.
1414. gbpat83.seq - Patent sequence entries, part 83.
1415. gbpat84.seq - Patent sequence entries, part 84.
1416. gbpat85.seq - Patent sequence entries, part 85.
1417. gbpat86.seq - Patent sequence entries, part 86.
1418. gbpat87.seq - Patent sequence entries, part 87.
1419. gbpat88.seq - Patent sequence entries, part 88.
1420. gbpat89.seq - Patent sequence entries, part 89.
1421. gbpat9.seq - Patent sequence entries, part 9.
1422. gbpat90.seq - Patent sequence entries, part 90.
1423. gbpat91.seq - Patent sequence entries, part 91.
1424. gbpat92.seq - Patent sequence entries, part 92.
1425. gbpat93.seq - Patent sequence entries, part 93.
1426. gbpat94.seq - Patent sequence entries, part 94.
1427. gbpat95.seq - Patent sequence entries, part 95.
1428. gbpat96.seq - Patent sequence entries, part 96.
1429. gbpat97.seq - Patent sequence entries, part 97.
1430. gbpat98.seq - Patent sequence entries, part 98.
1431. gbpat99.seq - Patent sequence entries, part 99.
1432. gbphg1.seq - Phage sequence entries, part 1.
1433. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1434. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1435. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1436. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1437. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1438. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1439. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1440. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1441. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1442. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1443. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1444. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1445. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1446. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1447. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1448. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1449. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1450. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1451. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1452. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1453. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1454. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1455. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1456. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1457. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1458. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1459. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1460. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1461. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1462. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1463. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1464. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1465. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1466. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1467. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1468. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1469. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1470. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1471. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1472. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1473. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1474. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1475. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1476. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1477. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1478. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1479. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1480. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1481. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1482. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1483. gbpri1.seq - Primate sequence entries, part 1.
1484. gbpri10.seq - Primate sequence entries, part 10.
1485. gbpri11.seq - Primate sequence entries, part 11.
1486. gbpri12.seq - Primate sequence entries, part 12.
1487. gbpri13.seq - Primate sequence entries, part 13.
1488. gbpri14.seq - Primate sequence entries, part 14.
1489. gbpri15.seq - Primate sequence entries, part 15.
1490. gbpri16.seq - Primate sequence entries, part 16.
1491. gbpri17.seq - Primate sequence entries, part 17.
1492. gbpri18.seq - Primate sequence entries, part 18.
1493. gbpri19.seq - Primate sequence entries, part 19.
1494. gbpri2.seq - Primate sequence entries, part 2.
1495. gbpri20.seq - Primate sequence entries, part 20.
1496. gbpri21.seq - Primate sequence entries, part 21.
1497. gbpri22.seq - Primate sequence entries, part 22.
1498. gbpri23.seq - Primate sequence entries, part 23.
1499. gbpri24.seq - Primate sequence entries, part 24.
1500. gbpri25.seq - Primate sequence entries, part 25.
1501. gbpri26.seq - Primate sequence entries, part 26.
1502. gbpri27.seq - Primate sequence entries, part 27.
1503. gbpri28.seq - Primate sequence entries, part 28.
1504. gbpri29.seq - Primate sequence entries, part 29.
1505. gbpri3.seq - Primate sequence entries, part 3.
1506. gbpri30.seq - Primate sequence entries, part 30.
1507. gbpri31.seq - Primate sequence entries, part 31.
1508. gbpri32.seq - Primate sequence entries, part 32.
1509. gbpri33.seq - Primate sequence entries, part 33.
1510. gbpri34.seq - Primate sequence entries, part 34.
1511. gbpri35.seq - Primate sequence entries, part 35.
1512. gbpri36.seq - Primate sequence entries, part 36.
1513. gbpri37.seq - Primate sequence entries, part 37.
1514. gbpri38.seq - Primate sequence entries, part 38.
1515. gbpri39.seq - Primate sequence entries, part 39.
1516. gbpri4.seq - Primate sequence entries, part 4.
1517. gbpri40.seq - Primate sequence entries, part 40.
1518. gbpri41.seq - Primate sequence entries, part 41.
1519. gbpri42.seq - Primate sequence entries, part 42.
1520. gbpri5.seq - Primate sequence entries, part 5.
1521. gbpri6.seq - Primate sequence entries, part 6.
1522. gbpri7.seq - Primate sequence entries, part 7.
1523. gbpri8.seq - Primate sequence entries, part 8.
1524. gbpri9.seq - Primate sequence entries, part 9.
1525. gbrel.txt - Release notes (this document).
1526. gbrod1.seq - Rodent sequence entries, part 1.
1527. gbrod10.seq - Rodent sequence entries, part 10.
1528. gbrod11.seq - Rodent sequence entries, part 11.
1529. gbrod12.seq - Rodent sequence entries, part 12.
1530. gbrod13.seq - Rodent sequence entries, part 13.
1531. gbrod14.seq - Rodent sequence entries, part 14.
1532. gbrod15.seq - Rodent sequence entries, part 15.
1533. gbrod16.seq - Rodent sequence entries, part 16.
1534. gbrod17.seq - Rodent sequence entries, part 17.
1535. gbrod18.seq - Rodent sequence entries, part 18.
1536. gbrod19.seq - Rodent sequence entries, part 19.
1537. gbrod2.seq - Rodent sequence entries, part 2.
1538. gbrod20.seq - Rodent sequence entries, part 20.
1539. gbrod21.seq - Rodent sequence entries, part 21.
1540. gbrod22.seq - Rodent sequence entries, part 22.
1541. gbrod23.seq - Rodent sequence entries, part 23.
1542. gbrod24.seq - Rodent sequence entries, part 24.
1543. gbrod25.seq - Rodent sequence entries, part 25.
1544. gbrod26.seq - Rodent sequence entries, part 26.
1545. gbrod27.seq - Rodent sequence entries, part 27.
1546. gbrod28.seq - Rodent sequence entries, part 28.
1547. gbrod29.seq - Rodent sequence entries, part 29.
1548. gbrod3.seq - Rodent sequence entries, part 3.
1549. gbrod4.seq - Rodent sequence entries, part 4.
1550. gbrod5.seq - Rodent sequence entries, part 5.
1551. gbrod6.seq - Rodent sequence entries, part 6.
1552. gbrod7.seq - Rodent sequence entries, part 7.
1553. gbrod8.seq - Rodent sequence entries, part 8.
1554. gbrod9.seq - Rodent sequence entries, part 9.
1555. gbsdr1.txt - Short directory of the data bank, part 1.
1556. gbsdr2.txt - Short directory of the data bank, part 2.
1557. gbsdr3.txt - Short directory of the data bank, part 3.
1558. gbsec.idx - Index of the entries according to secondary accession number.
1559. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1560. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1561. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1562. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1563. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1564. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1565. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1566. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1567. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1568. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1569. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1570. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1571. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1572. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1573. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1574. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1575. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1576. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1577. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1578. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1579. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1580. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1581. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1582. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1583. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1584. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1585. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1586. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1587. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1588. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1589. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1590. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1591. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1592. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1593. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1594. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1595. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1596. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1597. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1598. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1599. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1600. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1601. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1602. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1603. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1604. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1605. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1606. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1607. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1608. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1609. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1610. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1611. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1612. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1613. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1614. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1615. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1616. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1617. gbuna1.seq - Unannotated sequence entries, part 1.
1618. gbvrl1.seq - Viral sequence entries, part 1.
1619. gbvrl10.seq - Viral sequence entries, part 10.
1620. gbvrl11.seq - Viral sequence entries, part 11.
1621. gbvrl12.seq - Viral sequence entries, part 12.
1622. gbvrl13.seq - Viral sequence entries, part 13.
1623. gbvrl14.seq - Viral sequence entries, part 14.
1624. gbvrl15.seq - Viral sequence entries, part 15.
1625. gbvrl16.seq - Viral sequence entries, part 16.
1626. gbvrl17.seq - Viral sequence entries, part 17.
1627. gbvrl18.seq - Viral sequence entries, part 18.
1628. gbvrl2.seq - Viral sequence entries, part 2.
1629. gbvrl3.seq - Viral sequence entries, part 3.
1630. gbvrl4.seq - Viral sequence entries, part 4.
1631. gbvrl5.seq - Viral sequence entries, part 5.
1632. gbvrl6.seq - Viral sequence entries, part 6.
1633. gbvrl7.seq - Viral sequence entries, part 7.
1634. gbvrl8.seq - Viral sequence entries, part 8.
1635. gbvrl9.seq - Viral sequence entries, part 9.
1636. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1637. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1638. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1639. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1640. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1641. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1642. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1643. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1644. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1645. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1646. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1647. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1648. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1649. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1650. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1651. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1652. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1653. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1654. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1655. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1656. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1657. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1658. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1659. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 185.0 flatfiles require roughly 511 GB (sequence
files only) or 550 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1784451216     gbacc1.idx
2316141267     gbacc2.idx
 801860340     gbacc3.idx
 187442045     gbaut1.idx
 183954492     gbaut10.idx
 231639677     gbaut11.idx
 186847784     gbaut12.idx
 185914058     gbaut13.idx
 185304999     gbaut14.idx
 188365313     gbaut15.idx
 184120354     gbaut16.idx
 186500421     gbaut17.idx
 232199450     gbaut18.idx
 248230579     gbaut19.idx
 219189881     gbaut2.idx
 190355944     gbaut20.idx
 187835408     gbaut21.idx
 201324546     gbaut22.idx
 223242318     gbaut23.idx
 184374224     gbaut24.idx
 184404752     gbaut25.idx
 183959132     gbaut26.idx
 220009119     gbaut27.idx
 183831491     gbaut28.idx
 199222654     gbaut29.idx
 211550155     gbaut3.idx
 216854306     gbaut30.idx
 186586776     gbaut31.idx
 184531163     gbaut32.idx
 183847816     gbaut33.idx
 183891024     gbaut34.idx
 188972664     gbaut35.idx
 210136096     gbaut36.idx
 184716947     gbaut37.idx
 184317199     gbaut38.idx
 184659286     gbaut39.idx
 185460383     gbaut4.idx
 183991506     gbaut40.idx
 183827765     gbaut41.idx
 223918898     gbaut42.idx
 183895964     gbaut43.idx
 194350670     gbaut44.idx
 183909139     gbaut45.idx
 185713848     gbaut46.idx
 184194754     gbaut47.idx
 184930550     gbaut48.idx
 184387340     gbaut49.idx
 203882028     gbaut5.idx
 220247107     gbaut50.idx
 186222914     gbaut51.idx
 184588199     gbaut52.idx
 186283532     gbaut53.idx
 200017230     gbaut54.idx
 206455517     gbaut55.idx
 183805757     gbaut56.idx
 185572490     gbaut57.idx
 185304209     gbaut58.idx
 183894392     gbaut59.idx
 188984583     gbaut6.idx
 185977964     gbaut60.idx
 183854188     gbaut61.idx
 205021927     gbaut62.idx
 256871575     gbaut63.idx
 183895370     gbaut64.idx
 185862993     gbaut65.idx
 206526755     gbaut66.idx
 183779247     gbaut67.idx
 183946052     gbaut68.idx
 186150142     gbaut69.idx
 183793347     gbaut7.idx
 224515620     gbaut70.idx
 218078907     gbaut71.idx
 211598973     gbaut72.idx
 184771691     gbaut73.idx
 189491890     gbaut74.idx
 184280528     gbaut75.idx
 185662199     gbaut76.idx
 195929967     gbaut77.idx
 183737250     gbaut78.idx
 212117746     gbaut79.idx
 189526627     gbaut8.idx
 197955992     gbaut80.idx
 183833513     gbaut81.idx
 185380674     gbaut82.idx
 189091917     gbaut83.idx
 203327388     gbaut84.idx
 185073743     gbaut85.idx
 185654112     gbaut86.idx
 194716194     gbaut87.idx
 187262460     gbaut88.idx
 160827182     gbaut89.idx
 183858224     gbaut9.idx
 247842817     gbbct1.seq
 243882838     gbbct10.seq
 245998171     gbbct11.seq
 249998359     gbbct12.seq
   7748984     gbbct13.seq
 243116071     gbbct14.seq
 249720551     gbbct15.seq
 245549914     gbbct16.seq
 248628320     gbbct17.seq
 248244254     gbbct18.seq
 249284896     gbbct19.seq
 248900122     gbbct2.seq
 246200736     gbbct20.seq
 245695748     gbbct21.seq
 217808759     gbbct22.seq
 242806493     gbbct23.seq
 241491847     gbbct24.seq
 248678554     gbbct25.seq
 247892628     gbbct26.seq
 249390239     gbbct27.seq
 244188289     gbbct28.seq
 247135695     gbbct29.seq
 249285281     gbbct3.seq
 249999671     gbbct30.seq
 249761901     gbbct31.seq
 249791977     gbbct32.seq
 242939802     gbbct33.seq
 243142402     gbbct34.seq
 149253431     gbbct35.seq
 243876608     gbbct36.seq
 246112207     gbbct37.seq
 242768888     gbbct38.seq
 239637243     gbbct39.seq
 249960482     gbbct4.seq
 247212911     gbbct40.seq
 246865246     gbbct41.seq
 245863704     gbbct42.seq
 247634109     gbbct43.seq
 245765872     gbbct44.seq
 244588167     gbbct45.seq
 244814290     gbbct46.seq
  87889246     gbbct47.seq
 245564828     gbbct48.seq
 239384061     gbbct49.seq
 165617011     gbbct5.seq
 248000002     gbbct50.seq
 247353670     gbbct51.seq
 248694463     gbbct52.seq
 238011631     gbbct53.seq
 249561288     gbbct54.seq
 246619064     gbbct55.seq
 248972498     gbbct56.seq
 239509973     gbbct57.seq
 216672635     gbbct58.seq
   6887302     gbbct59.seq
 242108934     gbbct6.seq
  14090994     gbbct60.seq
  23158212     gbbct61.seq
  45089414     gbbct62.seq
  87756989     gbbct63.seq
 169932242     gbbct64.seq
 249999578     gbbct65.seq
 249998645     gbbct66.seq
 247921760     gbbct67.seq
 249293885     gbbct68.seq
 246672275     gbbct69.seq
 247359012     gbbct7.seq
 249106609     gbbct70.seq
 249991176     gbbct71.seq
 249998335     gbbct72.seq
 249999550     gbbct73.seq
 249999616     gbbct74.seq
 109718388     gbbct75.seq
 247170413     gbbct8.seq
 244862352     gbbct9.seq
  15314322     gbchg.txt
 250000240     gbcon1.seq
 249996514     gbcon10.seq
 249995660     gbcon100.seq
 249998605     gbcon101.seq
 249998936     gbcon102.seq
 250000223     gbcon103.seq
 156342446     gbcon104.seq
 249996812     gbcon105.seq
 249993767     gbcon106.seq
 249992301     gbcon107.seq
 249998322     gbcon108.seq
  71615782     gbcon109.seq
 249998969     gbcon11.seq
 249997862     gbcon110.seq
 249998650     gbcon111.seq
 208522809     gbcon112.seq
 250000256     gbcon113.seq
 250000098     gbcon114.seq
 249995503     gbcon115.seq
 249706533     gbcon116.seq
 163127783     gbcon117.seq
 249779275     gbcon118.seq
 249817113     gbcon119.seq
 248683849     gbcon12.seq
 192063092     gbcon120.seq
 249997002     gbcon121.seq
 249998975     gbcon122.seq
 249999596     gbcon123.seq
 249777006     gbcon124.seq
  19839375     gbcon125.seq
 249999604     gbcon126.seq
 249962587     gbcon127.seq
 249646814     gbcon128.seq
 249999116     gbcon129.seq
 247344551     gbcon13.seq
 249998540     gbcon130.seq
 215461240     gbcon131.seq
 249999839     gbcon132.seq
 249985338     gbcon133.seq
 249819716     gbcon134.seq
 249993762     gbcon135.seq
 249999846     gbcon136.seq
 248313325     gbcon137.seq
 250000042     gbcon138.seq
 249994952     gbcon139.seq
 249997148     gbcon14.seq
 159567680     gbcon140.seq
 249092739     gbcon141.seq
 249998279     gbcon142.seq
 248974359     gbcon143.seq
 249997069     gbcon144.seq
 249997121     gbcon145.seq
 249999150     gbcon146.seq
 249998212     gbcon147.seq
 206529882     gbcon148.seq
  18849423     gbcon149.seq
  77464502     gbcon15.seq
 249821933     gbcon16.seq
 249996499     gbcon17.seq
 155322820     gbcon18.seq
 250000142     gbcon19.seq
 248147599     gbcon2.seq
 248022413     gbcon20.seq
 122899685     gbcon21.seq
 249998506     gbcon22.seq
 120044016     gbcon23.seq
 249996870     gbcon24.seq
 249774546     gbcon25.seq
 249999330     gbcon26.seq
 249996506     gbcon27.seq
 201045147     gbcon28.seq
 249999800     gbcon29.seq
 249767877     gbcon3.seq
 249997309     gbcon30.seq
 249999857     gbcon31.seq
 249999952     gbcon32.seq
 247968337     gbcon33.seq
 234568834     gbcon34.seq
 249999237     gbcon35.seq
 249996869     gbcon36.seq
 249995921     gbcon37.seq
 249996351     gbcon38.seq
 249999450     gbcon39.seq
 249980011     gbcon4.seq
 249997210     gbcon40.seq
  61183731     gbcon41.seq
 249997486     gbcon42.seq
 249994070     gbcon43.seq
 249999391     gbcon44.seq
 249997743     gbcon45.seq
 249994859     gbcon46.seq
  43089049     gbcon47.seq
 249993995     gbcon48.seq
 249996310     gbcon49.seq
 249994359     gbcon5.seq
 249994442     gbcon50.seq
 249997248     gbcon51.seq
 250000078     gbcon52.seq
  36404971     gbcon53.seq
 249993185     gbcon54.seq
 249998119     gbcon55.seq
 249995170     gbcon56.seq
 249998154     gbcon57.seq
 249998078     gbcon58.seq
 152679523     gbcon59.seq
 249990922     gbcon6.seq
 249999955     gbcon60.seq
 249999066     gbcon61.seq
 249997558     gbcon62.seq
 249998625     gbcon63.seq
 183609322     gbcon64.seq
 249999870     gbcon65.seq
 249997967     gbcon66.seq
 249997138     gbcon67.seq
 249995207     gbcon68.seq
 245488804     gbcon69.seq
 249994250     gbcon7.seq
 250000182     gbcon70.seq
 249998695     gbcon71.seq
 249998372     gbcon72.seq
 249996966     gbcon73.seq
 250000007     gbcon74.seq
  96627683     gbcon75.seq
 249993448     gbcon76.seq
 249995119     gbcon77.seq
 249997383     gbcon78.seq
 249995948     gbcon79.seq
   1242649     gbcon8.seq
 249999042     gbcon80.seq
  62682749     gbcon81.seq
 249997771     gbcon82.seq
 249996653     gbcon83.seq
 249999445     gbcon84.seq
 249999590     gbcon85.seq
 249998149     gbcon86.seq
  21674116     gbcon87.seq
 249998140     gbcon88.seq
 249997503     gbcon89.seq
 249997708     gbcon9.seq
 249996940     gbcon90.seq
 249995720     gbcon91.seq
 197881888     gbcon92.seq
 249993974     gbcon93.seq
 249996060     gbcon94.seq
 249999726     gbcon95.seq
 249998645     gbcon96.seq
 249996901     gbcon97.seq
 133265984     gbcon98.seq
 249994222     gbcon99.seq
   1054716     gbdel.txt
 249998556     gbenv1.seq
 249997800     gbenv10.seq
  52977999     gbenv11.seq
 249999507     gbenv12.seq
 249998922     gbenv13.seq
 249999372     gbenv14.seq
 249997743     gbenv15.seq
 249998361     gbenv16.seq
 249997985     gbenv17.seq
 235986287     gbenv18.seq
 249999794     gbenv19.seq
 249997349     gbenv2.seq
 249999877     gbenv20.seq
 249999462     gbenv21.seq
 249998479     gbenv22.seq
 126843326     gbenv23.seq
 249998986     gbenv24.seq
 249999160     gbenv25.seq
 249998963     gbenv26.seq
 249999413     gbenv27.seq
 249998256     gbenv28.seq
  81027899     gbenv29.seq
 249999701     gbenv3.seq
 249998069     gbenv30.seq
 249997340     gbenv31.seq
 249998074     gbenv32.seq
 249998428     gbenv33.seq
 130601483     gbenv34.seq
 249998516     gbenv35.seq
 249998934     gbenv36.seq
 249999439     gbenv37.seq
 250000030     gbenv38.seq
 250000005     gbenv39.seq
 249999028     gbenv4.seq
 249998895     gbenv40.seq
 249999932     gbenv41.seq
  83131358     gbenv42.seq
 249997209     gbenv5.seq
 166648548     gbenv6.seq
 249999294     gbenv7.seq
 249999818     gbenv8.seq
 249999579     gbenv9.seq
 524292008     gbest1.seq
 524290020     gbest10.seq
 524289528     gbest100.seq
 524289952     gbest101.seq
 524290333     gbest102.seq
 524290904     gbest103.seq
 355848210     gbest104.seq
 524289191     gbest105.seq
 524290379     gbest106.seq
 497433583     gbest107.seq
 388466985     gbest108.seq
 387584412     gbest109.seq
 524291466     gbest11.seq
 383132220     gbest110.seq
 384253158     gbest111.seq
 384325966     gbest112.seq
 381682500     gbest113.seq
 391880173     gbest114.seq
 387828030     gbest115.seq
 386113926     gbest116.seq
 384277532     gbest117.seq
 411759853     gbest118.seq
 524291299     gbest119.seq
 524290420     gbest12.seq
 524291116     gbest120.seq
 524288737     gbest121.seq
 524291517     gbest122.seq
 524292081     gbest123.seq
 464303390     gbest124.seq
 524290523     gbest125.seq
 524290344     gbest126.seq
 524289672     gbest127.seq
 524289440     gbest128.seq
 524291347     gbest129.seq
 156662877     gbest13.seq
 524288954     gbest130.seq
 524289974     gbest131.seq
 524289564     gbest132.seq
 524290103     gbest133.seq
 524288969     gbest134.seq
 524290716     gbest135.seq
 524290521     gbest136.seq
 272959509     gbest137.seq
 524290677     gbest138.seq
 524288949     gbest139.seq
 524289762     gbest14.seq
 524290015     gbest140.seq
 524291257     gbest141.seq
 524291972     gbest142.seq
 524291379     gbest143.seq
 524289543     gbest144.seq
 524290355     gbest145.seq
 524291047     gbest146.seq
 524292145     gbest147.seq
 524289657     gbest148.seq
 524289896     gbest149.seq
 524289351     gbest15.seq
 524292763     gbest150.seq
 477398537     gbest151.seq
 524289509     gbest152.seq
 524290416     gbest153.seq
 524291145     gbest154.seq
 524290779     gbest155.seq
 524290852     gbest156.seq
 524290971     gbest157.seq
 524289704     gbest158.seq
 524292090     gbest159.seq
 524290603     gbest16.seq
 499492937     gbest160.seq
 524290065     gbest161.seq
 524291255     gbest162.seq
 524292148     gbest163.seq
 244123019     gbest164.seq
 524289468     gbest165.seq
 524290410     gbest166.seq
 524290255     gbest167.seq
 524292615     gbest168.seq
 524288781     gbest169.seq
 524290313     gbest17.seq
 524290639     gbest170.seq
 524289394     gbest171.seq
 524289365     gbest172.seq
 524289809     gbest173.seq
 524289193     gbest174.seq
 524289088     gbest175.seq
 524294713     gbest176.seq
 524291538     gbest177.seq
  96179849     gbest178.seq
 524289699     gbest179.seq
 524290391     gbest18.seq
 524291778     gbest180.seq
 524289480     gbest181.seq
 524290105     gbest182.seq
 524288739     gbest183.seq
 524290934     gbest184.seq
 524292014     gbest185.seq
 524289219     gbest186.seq
 524289152     gbest187.seq
 524288847     gbest188.seq
 524289097     gbest189.seq
 524291530     gbest19.seq
 524290593     gbest190.seq
 456279764     gbest191.seq
 524290527     gbest192.seq
 524289273     gbest193.seq
 524290609     gbest194.seq
 524292236     gbest195.seq
 524296959     gbest196.seq
 524291601     gbest197.seq
 524289120     gbest198.seq
 524289059     gbest199.seq
 524289694     gbest2.seq
 524290396     gbest20.seq
 524291037     gbest200.seq
 524288871     gbest201.seq
 524290184     gbest202.seq
 524291672     gbest203.seq
 524289118     gbest204.seq
  96668002     gbest205.seq
 524289903     gbest206.seq
 524289252     gbest207.seq
 524289827     gbest208.seq
 524290496     gbest209.seq
 524290173     gbest21.seq
 524290212     gbest210.seq
 524290846     gbest211.seq
 524291896     gbest212.seq
 524289681     gbest213.seq
 524290250     gbest214.seq
 524289418     gbest215.seq
 429075926     gbest216.seq
 524289578     gbest217.seq
 524289189     gbest218.seq
 524289827     gbest219.seq
 511676762     gbest22.seq
 524290849     gbest220.seq
 524289652     gbest221.seq
 524289004     gbest222.seq
 524289226     gbest223.seq
 524292486     gbest224.seq
 524290794     gbest225.seq
 524292361     gbest226.seq
 524289730     gbest227.seq
 524291994     gbest228.seq
 524290503     gbest229.seq
 500428727     gbest23.seq
 374325265     gbest230.seq
 524290368     gbest231.seq
 524291439     gbest232.seq
 524292237     gbest233.seq
 524289892     gbest234.seq
 524290903     gbest235.seq
 524291067     gbest236.seq
 524292189     gbest237.seq
 524291603     gbest238.seq
 524289293     gbest239.seq
 509311743     gbest24.seq
 524290522     gbest240.seq
 524290148     gbest241.seq
 524291364     gbest242.seq
 524291101     gbest243.seq
 524291025     gbest244.seq
  44697073     gbest245.seq
 524288927     gbest246.seq
 524290511     gbest247.seq
 524292168     gbest248.seq
 524288902     gbest249.seq
 320206659     gbest25.seq
 524289897     gbest250.seq
 524290090     gbest251.seq
 524289317     gbest252.seq
 524289890     gbest253.seq
 524289328     gbest254.seq
 524288755     gbest255.seq
 524289211     gbest256.seq
 237349317     gbest257.seq
 524288802     gbest258.seq
 524290634     gbest259.seq
 524289772     gbest26.seq
 524289833     gbest260.seq
 524289466     gbest261.seq
 524289442     gbest262.seq
 524292018     gbest263.seq
 524290589     gbest264.seq
 524290712     gbest265.seq
 524289439     gbest266.seq
 524290005     gbest267.seq
 288458158     gbest268.seq
 524288934     gbest269.seq
 524291017     gbest27.seq
 524291626     gbest270.seq
 524289989     gbest271.seq
 524289798     gbest272.seq
 524289823     gbest273.seq
 524291663     gbest274.seq
 524290196     gbest275.seq
 524289063     gbest276.seq
 524288872     gbest277.seq
 524289385     gbest278.seq
 524289279     gbest279.seq
 524290887     gbest28.seq
 294981623     gbest280.seq
 524289748     gbest281.seq
 524289474     gbest282.seq
 524289304     gbest283.seq
 524289360     gbest284.seq
 524290242     gbest285.seq
 524292136     gbest286.seq
 524289765     gbest287.seq
 524289419     gbest288.seq
 524290145     gbest289.seq
 524292112     gbest29.seq
 524292595     gbest290.seq
 524291222     gbest291.seq
 229986704     gbest292.seq
 524291955     gbest293.seq
 524289419     gbest294.seq
 524290298     gbest295.seq
 524289434     gbest296.seq
 524291349     gbest297.seq
 524292172     gbest298.seq
 524289981     gbest299.seq
 497701912     gbest3.seq
 524291338     gbest30.seq
 524290258     gbest300.seq
 479534430     gbest301.seq
 485198822     gbest302.seq
 486545640     gbest303.seq
 313980137     gbest304.seq
 524291054     gbest305.seq
 524289872     gbest306.seq
 524290668     gbest307.seq
 524292865     gbest308.seq
 524290107     gbest309.seq
 524289477     gbest31.seq
 524291061     gbest310.seq
 524289061     gbest311.seq
 524290658     gbest312.seq
 524290312     gbest313.seq
 524290188     gbest314.seq
 524290517     gbest315.seq
 524289425     gbest316.seq
 503959118     gbest317.seq
 524290207     gbest318.seq
 524290494     gbest319.seq
 524288791     gbest32.seq
 524290637     gbest320.seq
 524291825     gbest321.seq
 524292757     gbest322.seq
 524290053     gbest323.seq
 524292044     gbest324.seq
 524291858     gbest325.seq
 524291374     gbest326.seq
 524289786     gbest327.seq
 524290875     gbest328.seq
 524291421     gbest329.seq
 524288813     gbest33.seq
 524291140     gbest330.seq
 265802900     gbest331.seq
 524289624     gbest332.seq
 524291403     gbest333.seq
 524289994     gbest334.seq
 524292026     gbest335.seq
 524290643     gbest336.seq
 524289726     gbest337.seq
 524290823     gbest338.seq
 524289297     gbest339.seq
 519125593     gbest34.seq
 524289052     gbest340.seq
 524291217     gbest341.seq
 524288798     gbest342.seq
 524290568     gbest343.seq
 524292725     gbest344.seq
 341048353     gbest345.seq
 524288808     gbest346.seq
 524289777     gbest347.seq
 524288800     gbest348.seq
 524289402     gbest349.seq
 492711364     gbest35.seq
 524290829     gbest350.seq
 524290519     gbest351.seq
 524290235     gbest352.seq
 524290350     gbest353.seq
 524289469     gbest354.seq
 524288940     gbest355.seq
 524288905     gbest356.seq
 524288831     gbest357.seq
 524289120     gbest358.seq
 502813923     gbest359.seq
 494452291     gbest36.seq
 524290274     gbest360.seq
 524288866     gbest361.seq
 524288766     gbest362.seq
 524291649     gbest363.seq
 524291915     gbest364.seq
 524290984     gbest365.seq
 524291434     gbest366.seq
 524291926     gbest367.seq
 524290075     gbest368.seq
 524291024     gbest369.seq
 493350947     gbest37.seq
 524289302     gbest370.seq
  11991948     gbest371.seq
 524290921     gbest372.seq
 524288805     gbest373.seq
 491213730     gbest374.seq
 524289499     gbest375.seq
 524291734     gbest376.seq
 524290186     gbest377.seq
 524290945     gbest378.seq
 524291057     gbest379.seq
 487989927     gbest38.seq
 524290797     gbest380.seq
 524289295     gbest381.seq
 524291345     gbest382.seq
  54738060     gbest383.seq
 524290960     gbest384.seq
 524288928     gbest385.seq
 524290982     gbest386.seq
 524290555     gbest387.seq
 524291527     gbest388.seq
 524291459     gbest389.seq
 493318745     gbest39.seq
 524288880     gbest390.seq
 524290943     gbest391.seq
 524289102     gbest392.seq
 524290293     gbest393.seq
 524289526     gbest394.seq
 524289919     gbest395.seq
 121878684     gbest396.seq
 524292191     gbest397.seq
 524290809     gbest398.seq
 524291785     gbest399.seq
 524288944     gbest4.seq
 113318893     gbest40.seq
 524288795     gbest400.seq
 524289847     gbest401.seq
 524289321     gbest402.seq
 524289285     gbest403.seq
 524291028     gbest404.seq
 524289306     gbest405.seq
 524290683     gbest406.seq
 524291304     gbest407.seq
 524289191     gbest408.seq
 448243986     gbest409.seq
 524292418     gbest41.seq
 524292663     gbest410.seq
 524291272     gbest411.seq
 524289375     gbest412.seq
 524289188     gbest413.seq
 524290218     gbest414.seq
 524290332     gbest415.seq
 524291595     gbest416.seq
 524290565     gbest417.seq
 524293747     gbest418.seq
 524292231     gbest419.seq
 524291602     gbest42.seq
 524288826     gbest420.seq
 524290461     gbest421.seq
 524296289     gbest422.seq
 524292324     gbest423.seq
 150371758     gbest424.seq
 524290947     gbest425.seq
 524291461     gbest426.seq
 524290992     gbest427.seq
 524291165     gbest428.seq
 524291423     gbest429.seq
 524290900     gbest43.seq
 524288900     gbest430.seq
 524289745     gbest431.seq
 524290775     gbest432.seq
 524290930     gbest433.seq
 524290616     gbest434.seq
 524290861     gbest435.seq
 524291329     gbest436.seq
 322182255     gbest437.seq
 524290116     gbest438.seq
 524289559     gbest439.seq
 524290526     gbest44.seq
 524291740     gbest440.seq
 524290577     gbest441.seq
 524290346     gbest442.seq
 524289243     gbest443.seq
 524290033     gbest444.seq
 524290361     gbest445.seq
 524290357     gbest446.seq
 222266000     gbest447.seq
 524288987     gbest45.seq
 524289949     gbest46.seq
 524289181     gbest47.seq
 524290019     gbest48.seq
 524292037     gbest49.seq
 524289625     gbest5.seq
 524290634     gbest50.seq
 524288899     gbest51.seq
 524289601     gbest52.seq
 524291078     gbest53.seq
 272097690     gbest54.seq
 524290310     gbest55.seq
 524289001     gbest56.seq
 524289006     gbest57.seq
 524289413     gbest58.seq
 524289230     gbest59.seq
 524288762     gbest6.seq
 524291041     gbest60.seq
 524290849     gbest61.seq
 524290575     gbest62.seq
 524290819     gbest63.seq
 524289636     gbest64.seq
 524289829     gbest65.seq
 524291645     gbest66.seq
 464742019     gbest67.seq
 524291687     gbest68.seq
 524292241     gbest69.seq
 524289018     gbest7.seq
 524289556     gbest70.seq
 524289251     gbest71.seq
 524291010     gbest72.seq
 524289232     gbest73.seq
 524290639     gbest74.seq
 524289759     gbest75.seq
 524290591     gbest76.seq
 524291314     gbest77.seq
 524290367     gbest78.seq
 524289168     gbest79.seq
 524289582     gbest8.seq
 203995000     gbest80.seq
 524288997     gbest81.seq
 524289024     gbest82.seq
 524292450     gbest83.seq
 524290316     gbest84.seq
 524291178     gbest85.seq
 524289761     gbest86.seq
 524291021     gbest87.seq
 524290263     gbest88.seq
 524289447     gbest89.seq
 524289263     gbest9.seq
 524289069     gbest90.seq
 524290288     gbest91.seq
 448377362     gbest92.seq
 524290749     gbest93.seq
 524290598     gbest94.seq
 524291090     gbest95.seq
 524290430     gbest96.seq
 524290528     gbest97.seq
 524291889     gbest98.seq
 524290679     gbest99.seq
 164302877     gbgen.idx
 524291294     gbgss1.seq
 524291442     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524290642     gbgss103.seq
 413690581     gbgss104.seq
 524290929     gbgss105.seq
 524290943     gbgss106.seq
 524290652     gbgss107.seq
 524290137     gbgss108.seq
 524289171     gbgss109.seq
 524292161     gbgss11.seq
 524289251     gbgss110.seq
 524290077     gbgss111.seq
 524289903     gbgss112.seq
 524290560     gbgss113.seq
 524290818     gbgss114.seq
 524289764     gbgss115.seq
  55545257     gbgss116.seq
 524289667     gbgss117.seq
 524288912     gbgss118.seq
 524291610     gbgss119.seq
 524289997     gbgss12.seq
 524288923     gbgss120.seq
 524290459     gbgss121.seq
 524290140     gbgss122.seq
 524291049     gbgss123.seq
 524290520     gbgss124.seq
 524289148     gbgss125.seq
 524290894     gbgss126.seq
 524291772     gbgss127.seq
 524291406     gbgss128.seq
 228112150     gbgss129.seq
 524288852     gbgss13.seq
 524288892     gbgss130.seq
 524290941     gbgss131.seq
 524288773     gbgss132.seq
 524289898     gbgss133.seq
 524289884     gbgss134.seq
 524290213     gbgss135.seq
 524289870     gbgss136.seq
 524291324     gbgss137.seq
 524289842     gbgss138.seq
 515994606     gbgss139.seq
 524288985     gbgss14.seq
 516017332     gbgss140.seq
  96671360     gbgss141.seq
 524289923     gbgss142.seq
 524290020     gbgss143.seq
 524290617     gbgss144.seq
 366712818     gbgss145.seq
 249999631     gbgss146.seq
 249998189     gbgss147.seq
 250000024     gbgss148.seq
 249998703     gbgss149.seq
 524290063     gbgss15.seq
  28529034     gbgss150.seq
 249997137     gbgss151.seq
 250000033     gbgss152.seq
 249998542     gbgss153.seq
 249998333     gbgss154.seq
 224919493     gbgss155.seq
 249998415     gbgss156.seq
 249998761     gbgss157.seq
 249998880     gbgss158.seq
 249997750     gbgss159.seq
 524290859     gbgss16.seq
 189046598     gbgss160.seq
 249999433     gbgss161.seq
 249998390     gbgss162.seq
 249999267     gbgss163.seq
 249998392     gbgss164.seq
 249998723     gbgss165.seq
  76677866     gbgss166.seq
 249997579     gbgss167.seq
   2077145     gbgss168.seq
  79542394     gbgss169.seq
 524290670     gbgss17.seq
 249999009     gbgss170.seq
 250000259     gbgss171.seq
  87380505     gbgss172.seq
 249999685     gbgss173.seq
 249998355     gbgss174.seq
 249998984     gbgss175.seq
 202719103     gbgss176.seq
 249999232     gbgss177.seq
 249999013     gbgss178.seq
 249998851     gbgss179.seq
 524290328     gbgss18.seq
 246250899     gbgss180.seq
 249999268     gbgss181.seq
 249997406     gbgss182.seq
 249999279     gbgss183.seq
 243520281     gbgss184.seq
 249999336     gbgss185.seq
 249997150     gbgss186.seq
 249998209     gbgss187.seq
 249997376     gbgss188.seq
 122294651     gbgss189.seq
 314841901     gbgss19.seq
 249998013     gbgss190.seq
 250000031     gbgss191.seq
 249999974     gbgss192.seq
 249998152     gbgss193.seq
  94058788     gbgss194.seq
 249998892     gbgss195.seq
 249999850     gbgss196.seq
 249998239     gbgss197.seq
 249999582     gbgss198.seq
 174092603     gbgss199.seq
 524290030     gbgss2.seq
 524288952     gbgss20.seq
 249999236     gbgss200.seq
 249997993     gbgss201.seq
 249998006     gbgss202.seq
 249999353     gbgss203.seq
  95926739     gbgss204.seq
 249999461     gbgss205.seq
 249999350     gbgss206.seq
 249998406     gbgss207.seq
 249998619     gbgss208.seq
 249999398     gbgss209.seq
 524289034     gbgss21.seq
 249999995     gbgss210.seq
  17245248     gbgss211.seq
 249999424     gbgss212.seq
 249999963     gbgss213.seq
 249997369     gbgss214.seq
  43648880     gbgss215.seq
  52862187     gbgss216.seq
 249997605     gbgss217.seq
 249998837     gbgss218.seq
 249998422     gbgss219.seq
 524291398     gbgss22.seq
 249998900     gbgss220.seq
  30266551     gbgss221.seq
 249997658     gbgss222.seq
 249997580     gbgss223.seq
 249998996     gbgss224.seq
 249999984     gbgss225.seq
  28042636     gbgss226.seq
 249997655     gbgss227.seq
 249998570     gbgss228.seq
 249999046     gbgss229.seq
 524290800     gbgss23.seq
 250000051     gbgss230.seq
 249998160     gbgss231.seq
 249998166     gbgss232.seq
 178904694     gbgss233.seq
 249999812     gbgss234.seq
 249998926     gbgss235.seq
 249999095     gbgss236.seq
 220154622     gbgss237.seq
 250000034     gbgss238.seq
 249997956     gbgss239.seq
 524291392     gbgss24.seq
 250000074     gbgss240.seq
 249998729     gbgss241.seq
 195288113     gbgss242.seq
 249999561     gbgss243.seq
 249998751     gbgss244.seq
 249999600     gbgss245.seq
 249999029     gbgss246.seq
 249999714     gbgss247.seq
  16550601     gbgss248.seq
 524290581     gbgss25.seq
 524290713     gbgss26.seq
 524290348     gbgss27.seq
 524288854     gbgss28.seq
 524289528     gbgss29.seq
 524291456     gbgss3.seq
 524289655     gbgss30.seq
  38849864     gbgss31.seq
 524289075     gbgss32.seq
 524290723     gbgss33.seq
 524288828     gbgss34.seq
 524289728     gbgss35.seq
 524289696     gbgss36.seq
 524289533     gbgss37.seq
 524289071     gbgss38.seq
 509087433     gbgss39.seq
 524289321     gbgss4.seq
 524290362     gbgss40.seq
 524289231     gbgss41.seq
 524291640     gbgss42.seq
  28732657     gbgss43.seq
 524288882     gbgss44.seq
 524288983     gbgss45.seq
 524290809     gbgss46.seq
 524290935     gbgss47.seq
 209349659     gbgss48.seq
 524291863     gbgss49.seq
 168340015     gbgss5.seq
 524291582     gbgss50.seq
 524290401     gbgss51.seq
 524290464     gbgss52.seq
 524290548     gbgss53.seq
 524290689     gbgss54.seq
 524289963     gbgss55.seq
 524289945     gbgss56.seq
 524290428     gbgss57.seq
 524291284     gbgss58.seq
 524290900     gbgss59.seq
 524290951     gbgss6.seq
   5856233     gbgss60.seq
 524291816     gbgss61.seq
 524290410     gbgss62.seq
 524289010     gbgss63.seq
 456972177     gbgss64.seq
 524291037     gbgss65.seq
 524291022     gbgss66.seq
 524290625     gbgss67.seq
 524289969     gbgss68.seq
 524289927     gbgss69.seq
 524291032     gbgss7.seq
 524291431     gbgss70.seq
 524291342     gbgss71.seq
 524290946     gbgss72.seq
 524289514     gbgss73.seq
 524288792     gbgss74.seq
 524289923     gbgss75.seq
 524291029     gbgss76.seq
  32009598     gbgss77.seq
 524289561     gbgss78.seq
 524291931     gbgss79.seq
 524292289     gbgss8.seq
 524289482     gbgss80.seq
 524290066     gbgss81.seq
 524289701     gbgss82.seq
 524291196     gbgss83.seq
 524290880     gbgss84.seq
 524289902     gbgss85.seq
 524291820     gbgss86.seq
 524289216     gbgss87.seq
 524290299     gbgss88.seq
 369802312     gbgss89.seq
 524290754     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249992912     gbhtc1.seq
 249999763     gbhtc10.seq
 250000172     gbhtc11.seq
  79444250     gbhtc12.seq
 249998828     gbhtc13.seq
 249998442     gbhtc14.seq
  61708709     gbhtc15.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  83873876     gbhtc8.seq
 249999621     gbhtc9.seq
 249904748     gbhtg1.seq
 249863408     gbhtg10.seq
 249917503     gbhtg100.seq
 249844944     gbhtg101.seq
 249902534     gbhtg102.seq
 249951070     gbhtg103.seq
   5713706     gbhtg104.seq
 249898090     gbhtg105.seq
 249968110     gbhtg106.seq
 249908037     gbhtg107.seq
 249923781     gbhtg108.seq
 249924541     gbhtg109.seq
   1107147     gbhtg11.seq
 249984985     gbhtg110.seq
 249769963     gbhtg111.seq
 249851148     gbhtg112.seq
 249997533     gbhtg113.seq
 168555354     gbhtg114.seq
 249974219     gbhtg115.seq
 249957856     gbhtg116.seq
 249971769     gbhtg117.seq
 249933365     gbhtg118.seq
 249807596     gbhtg119.seq
 249658387     gbhtg12.seq
  54294149     gbhtg120.seq
 249930742     gbhtg121.seq
 249997578     gbhtg122.seq
 249760210     gbhtg123.seq
 249990285     gbhtg124.seq
 249907394     gbhtg125.seq
 137274670     gbhtg126.seq
 249850575     gbhtg127.seq
 249861351     gbhtg128.seq
 249908644     gbhtg129.seq
 249699749     gbhtg13.seq
 249972612     gbhtg130.seq
 249818283     gbhtg131.seq
 249908304     gbhtg132.seq
 249788982     gbhtg133.seq
 249896826     gbhtg134.seq
 245194410     gbhtg135.seq
 249765870     gbhtg14.seq
 249760883     gbhtg15.seq
 249872612     gbhtg16.seq
 249832528     gbhtg17.seq
 249983662     gbhtg18.seq
 249677291     gbhtg19.seq
 249994630     gbhtg2.seq
 249988730     gbhtg20.seq
 237145184     gbhtg21.seq
 249760624     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761207     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249848514     gbhtg29.seq
 249950135     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249920767     gbhtg33.seq
 249929437     gbhtg34.seq
 249919058     gbhtg35.seq
 249852033     gbhtg36.seq
 249814604     gbhtg37.seq
 249767419     gbhtg38.seq
 249627604     gbhtg39.seq
 249984089     gbhtg4.seq
 249839726     gbhtg40.seq
 224363115     gbhtg41.seq
 249889211     gbhtg42.seq
 249786801     gbhtg43.seq
 249972417     gbhtg44.seq
 249775813     gbhtg45.seq
 249944735     gbhtg46.seq
 249538065     gbhtg47.seq
 249860682     gbhtg48.seq
 249401904     gbhtg49.seq
 249882044     gbhtg5.seq
 249943991     gbhtg50.seq
 236051205     gbhtg51.seq
 249779581     gbhtg52.seq
 249868880     gbhtg53.seq
 249951046     gbhtg54.seq
 249971361     gbhtg55.seq
 249934069     gbhtg56.seq
  18926953     gbhtg57.seq
 249779000     gbhtg58.seq
 249829467     gbhtg59.seq
 249898460     gbhtg6.seq
 249948645     gbhtg60.seq
 249919907     gbhtg61.seq
 227544229     gbhtg62.seq
 249954240     gbhtg63.seq
 249782667     gbhtg64.seq
 249794702     gbhtg65.seq
 249883760     gbhtg66.seq
 249966605     gbhtg67.seq
  16805116     gbhtg68.seq
 249960711     gbhtg69.seq
 249933725     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249936542     gbhtg72.seq
 225954343     gbhtg73.seq
 249811185     gbhtg74.seq
 249933453     gbhtg75.seq
 249901238     gbhtg76.seq
 249980198     gbhtg77.seq
 244510083     gbhtg78.seq
 249883367     gbhtg79.seq
 249933567     gbhtg8.seq
 249988070     gbhtg80.seq
 249984793     gbhtg81.seq
 249923601     gbhtg82.seq
 216706050     gbhtg83.seq
 249912287     gbhtg84.seq
 249753930     gbhtg85.seq
 249833379     gbhtg86.seq
 249773916     gbhtg87.seq
 221421599     gbhtg88.seq
 249740814     gbhtg89.seq
 249923766     gbhtg9.seq
 249970890     gbhtg90.seq
 249817508     gbhtg91.seq
 249995281     gbhtg92.seq
 211823301     gbhtg93.seq
 249866103     gbhtg94.seq
 249984141     gbhtg95.seq
 249734311     gbhtg96.seq
 249842265     gbhtg97.seq
 169279701     gbhtg98.seq
 249744688     gbhtg99.seq
 249982729     gbinv1.seq
 249998485     gbinv10.seq
 160069019     gbinv11.seq
 249999368     gbinv12.seq
 249998495     gbinv13.seq
 249999827     gbinv14.seq
 143341702     gbinv15.seq
 247564683     gbinv16.seq
 249927786     gbinv17.seq
 249999724     gbinv18.seq
 247923760     gbinv19.seq
 249977501     gbinv2.seq
 249999436     gbinv20.seq
 249997609     gbinv21.seq
 249998116     gbinv22.seq
 139425039     gbinv23.seq
 249999950     gbinv24.seq
 249996068     gbinv25.seq
 249998563     gbinv26.seq
 249996268     gbinv27.seq
 249997256     gbinv28.seq
 249997093     gbinv29.seq
 226092821     gbinv3.seq
 249922190     gbinv30.seq
 133871921     gbinv31.seq
 249988511     gbinv4.seq
 249994389     gbinv5.seq
 249998099     gbinv6.seq
 212788123     gbinv7.seq
 249998274     gbinv8.seq
 249999242     gbinv9.seq
 140409133     gbjou1.idx
 261810692     gbjou10.idx
 235558279     gbjou11.idx
  28729224     gbjou12.idx
 208214193     gbjou2.idx
 142011534     gbjou3.idx
 258647429     gbjou4.idx
 283556534     gbjou5.idx
 278686499     gbjou6.idx
 271786403     gbjou7.idx
 300920547     gbjou8.idx
 298564134     gbjou9.idx
 322108768     gbkey1.idx
 180071056     gbkey2.idx
 179971889     gbkey3.idx
 183186464     gbkey4.idx
 183501944     gbkey5.idx
 101453045     gbkey6.idx
 249939479     gbmam1.seq
 249998446     gbmam2.seq
 249873230     gbmam3.seq
 249997230     gbmam4.seq
 249998835     gbmam5.seq
 249999097     gbmam6.seq
 143280619     gbmam7.seq
  28731546     gbnew.txt
 249999696     gbpat1.seq
 249999663     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192934308     gbpat107.seq
 249999769     gbpat108.seq
 249999627     gbpat109.seq
 179524503     gbpat11.seq
 249999185     gbpat110.seq
  80117336     gbpat111.seq
 249999282     gbpat112.seq
 249999935     gbpat113.seq
 249978955     gbpat114.seq
 249999878     gbpat115.seq
 249849703     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 249999231     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 249994149     gbpat13.seq
 249997452     gbpat130.seq
 249996753     gbpat131.seq
 250000045     gbpat132.seq
 249999866     gbpat133.seq
 114070280     gbpat134.seq
 250000124     gbpat135.seq
 249999983     gbpat136.seq
 250000108     gbpat137.seq
  86031991     gbpat138.seq
 249999922     gbpat139.seq
 250000095     gbpat14.seq
 249999851     gbpat140.seq
 249999039     gbpat141.seq
  63534417     gbpat142.seq
 249998115     gbpat143.seq
 249998432     gbpat144.seq
 249999313     gbpat145.seq
 249999902     gbpat146.seq
 249999243     gbpat147.seq
 249997298     gbpat148.seq
 222063932     gbpat149.seq
 249996517     gbpat15.seq
 250000249     gbpat150.seq
 249999893     gbpat151.seq
 249999893     gbpat152.seq
 220539897     gbpat153.seq
 249999753     gbpat154.seq
 249998945     gbpat155.seq
 250000134     gbpat156.seq
  11330901     gbpat157.seq
 249997013     gbpat158.seq
 249997498     gbpat159.seq
 249999147     gbpat16.seq
 249999720     gbpat160.seq
 249997368     gbpat161.seq
  35336717     gbpat162.seq
 249998568     gbpat163.seq
 249997741     gbpat164.seq
 250000251     gbpat165.seq
 249999115     gbpat166.seq
 249961356     gbpat167.seq
  70346410     gbpat168.seq
  65866387     gbpat17.seq
 250000027     gbpat18.seq
 249999801     gbpat19.seq
 249999763     gbpat2.seq
 249999076     gbpat20.seq
 249995106     gbpat21.seq
 185815095     gbpat22.seq
 249999907     gbpat23.seq
 249837920     gbpat24.seq
 249999284     gbpat25.seq
 250000065     gbpat26.seq
  71180933     gbpat27.seq
 249983437     gbpat28.seq
 249999442     gbpat29.seq
 249998426     gbpat3.seq
 250000216     gbpat30.seq
 249999940     gbpat31.seq
 249999636     gbpat32.seq
 180161703     gbpat33.seq
 249997738     gbpat34.seq
 249999961     gbpat35.seq
 249998974     gbpat36.seq
 249999898     gbpat37.seq
 130526128     gbpat38.seq
 249995253     gbpat39.seq
 249999756     gbpat4.seq
 249979840     gbpat40.seq
 249999077     gbpat41.seq
 249998937     gbpat42.seq
 249999195     gbpat43.seq
 249816223     gbpat44.seq
 249999190     gbpat45.seq
 249999692     gbpat46.seq
 171260262     gbpat47.seq
 249999855     gbpat48.seq
 249998527     gbpat49.seq
  71790242     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164688826     gbpat56.seq
 249881328     gbpat57.seq
 249997679     gbpat58.seq
 249999787     gbpat59.seq
 249999527     gbpat6.seq
 249999118     gbpat60.seq
 134917207     gbpat61.seq
 249998246     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999532     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249999914     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244402927     gbpat72.seq
 248968678     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999937     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249996070     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249999823     gbpat82.seq
 249999742     gbpat83.seq
  93329421     gbpat84.seq
 249153657     gbpat85.seq
 249998925     gbpat86.seq
 249999067     gbpat87.seq
 249999347     gbpat88.seq
 249999476     gbpat89.seq
 249998073     gbpat9.seq
 249998929     gbpat90.seq
 145288703     gbpat91.seq
 249998977     gbpat92.seq
 249998980     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196964910     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 153970011     gbphg1.seq
 249999203     gbpln1.seq
 249990861     gbpln10.seq
 249995453     gbpln11.seq
 249855387     gbpln12.seq
 214505508     gbpln13.seq
 249998215     gbpln14.seq
 249985349     gbpln15.seq
 249996352     gbpln16.seq
 249413610     gbpln17.seq
 249979847     gbpln18.seq
 249606502     gbpln19.seq
 249835551     gbpln2.seq
 249998619     gbpln20.seq
  32430677     gbpln21.seq
 249997185     gbpln22.seq
  97502116     gbpln23.seq
 249998537     gbpln24.seq
 249997282     gbpln25.seq
 247000376     gbpln26.seq
 195754294     gbpln27.seq
 247675171     gbpln28.seq
 248393733     gbpln29.seq
 249907288     gbpln3.seq
 249999043     gbpln30.seq
 249999462     gbpln31.seq
 249998795     gbpln32.seq
  96285213     gbpln33.seq
 249998348     gbpln34.seq
 249998141     gbpln35.seq
 250000116     gbpln36.seq
 249997214     gbpln37.seq
 134069193     gbpln38.seq
 249998875     gbpln39.seq
 249904699     gbpln4.seq
 249999086     gbpln40.seq
 249998542     gbpln41.seq
 249983917     gbpln42.seq
 249999329     gbpln43.seq
  28998419     gbpln44.seq
 249998078     gbpln45.seq
 250000155     gbpln46.seq
 249999485     gbpln47.seq
 249998559     gbpln48.seq
 249997002     gbpln49.seq
 249895160     gbpln5.seq
 101203451     gbpln50.seq
 249842743     gbpln6.seq
 249998347     gbpln7.seq
 149344400     gbpln8.seq
 249999633     gbpln9.seq
 148950419     gbpri1.seq
 249923492     gbpri10.seq
 128569006     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902427     gbpri16.seq
 249853720     gbpri17.seq
 249795954     gbpri18.seq
 249857339     gbpri19.seq
 249952671     gbpri2.seq
 249878907     gbpri20.seq
 249982525     gbpri21.seq
 234508314     gbpri22.seq
 177480181     gbpri23.seq
 249995549     gbpri24.seq
 211364614     gbpri25.seq
 249813409     gbpri26.seq
 249887578     gbpri27.seq
 249999931     gbpri28.seq
 249905987     gbpri29.seq
 249777154     gbpri3.seq
 249975289     gbpri30.seq
 249953974     gbpri31.seq
 249889749     gbpri32.seq
 249997967     gbpri33.seq
  82054535     gbpri34.seq
 249993971     gbpri35.seq
 249995585     gbpri36.seq
 249985327     gbpri37.seq
 249996213     gbpri38.seq
 249998234     gbpri39.seq
 249912041     gbpri4.seq
 176660208     gbpri40.seq
 249997624     gbpri41.seq
 230636057     gbpri42.seq
 249847714     gbpri5.seq
 249958909     gbpri6.seq
 249889400     gbpri7.seq
 249895686     gbpri8.seq
 249954688     gbpri9.seq
    310045     gbrel.txt
 249882903     gbrod1.seq
 249952616     gbrod10.seq
  60961015     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249873165     gbrod18.seq
 229467377     gbrod19.seq
 249942176     gbrod2.seq
 249812401     gbrod20.seq
 249924095     gbrod21.seq
 230155519     gbrod22.seq
 249992015     gbrod23.seq
 249999998     gbrod24.seq
 249945267     gbrod25.seq
 249902066     gbrod26.seq
 249999356     gbrod27.seq
 249998424     gbrod28.seq
 138882931     gbrod29.seq
 249785229     gbrod3.seq
 249743057     gbrod4.seq
 249987585     gbrod5.seq
 249985583     gbrod6.seq
 249746791     gbrod7.seq
 249760313     gbrod8.seq
 249867062     gbrod9.seq
3673514348     gbsdr1.txt
5624955303     gbsdr2.txt
2606395810     gbsdr3.txt
 148853972     gbsec.idx
 249996975     gbsts1.seq
 249997720     gbsts10.seq
 210919464     gbsts11.seq
 249996524     gbsts12.seq
 249998879     gbsts13.seq
 249998985     gbsts14.seq
 249999338     gbsts15.seq
  24465750     gbsts16.seq
 249999107     gbsts17.seq
 249997782     gbsts18.seq
 250000230     gbsts19.seq
 249999957     gbsts2.seq
 146530646     gbsts20.seq
 249999302     gbsts3.seq
 250000060     gbsts4.seq
  39162150     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998706     gbsts9.seq
 249995790     gbsyn1.seq
 249992831     gbsyn2.seq
  39613100     gbsyn3.seq
 249999677     gbtsa1.seq
 249997567     gbtsa10.seq
 249998982     gbtsa11.seq
  89044265     gbtsa12.seq
 249997835     gbtsa13.seq
 249999221     gbtsa14.seq
 249999134     gbtsa15.seq
 249998282     gbtsa16.seq
 167230959     gbtsa17.seq
 249998694     gbtsa18.seq
 249998364     gbtsa19.seq
 249999837     gbtsa2.seq
 249999006     gbtsa20.seq
 249999246     gbtsa21.seq
  94452859     gbtsa22.seq
 249997811     gbtsa23.seq
 249998850     gbtsa24.seq
 249995466     gbtsa25.seq
 250000259     gbtsa26.seq
 140930144     gbtsa27.seq
 250000220     gbtsa28.seq
 249998088     gbtsa29.seq
 250000222     gbtsa3.seq
 250000164     gbtsa30.seq
 249998944     gbtsa31.seq
 249998868     gbtsa32.seq
 250000091     gbtsa33.seq
 249999091     gbtsa34.seq
  86770643     gbtsa35.seq
 249999116     gbtsa4.seq
  82924795     gbtsa5.seq
 249999551     gbtsa6.seq
 249997776     gbtsa7.seq
 249999453     gbtsa8.seq
 249998270     gbtsa9.seq
    486530     gbuna1.seq
 249997770     gbvrl1.seq
 250000130     gbvrl10.seq
  59466882     gbvrl11.seq
 249988531     gbvrl12.seq
 249999237     gbvrl13.seq
 249996433     gbvrl14.seq
 249998850     gbvrl15.seq
 249996343     gbvrl16.seq
 249999492     gbvrl17.seq
 224743242     gbvrl18.seq
 249999441     gbvrl2.seq
 249997938     gbvrl3.seq
 249997566     gbvrl4.seq
 177063613     gbvrl5.seq
 249999454     gbvrl6.seq
 249999463     gbvrl7.seq
 250000129     gbvrl8.seq
 250000255     gbvrl9.seq
 249856855     gbvrt1.seq
 249855727     gbvrt10.seq
 249950363     gbvrt11.seq
 185412106     gbvrt12.seq
 249995062     gbvrt13.seq
 249952465     gbvrt14.seq
 249989514     gbvrt15.seq
 249997486     gbvrt16.seq
 249998088     gbvrt17.seq
 249997528     gbvrt18.seq
  96397769     gbvrt19.seq
 249998186     gbvrt2.seq
 249979108     gbvrt20.seq
 249997682     gbvrt21.seq
 249997583     gbvrt22.seq
 249997399     gbvrt23.seq
 112975221     gbvrt24.seq
 249801505     gbvrt3.seq
 249999230     gbvrt4.seq
  84754879     gbvrt5.seq
 249999410     gbvrt6.seq
 249999888     gbvrt7.seq
 249934780     gbvrt8.seq
 249759826     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         58685      89255000
BCT10        59         115338437
BCT11        104        115778006
BCT12        13756      108653328
BCT13        2400       2270390
BCT14        53934      85390363
BCT15        93         110189094
BCT16        151        93915681
BCT17        61         112455059
BCT18        52         112042350
BCT19        46         114233015
BCT2         79         110915938
BCT20        58         114931588
BCT21        67         111284815
BCT22        36         96325907
BCT23        40         106881287
BCT24        58         105533856
BCT25        74         111675186
BCT26        55         110045255
BCT27        63         106845575
BCT28        55         109391288
BCT29        52         108559385
BCT3         55         112957780
BCT30        46         110496749
BCT31        95         109522868
BCT32        59         110966729
BCT33        67         108616570
BCT34        123        106326491
BCT35        35         64734494
BCT36        202        109105429
BCT37        51         109861512
BCT38        40         106911174
BCT39        54         104252121
BCT4         1695       109790801
BCT40        58         107350200
BCT41        44         110960713
BCT42        80         107599606
BCT43        52         108900333
BCT44        54         106277557
BCT45        79         106886118
BCT46        51         107288069
BCT47        50         40642874
BCT48        67         107603750
BCT49        60         101650984
BCT5         36665      60769873
BCT50        47         106810333
BCT51        58         106248224
BCT52        56         110504049
BCT53        55         104029628
BCT54        57         105662058
BCT55        57         109883829
BCT56        63         114880292
BCT57        244        97462175
BCT58        417        83484775
BCT59        1589       2511877
BCT6         39043      82648951
BCT60        3179       5215895
BCT61        6347       7901828
BCT62        12648      15076611
BCT63        25628      27748212
BCT64        50523      53965241
BCT65        76542      77437730
BCT66        71891      77221686
BCT67        8313       95964836
BCT68        5278       104271863
BCT69        2974       107403177
BCT7         5523       96145465
BCT70        66         118800768
BCT71        7085       111746083
BCT72        66741      80293734
BCT73        75770      78726570
BCT74        64885      86405264
BCT75        20534      39342124
BCT8         13866      90149060
BCT9         6715       96271819
ENV1         93817      71944796
ENV10        82998      87008628
ENV11        19089      16808434
ENV12        84894      80972564
ENV13        120708     43404632
ENV14        88757      78240527
ENV15        96716      67908399
ENV16        96430      63145127
ENV17        89421      69069979
ENV18        60883      82199978
ENV19        69532      85606513
ENV2         87938      70215902
ENV20        94291      72056864
ENV21        128622     31367820
ENV22        123353     29531812
ENV23        63069      14107960
ENV24        123220     49902220
ENV25        98412      67527841
ENV26        120312     57153932
ENV27        139945     51961557
ENV28        101388     64592241
ENV29        27737      26247630
ENV3         92180      75779969
ENV30        71058      96548027
ENV31        95444      69503510
ENV32        108213     43943006
ENV33        89333      67649284
ENV34        55678      34242438
ENV35        111426     47305785
ENV36        103629     60566899
ENV37        80496      85227995
ENV38        70396      95663367
ENV39        92362      71854260
ENV4         77783      85823309
ENV40        110585     57008424
ENV41        107511     59922790
ENV42        32495      25382292
ENV5         93439      80106280
ENV6         70599      40663617
ENV7         131791     31268854
ENV8         86946      71038957
ENV9         93944      73218738
EST1         158932     61578479
EST10        167467     72170705
EST100       226243     140246055
EST101       227616     115485205
EST102       201377     104748709
EST103       171811     101005787
EST104       102122     80240129
EST105       165124     110888376
EST106       168484     110405996
EST107       116997     68050411
EST108       63862      23524472
EST109       64110      22728516
EST11        169529     73974696
EST110       64333      23423547
EST111       64294      27229552
EST112       64309      21908358
EST113       65711      25952004
EST114       63772      27851281
EST115       64287      26251059
EST116       64524      26960814
EST117       64245      25130254
EST118       61224      38058968
EST119       162246     77038327
EST12        166825     70070117
EST120       174886     86181338
EST121       158364     92878256
EST122       149630     95737947
EST123       153461     89563546
EST124       126137     78380420
EST125       202977     99387306
EST126       153461     79468948
EST127       158021     84352468
EST128       155596     89077648
EST129       149675     79524551
EST13        72715      34889194
EST130       174591     101464271
EST131       200136     116349247
EST132       182396     99508569
EST133       162807     84305369
EST134       158376     80379707
EST135       146304     89306022
EST136       142025     85585576
EST137       93509      49235104
EST138       188163     107242327
EST139       232234     101987211
EST14        217723     109309966
EST140       152940     89657828
EST141       168240     91530195
EST142       146978     87185842
EST143       137589     86851748
EST144       157590     95368625
EST145       146222     76531113
EST146       123463     64405939
EST147       121769     65836552
EST148       129198     54536432
EST149       127612     50728572
EST15        168569     105331186
EST150       128331     51061832
EST151       119665     45516034
EST152       171986     86430301
EST153       180117     80432630
EST154       154649     109509540
EST155       211713     129311062
EST156       215417     119838490
EST157       174374     93018182
EST158       147096     111958774
EST159       134264     83216417
EST16        178944     112365730
EST160       157163     97895127
EST161       149752     80064940
EST162       142405     81978026
EST163       168531     94465883
EST164       72502      43359989
EST165       154658     96052504
EST166       188756     105990555
EST167       142890     78257948
EST168       135286     71817560
EST169       169061     94267933
EST17        195320     112927330
EST170       179565     103192674
EST171       150948     94327391
EST172       171469     83794329
EST173       129934     86523177
EST174       183744     108280828
EST175       164084     92777460
EST176       111832     66202721
EST177       164865     94229771
EST178       32851      20648816
EST179       169059     101120120
EST18        190611     121507952
EST180       181513     127709919
EST181       148900     106517921
EST182       190668     99306177
EST183       152810     115929694
EST184       144157     86934090
EST185       145404     82969079
EST186       177758     71917351
EST187       149535     84425940
EST188       155091     97039661
EST189       162501     99685911
EST19        159237     114034932
EST190       142561     88423034
EST191       161941     94295532
EST192       133736     89919862
EST193       131196     88374542
EST194       145013     89337464
EST195       134011     89300960
EST196       123932     87014517
EST197       173285     92459389
EST198       173992     95867310
EST199       173450     96322288
EST2         161860     61550624
EST20        187090     99428712
EST200       171169     96066434
EST201       168256     94202550
EST202       172250     95872690
EST203       173459     95044224
EST204       174007     95566488
EST205       32237      17535529
EST206       191225     103858778
EST207       202333     106571348
EST208       174712     105326940
EST209       183796     103913981
EST21        217125     106473537
EST210       197121     118564769
EST211       195596     116487043
EST212       182811     121341553
EST213       174169     104999421
EST214       214296     146886392
EST215       237590     107491536
EST216       139188     108084652
EST217       150577     101304743
EST218       146717     90960234
EST219       206037     111632834
EST22        198654     65830502
EST220       171836     113699117
EST221       99864      91369719
EST222       142722     110419236
EST223       160867     94615799
EST224       145611     106217573
EST225       216482     100682264
EST226       144124     101911657
EST227       137855     96881908
EST228       140434     100747763
EST229       121105     86087020
EST23        140907     40077659
EST230       95759      61656521
EST231       141452     91734604
EST232       133066     98067961
EST233       137716     98123758
EST234       123942     84427287
EST235       132798     86789728
EST236       158087     116671879
EST237       143324     117078073
EST238       133635     113047705
EST239       154983     95505115
EST24        103788     28103246
EST240       177977     112853555
EST241       146362     92435835
EST242       179476     112634393
EST243       164492     122299684
EST244       140481     104169873
EST245       11561      9381163
EST246       164714     100615452
EST247       231388     97092810
EST248       151978     113229291
EST249       179473     65049460
EST25        121744     50998075
EST250       217003     50038462
EST251       212340     82294713
EST252       171181     131272817
EST253       165221     101379270
EST254       169373     107860278
EST255       164214     111345862
EST256       166788     117148079
EST257       86298      44333850
EST258       187516     98334089
EST259       176380     111581834
EST26        213566     97253517
EST260       165318     109202982
EST261       233180     110649585
EST262       278258     120123928
EST263       183373     111845792
EST264       187454     36839070
EST265       259312     124366273
EST266       151667     94581423
EST267       161055     105003770
EST268       96486      56238519
EST269       174002     118521429
EST27        219255     110172725
EST270       183504     98663142
EST271       172337     113469060
EST272       182186     105404513
EST273       207960     36624156
EST274       190878     56173619
EST275       185642     105858105
EST276       187422     118288243
EST277       173053     113346445
EST278       179933     102629753
EST279       156425     104368835
EST28        190331     88460687
EST280       111498     37301241
EST281       129567     81592044
EST282       132932     85980239
EST283       156228     100467692
EST284       259869     27441583
EST285       263840     24257504
EST286       146358     106011331
EST287       168768     109365331
EST288       161509     102910743
EST289       155893     91017086
EST29        157928     68872707
EST290       264437     32068637
EST291       165084     108386906
EST292       73958      42946288
EST293       184839     111078143
EST294       149328     91148334
EST295       195304     109643741
EST296       164273     114836900
EST297       162085     104391732
EST298       189129     113889721
EST299       179371     100266528
EST3         153644     54437600
EST30        171506     69597103
EST300       181438     103317106
EST301       188346     64340839
EST302       187451     69745707
EST303       187274     70837928
EST304       122475     47081553
EST305       187168     91811109
EST306       182049     133319321
EST307       149694     86297028
EST308       154219     90747847
EST309       128792     100377357
EST31        149152     63303313
EST310       157122     97917840
EST311       172526     98496840
EST312       155616     98072349
EST313       169540     97158435
EST314       158481     105989749
EST315       145086     101552168
EST316       165231     106398863
EST317       154047     113691616
EST318       182352     153684917
EST319       172874     94179172
EST32        168257     76112343
EST320       134259     85108701
EST321       144111     99219209
EST322       140717     93909741
EST323       139826     91381774
EST324       145668     101535794
EST325       151004     101275030
EST326       179220     106353564
EST327       149679     86805504
EST328       151775     86260629
EST329       155048     112488123
EST33        174119     66765033
EST330       158743     94859549
EST331       74724      49683754
EST332       139392     87223240
EST333       153670     95402301
EST334       205444     106068103
EST335       114395     62912377
EST336       103264     65677440
EST337       132596     88707185
EST338       138915     87899089
EST339       122865     75654803
EST34        122436     42980065
EST340       217054     82988041
EST341       182051     85877425
EST342       157174     95458639
EST343       177913     108826783
EST344       151006     90194217
EST345       83525      54931143
EST346       134779     90090177
EST347       146854     95485641
EST348       186734     116632084
EST349       158540     90471301
EST35        97395      29886474
EST350       174775     100195910
EST351       175946     129644358
EST352       80756      48889306
EST353       86592      48653324
EST354       145959     84237593
EST355       131100     77330876
EST356       158098     41740608
EST357       158948     31634324
EST358       157274     50522828
EST359       182752     119140827
EST36        97796      30592757
EST360       247435     114259436
EST361       250786     114852705
EST362       175608     99406043
EST363       142320     92327086
EST364       137896     86155798
EST365       156673     93383607
EST366       195405     120050413
EST367       222237     58892885
EST368       185299     113126555
EST369       212811     121569992
EST37        96710      29343773
EST370       144160     69647975
EST371       4665       2115068
EST372       192239     120599946
EST373       165800     104812258
EST374       163043     124839702
EST375       180775     147171457
EST376       156978     90021281
EST377       198339     111513808
EST378       204149     115983782
EST379       178265     103724899
EST38        98631      29841326
EST380       212631     133448329
EST381       189900     122193726
EST382       216249     136293100
EST383       21098      18051420
EST384       212256     166830827
EST385       184447     108602541
EST386       183882     85795866
EST387       168522     13163767
EST388       156692     13648645
EST389       157969     29813160
EST39        99465      31211921
EST390       158892     31770234
EST391       158584     32503650
EST392       148058     86731381
EST393       182288     108254213
EST394       162983     112937445
EST395       167491     97718016
EST396       37171      27328104
EST397       146938     100025874
EST398       142477     99971358
EST399       147427     93466403
EST4         170812     67108330
EST40        23453      5982761
EST400       176641     127066899
EST401       145216     93360203
EST402       173599     94967568
EST403       167851     26612867
EST404       166609     80353017
EST405       152314     106282951
EST406       171535     108060541
EST407       142000     84707681
EST408       186390     103148392
EST409       152769     111693317
EST41        100929     53081949
EST410       141027     92862512
EST411       132205     90563627
EST412       154638     95577944
EST413       162494     94282736
EST414       176668     94844940
EST415       150649     93826765
EST416       169117     99941918
EST417       176307     108014623
EST418       123713     80264221
EST419       85200      64936082
EST42        119766     50950194
EST420       99800      66521609
EST421       150935     84865183
EST422       122668     75464561
EST423       142518     89825332
EST424       37768      26032229
EST425       142079     83403160
EST426       167162     97689827
EST427       165885     90294241
EST428       184375     112416905
EST429       135389     90568955
EST43        164268     85724610
EST430       179063     82806033
EST431       164177     84216720
EST432       147652     83634748
EST433       196167     116942052
EST434       148248     92937821
EST435       136580     88887858
EST436       202110     71973307
EST437       109720     50346117
EST438       205442     87669743
EST439       209899     98523363
EST44        166526     67575751
EST440       212573     123350141
EST441       164003     101781134
EST442       177485     111426064
EST443       134841     101474066
EST444       189650     104339282
EST445       163837     59945729
EST446       167382     61615365
EST447       70394      26515856
EST45        166231     87656112
EST46        170515     87042095
EST47        162168     87642043
EST48        162722     82190576
EST49        157548     91109328
EST5         168996     66194437
EST50        161285     90955339
EST51        158811     98442598
EST52        157159     69416873
EST53        150555     82911635
EST54        81517      49865731
EST55        167810     67437601
EST56        160485     76558470
EST57        169028     93232875
EST58        156510     101555965
EST59        157521     100138986
EST6         171504     66930687
EST60        163281     100735833
EST61        160637     106123384
EST62        172743     73914410
EST63        173099     101002538
EST64        151297     80220604
EST65        151211     84181847
EST66        158907     99323139
EST67        137470     78902440
EST68        143242     84930123
EST69        196189     109255851
EST7         169781     72705821
EST70        198110     103942620
EST71        211381     118564719
EST72        192267     113467100
EST73        193714     114097137
EST74        160347     86287066
EST75        133186     62205359
EST76        137010     68772582
EST77        158509     108089595
EST78        155589     85626524
EST79        144509     78799557
EST8         179409     72875725
EST80        55932      37667294
EST81        182772     94253065
EST82        211425     123427030
EST83        213942     114892140
EST84        209593     98586609
EST85        208716     91055998
EST86        148590     90297293
EST87        144382     83804651
EST88        162642     81150091
EST89        159985     80844882
EST9         168510     69277220
EST90        152203     103108752
EST91        152443     99415795
EST92        133252     75489904
EST93        152416     115346042
EST94        141961     104565030
EST95        145446     105517944
EST96        139321     88094695
EST97        153203     86330519
EST98        174575     107213642
EST99        243909     149469709
GSS1         200065     87618868
GSS10        132040     60283372
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167238     128921102
GSS104       149783     82569304
GSS105       191527     120854119
GSS106       167754     112128998
GSS107       197330     115526115
GSS108       204980     134772397
GSS109       209811     138226934
GSS11        137026     73963307
GSS110       207577     140849120
GSS111       206236     142442604
GSS112       205252     143736524
GSS113       205174     143940262
GSS114       202120     146640781
GSS115       182321     139886386
GSS116       18402      10868805
GSS117       132848     84052151
GSS118       169611     80019194
GSS119       185717     80451589
GSS12        147892     75892162
GSS120       170454     148554436
GSS121       178779     121970376
GSS122       184678     149590824
GSS123       192460     124905041
GSS124       187664     137491829
GSS125       192956     126317294
GSS126       188798     97295250
GSS127       165751     151327959
GSS128       164495     116025886
GSS129       71629      48449951
GSS13        145394     68606548
GSS130       171039     155483517
GSS131       172723     154180802
GSS132       172116     155501394
GSS133       173773     154311856
GSS134       174061     152721060
GSS135       184042     145572037
GSS136       180024     146309329
GSS137       163728     112649974
GSS138       214849     84091341
GSS139       265737     40936752
GSS14        169809     84775490
GSS140       265733     40959862
GSS141       49811      7634149
GSS142       257667     58097193
GSS143       247381     64704717
GSS144       195066     78959591
GSS145       134269     35588307
GSS146       87126      64015147
GSS147       83554      62807042
GSS148       103685     48624361
GSS149       68568      58467902
GSS15        161100     97663213
GSS150       7638       6998117
GSS151       68591      57924394
GSS152       69224      56650935
GSS153       69460      56187403
GSS154       71202      55998401
GSS155       68561      51865315
GSS156       75915      58209304
GSS157       87237      74898207
GSS158       81830      44609896
GSS159       92677      45029689
GSS16        172836     87033749
GSS160       63209      47603494
GSS161       77435      61351403
GSS162       69655      58699293
GSS163       67711      62706526
GSS164       62009      53369632
GSS165       95592      42925428
GSS166       21061      4909542
GSS167       112938     70877522
GSS168       822        559311
GSS169       23226      28867035
GSS17        183523     113501533
GSS170       109043     70652585
GSS171       84533      34668223
GSS172       35815      22222733
GSS173       103304     62490220
GSS174       102329     63761256
GSS175       104268     67656826
GSS176       82099      41276456
GSS177       83102      54651503
GSS178       95673      61335435
GSS179       107323     78547443
GSS18        192358     114305774
GSS180       106375     76684757
GSS181       106058     79947480
GSS182       103996     80016519
GSS183       76374      51039123
GSS184       104572     63292187
GSS185       109868     66415305
GSS186       106205     59313311
GSS187       68379      37446344
GSS188       69561      38732329
GSS189       37157      17778905
GSS19        114075     52103409
GSS190       85481      46023427
GSS191       97119      55907586
GSS192       94982      49597190
GSS193       96286      55922591
GSS194       42132      23615490
GSS195       114638     43642267
GSS196       117085     39368203
GSS197       108676     55514545
GSS198       101471     78372335
GSS199       68774      44253973
GSS2         182294     92190805
GSS20        181789     101771260
GSS200       95891      36542252
GSS201       95417      37268709
GSS202       96671      35161518
GSS203       94285      39167432
GSS204       37736      17626556
GSS205       103939     66277823
GSS206       94551      61190929
GSS207       95128      60357048
GSS208       94773      60868501
GSS209       75675      70017159
GSS21        166208     114173594
GSS210       75117      74330280
GSS211       4473       7127270
GSS212       83736      28233267
GSS213       84219      27346468
GSS214       84926      25909272
GSS215       14851      4422302
GSS216       16547      7508221
GSS217       92648      59635081
GSS218       84624      52490775
GSS219       94061      50735685
GSS22        169506     97609042
GSS220       88579      48354065
GSS221       10731      5841916
GSS222       90648      56882510
GSS223       89662      61882079
GSS224       88553      63641206
GSS225       89283      62505584
GSS226       9890       7129098
GSS227       87995      63795538
GSS228       90217      62488977
GSS229       94638      59913510
GSS23        187251     126687349
GSS230       74308      63032786
GSS231       84243      78882674
GSS232       83029      80585163
GSS233       70505      52672246
GSS234       117650     64297121
GSS235       108874     55446727
GSS236       107533     52125503
GSS237       96658      43251344
GSS238       109801     49060015
GSS239       98194      46325477
GSS24        194057     130219707
GSS240       73059      72225597
GSS241       76682      71142435
GSS242       72980      46435649
GSS243       94787      57200301
GSS244       93517      59081345
GSS245       93900      58510429
GSS246       94714      57307691
GSS247       94279      58016121
GSS248       6701       3333254
GSS25        177481     105207105
GSS26        185918     107808246
GSS27        170600     151419573
GSS28        190494     146229226
GSS29        151147     106441309
GSS3         174947     87827485
GSS30        192446     132128206
GSS31        13634      8776287
GSS32        196044     127318947
GSS33        216659     116231837
GSS34        218573     113602417
GSS35        219720     112025390
GSS36        213958     121897898
GSS37        198560     156434224
GSS38        194991     146802885
GSS39        197241     73368303
GSS4         167154     85100946
GSS40        185065     97681837
GSS41        189783     125959643
GSS42        170343     158769399
GSS43        9054       5887224
GSS44        183999     100320381
GSS45        173031     121666603
GSS46        185089     124654949
GSS47        190835     122398659
GSS48        70734      62565384
GSS49        171799     101963548
GSS5         53442      31615955
GSS50        167647     103037030
GSS51        167798     102616122
GSS52        184194     121477291
GSS53        184774     116632196
GSS54        181686     122485290
GSS55        187531     113994336
GSS56        189392     134519036
GSS57        178947     104938173
GSS58        195715     120562907
GSS59        179925     133347062
GSS6         161617     84471320
GSS60        1898       1718384
GSS61        172927     139004649
GSS62        161633     111556933
GSS63        161679     111560086
GSS64        158740     107545551
GSS65        156768     129062324
GSS66        170185     142553826
GSS67        179844     117096102
GSS68        204956     127989095
GSS69        193312     110751728
GSS7         165323     79361698
GSS70        244049     126053657
GSS71        160164     106280071
GSS72        159390     119843139
GSS73        162663     124539223
GSS74        162628     124600532
GSS75        175126     108966900
GSS76        190291     140108043
GSS77        12966      7534733
GSS78        199135     126616367
GSS79        170370     111603100
GSS8         165782     88979927
GSS80        200718     131518447
GSS81        214948     86011305
GSS82        187080     100057507
GSS83        131104     91989085
GSS84        146939     117974637
GSS85        139562     116979023
GSS86        142823     114217730
GSS87        143960     119802766
GSS88        141946     115786817
GSS89        104815     87300351
GSS9         137999     67157686
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        64114      67400022
HTC11        74630      76211752
HTC12        21346      31167752
HTC13        66997      61008541
HTC14        68336      69516375
HTC15        22362      15458555
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         62290      77331613
HTG1         1318       188771164
HTG10        1298       186333849
HTG100       990        189440077
HTG101       996        189331054
HTG102       985        189419172
HTG103       1161       190557355
HTG104       31         4345532
HTG105       1088       189830448
HTG106       1045       189793578
HTG107       1391       191463058
HTG108       1296       190938436
HTG109       1619       191178081
HTG11        6          837687
HTG110       1381       192006827
HTG111       1297       192021498
HTG112       1278       190196751
HTG113       1056       186244258
HTG114       792        126579668
HTG115       1513       182381556
HTG116       992        192258010
HTG117       929        180600602
HTG118       1076       193795486
HTG119       1103       193009753
HTG12        1451       183826000
HTG120       224        42068950
HTG121       1029       189518258
HTG122       1055       192800231
HTG123       1163       191955853
HTG124       1083       193036488
HTG125       1082       193047213
HTG126       602        105962989
HTG127       1121       192609598
HTG128       1081       192408488
HTG129       1078       192394098
HTG13        875        191579912
HTG130       1160       192079800
HTG131       1013       192362924
HTG132       1077       192134134
HTG133       1054       192365214
HTG134       1148       191322760
HTG135       1290       183968287
HTG14        753        192058598
HTG15        745        191952430
HTG16        786        192030578
HTG17        798        191859978
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2470       186037380
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189964220
HTG3         2513       185208586
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191697068
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2550       188439001
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010126
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190659453
HTG47        1176       190773374
HTG48        1129       191227547
HTG49        1046       190928744
HTG5         1283       185453274
HTG50        1027       189664964
HTG51        1048       179514385
HTG52        969        190087029
HTG53        1105       190108948
HTG54        1047       190298155
HTG55        1014       189831932
HTG56        969        189154538
HTG57        82         14401609
HTG58        1009       189284549
HTG59        1031       189911132
HTG6         1273       185124562
HTG60        1075       187343496
HTG61        1127       188239776
HTG62        998        172678990
HTG63        1086       189624557
HTG64        1064       189413842
HTG65        1168       188733122
HTG66        1178       187478964
HTG67        1283       184490539
HTG68        95         12336833
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187658245
HTG73        1023       170807599
HTG74        1118       188293510
HTG75        1103       190822609
HTG76        1136       190863851
HTG77        1182       190886617
HTG78        1097       186208548
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190062169
HTG81        1214       189987118
HTG82        1120       189706900
HTG83        959        164650927
HTG84        1228       188383308
HTG85        1251       187687552
HTG86        1142       189936537
HTG87        1144       189635018
HTG88        981        168316109
HTG89        1182       189780872
HTG9         1200       186916809
HTG90        1104       190250569
HTG91        1145       190090446
HTG92        1104       190500681
HTG93        980        161658653
HTG94        1056       190751264
HTG95        1159       191052343
HTG96        1033       189031946
HTG97        1070       189559758
HTG98        690        128563367
HTG99        1018       189641315
INV1         94114      48353748
INV10        83867      65329786
INV11        53361      42432273
INV12        84944      66277993
INV13        80913      67012795
INV14        78350      68176590
INV15        43705      40087937
INV16        8168       145023213
INV17        320        155148771
INV18        28265      118182138
INV19        15111      139095486
INV2         14077      165916429
INV20        34695      122269990
INV21        78314      57279892
INV22        73815      62885859
INV23        39190      25563394
INV24        55678      88090472
INV25        73018      48071618
INV26        73029      48051927
INV27        75340      52750389
INV28        70933      46773526
INV29        72098      48431646
INV3         1475       155974651
INV30        59193      68791316
INV31        13763      57668902
INV4         10879      132548449
INV5         76701      74840988
INV6         56440      86914691
INV7         43647      79553861
INV8         80627      71822999
INV9         59366      86014468
MAM1         14910      162841311
MAM2         22968      153627505
MAM3         55837      87108943
MAM4         13620      176585211
MAM5         78859      74766973
MAM6         54055      116984359
MAM7         44966      35184095
PAT1         222547     70116852
PAT10        124490     102559093
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224731     34113482
PAT109       250080     15844362
PAT11        98582      64113569
PAT110       180680     63680037
PAT111       51647      26043244
PAT112       114191     110462189
PAT113       137704     83281015
PAT114       164154     99345808
PAT115       158877     103325984
PAT116       137417     114988187
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142065     62828791
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105888     59875034
PAT130       44618      171217879
PAT131       32863      178783372
PAT132       101779     136605525
PAT133       185919     90675669
PAT134       94466      29751735
PAT135       203659     47736667
PAT136       277827     9628431
PAT137       220409     46465135
PAT138       106723     2881242
PAT139       270386     21672571
PAT14        103650     50160806
PAT140       186752     61240505
PAT141       109802     106056534
PAT142       47514      9550017
PAT143       87300      88252619
PAT144       78467      95592643
PAT145       145221     77687807
PAT146       167503     71383908
PAT147       121471     92947696
PAT148       102962     85404157
PAT149       165548     45989168
PAT15        121150     53321659
PAT150       270022     5130418
PAT151       269978     5129582
PAT152       269978     5129582
PAT153       237888     4519872
PAT154       269396     5118524
PAT155       235715     25782943
PAT156       204521     46982512
PAT157       11011      386637
PAT158       165317     74871979
PAT159       91688      126658582
PAT16        113145     61277722
PAT160       172595     71660689
PAT161       137855     72262761
PAT162       9530       13980165
PAT163       93111      87244841
PAT164       91739      79911553
PAT165       98423      91876909
PAT166       96672      134098081
PAT167       160038     76850969
PAT168       50701      16567190
PAT17        39141      16227175
PAT18        146771     52594264
PAT19        153705     78039102
PAT2         194541     84646278
PAT20        104995     118172564
PAT21        133550     95503155
PAT22        84598      79322013
PAT23        123566     103406367
PAT24        119412     105655419
PAT25        145492     86671235
PAT26        175170     64298181
PAT27        71360      1784000
PAT28        102171     77387698
PAT29        93958      87647590
PAT3         171983     95893688
PAT30        119943     61672014
PAT31        96649      78966375
PAT32        128385     55033926
PAT33        92204      51115231
PAT34        111299     78151838
PAT35        138103     29119101
PAT36        158499     24085905
PAT37        114684     49015396
PAT38        44863      54579873
PAT39        95734      83197609
PAT4         153734     106066478
PAT40        100230     70978875
PAT41        136206     39303264
PAT42        143780     35446924
PAT43        123731     64746991
PAT44        104355     81197550
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57195      23949265
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92813      89405535
PAT59        106520     74781286
PAT6         170642     91909261
PAT60        122361     64031080
PAT61        67421      30296794
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154786     88238970
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131210     96924023
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        93691      93465245
PAT84        34070      33980300
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164902     19209976
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129398     101135301
PAT90        175304     3330776
PAT91        101388     1926372
PAT92        169171     12412246
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140780     2674820
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6215       62579756
PLN1         59922      93462183
PLN10        37428      49337664
PLN11        40286      65710949
PLN12        22489      123976681
PLN13        21103      99490646
PLN14        17578      144865462
PLN15        17634      146278605
PLN16        17564      146392665
PLN17        24586      128622194
PLN18        6000       149205408
PLN19        1266       170315035
PLN2         33799      122791530
PLN20        14362      155620121
PLN21        6893       8116708
PLN22        67269      69784602
PLN23        29359      31543626
PLN24        76994      76407737
PLN25        65429      81430026
PLN26        40984      115855240
PLN27        32         71904925
PLN28        828        90039722
PLN29        24837      128290004
PLN3         1361       179311817
PLN30        22393      130882948
PLN31        77406      75364385
PLN32        99022      57868003
PLN33        27194      28527825
PLN34        80695      71319514
PLN35        78004      75868541
PLN36        80027      70428111
PLN37        82206      75800357
PLN38        56182      29768611
PLN39        101348     57349958
PLN4         1859       185865132
PLN40        80517      70118175
PLN41        45840      98969504
PLN42        14815      143052963
PLN43        56297      102813150
PLN44        10363      7025022
PLN45        81948      72183981
PLN46        71008      78066176
PLN47        83349      64679188
PLN48        79993      66624166
PLN49        69938      83488904
PLN5         1841       194288023
PLN50        18288      38154521
PLN6         1715       194277267
PLN7         53019      99541295
PLN8         45598      45032818
PLN9         73094      75878969
PRI1         23016      59646733
PRI10        1276       179396257
PRI11        767        93186623
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193649117
PRI18        1098       194157243
PRI19        1165       193624176
PRI2         18084      149789013
PRI20        1751       191728036
PRI21        2693       189710071
PRI22        20439      145991393
PRI23        31573      84616059
PRI24        61950      78204676
PRI25        31351      70630978
PRI26        6591       166738065
PRI27        2117       180626886
PRI28        1602       181666576
PRI29        2026       181683149
PRI3         1433       175194600
PRI30        1961       180647395
PRI31        13187      156618561
PRI32        1291       182960274
PRI33        44001      103796793
PRI34        20561      26565148
PRI35        32189      63608729
PRI36        20184      117587027
PRI37        18531      147089726
PRI38        66683      86892251
PRI39        49640      89409582
PRI4         1284       185536487
PRI40        38922      71746405
PRI41        52493      92988075
PRI42        54161      91812958
PRI5         1322       184232063
PRI6         1182       180028694
PRI7         1246       181069377
PRI8         1213       178383776
PRI9         1365       174641493
ROD1         32247      140810535
ROD10        987        181481529
ROD11        232        44057446
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190474838
ROD19        16685      142316547
ROD2         915        175393737
ROD20        20349      148361268
ROD21        1132       182075942
ROD22        1079       168068566
ROD23        13609      162595725
ROD24        38836      69261008
ROD25        21801      104569268
ROD26        1508       187778262
ROD27        135065     36436634
ROD28        83859      70576113
ROD29        38452      44907041
ROD3         905        173297900
ROD4         900        173792415
ROD5         923        174315076
ROD6         966        178209811
ROD7         968        179457909
ROD8         979        181267813
ROD9         994        181774273
STS1         85281      36762778
STS10        57907      44420267
STS11        48910      37503235
STS12        57924      43637361
STS13        64284      42850769
STS14        93608      34184854
STS15        104286     26516886
STS16        10114      2740613
STS17        103611     27476228
STS18        86930      34448685
STS19        99734      33367534
STS2         84354      49850361
STS20        54307      20631266
STS3         66846      26362713
STS4         76990      36946037
STS5         8457       4958885
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55716      37767321
SYN1         44614      73045790
SYN2         48807      68944622
SYN3         6879       14227651
TSA1         120505     38243959
TSA10        111315     38040522
TSA11        97611      30619321
TSA12        41410      15014778
TSA13        86486      70566494
TSA14        121991     38853496
TSA15        134868     35825115
TSA16        60971      79702835
TSA17        39395      53450233
TSA18        88109      76513628
TSA19        105546     51368709
TSA2         113528     41670793
TSA20        103647     54265974
TSA21        107408     46370259
TSA22        31546      21416649
TSA23        69301      60109553
TSA24        91457      63797902
TSA25        88509      79254371
TSA26        85494      73939043
TSA27        50452      42024094
TSA28        119300     45992130
TSA29        108870     50886151
TSA3         110398     41018342
TSA30        91124      71384365
TSA31        89041      76955437
TSA32        99311      60718797
TSA33        77284      87897940
TSA34        80253      93354702
TSA35        39870      18631458
TSA4         110952     45737441
TSA5         43145      10916057
TSA6         112597     59532934
TSA7         95600      66329173
TSA8         105785     68717235
TSA9         105858     64927558
UNA1         239        125912
VRL1         68638      68742257
VRL10        57385      74228861
VRL11        13623      17514684
VRL12        62750      71232624
VRL13        58114      72866748
VRL14        62754      65559960
VRL15        59482      72793458
VRL16        57525      72823894
VRL17        58164      71001344
VRL18        61284      61575082
VRL2         73411      64341665
VRL3         69559      61085938
VRL4         68161      70221345
VRL5         46015      47955486
VRL6         48256      77527463
VRL7         53796      71980791
VRL8         62753      71660746
VRL9         67792      66971254
VRT1         38137      129483755
VRT10        1256       189217442
VRT11        8274       177839690
VRT12        3993       136596069
VRT13        13095      170781188
VRT14        5350       182605112
VRT15        3936       186021840
VRT16        37672      134478373
VRT17        79857      68489435
VRT18        78435      66475074
VRT19        30159      24453861
VRT2         6096       186549297
VRT20        69762      80273470
VRT21        49172      117421412
VRT22        76002      63237201
VRT23        76950      58620391
VRT24        35121      28703258
VRT3         67659      84024517
VRT4         11608      165615396
VRT5         28003      22182903
VRT6         73017      66717352
VRT7         31733      63525372
VRT8         30639      112100808
VRT9         1202       189837495

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 185.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

19301988 15881839899   Homo sapiens
9296587   9118049806   Mus musculus
2187038   6503434302   Rattus norvegicus
2199144   5381235474   Bos taurus
3927943   5055840446   Zea mays
3222429   4793300236   Sus scrofa
1705210   3127958433   Danio rerio
228265    1352948327   Strongylocentrotus purpuratus
1343269   1251053810   Oryza sativa Japonica Group
1770193   1194842997   Nicotiana tabacum
1424327   1147237486   Xenopus (Silurana) tropicalis
2321188   1138511865   Arabidopsis thaliana
1224108   1058563193   Drosophila melanogaster
214236    1003309475   Pan troglodytes
1454515    947332578   Canis lupus familiaris
662510     915431680   Vitis vinifera
811571     896784038   Gallus gallus
1890146    895052594   Glycine max
82708      828906407   Macaca mulatta
738474     778132243   Solanum lycopersicum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 185.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 185.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Gert Roosen, Susan Schafer,
	Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
	Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade,	Constantin Vasilyev

User Support
	Peter Cooper, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center