Release Notes For GenBank Release 186
GBREL.TXT Genetic Sequence Data Bank
October 15 2011
NCBI-GenBank Flat File Release 186.0
Distribution Release Notes
144458648 loci, 132067413372 bases, from 144458648 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 186.0
1.2 Cutoff Date
1.3 Important Changes in Release 186.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 186.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for GenBank's web-based submission tool (BankIt) :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 186.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 186.0, incorporates data available to the collaborating
databases as of October 13, 2011 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 186.0
1.3.1 Organizational changes
The total number of sequence data files increased by 23 with this release:
- the BCT division is now composed of 77 files (+2)
- the CON division is now composed of 152 files (+3)
- the ENV division is now composed of 43 files (+1)
- the EST division is now composed of 450 files (+3)
- the HTC division is now composed of 14 files (-1)
- the HTG division is now composed of 136 files (+1)
- the INV division is now composed of 30 files (-1)
- the PAT division is now composed of 171 files (+3)
- the PLN division is now composed of 51 files (+1)
- the PRI division is now composed of 44 files (+2)
- the TSA division is now composed of 43 files (+8)
- the VRL division is now composed of 19 files (+1)
The number of HTC division files decreased by one because nearly 37,000
high-throughput sequences for human cDNA clones were removed at the
submitter's request.
The number of INV division files decreased by one because WGS project CABG01
has replaced approximately 19,000 (non-WGS) records for the Schistosoma mansoni
genome.
The total number of 'index' files increased by 2 with this release:
- the AUT (author name) index is now composed of 91 files (+2)
1.3.2 New centromere and telomere features
Telomeres and centromeres are essential features of chromosomes and
disrupting their structure affects the viability and life span of an
organism. Centromeric sequence varies from a compact, non-repetitive,
less than 150 base pair region in S. cerevisiae to a highly repetitive
and complex region of several hundred thousands of base pairs in
eukaryote genomes. The sequence at the telomeric ends is unique compared
to the rest of the chromosome and protects the chromosome ends from
recombination, fusion to other chromosomes or degradation by nucleases.
Currently telomere and centromere features may be under-annotated since
there are no specific feature keys for them, hence the INSDC approved
the creation of two new features, which are now allowed as of the
October 15 2011 GenBank Release.
These two features are intended for use when the centromere or telomere
have been actually been sequenced. These two new features are now legal as
of this GenBank Release 186.0 (October 15 2011).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Feature Key centromere
Definition region of biological interest identified as a centromere
and which have been experimentally characterized
Optional qualifiers /centromere_type=<centromere_type>
/citation=[number]
/db_xref="<database>:<identifier>"
/experiment="[CATEGORY:]text"
/inference="[CATEGORY:]TYPE[ (same species)][:EVIDENCE_BASIS]"
/note="text"
/standard_name="text"
Comment the centromere feature describes the interval of DNA
that corresponds to a region where chromatids are held
and a kinetochore is formed
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Qualifier /centromere_type=
Definition type of centromere
Value format point, regional
Example /centromere_type=point
Comment the values are case-insensitive, i.e. both "POINT" and
"point" are valid;
Definitions of the values:
regional : the DNA sequence consists of large arrays of
repetitive DNA, where the sequence of individual repeat
elements is similar but not identical
point : consist of well defined and conserved DNA
sequences that are sufficient to confirm centromere
identity and function
Important Note: The necessity of a /centromere_type qualifier is still under
discussion. If it is determined that the type can *always* be inferred based
on the organism alone (eg, 'point' for S. cerevisiae and 5 other budding yeasts,
'regional' for all other eukaryotes) then /centromere_type will not be
implemented.
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Feature Key telomere
Definition region of biological interest identified as a telomere
and which have been experimentally characterized
Optional qualifiers /citation=[number]
/db_xref="<database>:<identifier>"
/experiment="[CATEGORY:]text"/note="text"
/inference="[CATEGORY:]TYPE[ (same species)][:EVIDENCE_BASIS]"
/note="text"
/rpt_unit_seq
/rpt_unit_range
/rpt_type
/standard_name="text"
Comment the telomere feature describes the interval of DNA
that corresponds to a specific structure at the end of
the linear eukaryotic chromosome which is required for
the integrity and maintenance of the end; this region
is unique compared to the rest of the chromosome and
represents the physical end of the chromosome;
1.3.3 New assembly_gap feature, and /gap_type and /linkage_evidence qualifiers
Complete genomes are often submitted to the INSDC via a small (or large)
set of independent sequence records, which can be assembled into chromosomes
and/or scaffolds. The CON-division records representing these scaffolds
and chromosomes are usually built using information provided in "AGP files"
provided by the submitter. See:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genome/assembly/agp/AGP_Update.shtml **
The AGP 2.0 specification includes provisions for a variety of different
gap types, as well as information about whether a gap between two
scaffold or chromosome components is an unspanned gap or a spanned gap.
There is also biological gap-types: telomere, centromere and repeat.
AGP 2.0 also supports terminology to describe the type of evidence used
to establish the linkage connecting the components on either side of a
spanned gap within a scaffold or chromosome. Unfortunately, there is no
mechanism to represent any of this information in the Feature Table.
To address this, the INSDC has decided to implement an assembly_gap
feature, and /gap_type and /linkage_evidence qualifiers, all of which
are now legal as of this October 15 2011 GenBank Release.
The new centromere and telomere features (see Section 1.3.2) should
only be used when the actual sequence of a centromere/telomere has been
determined. If this is not the case, then an assembly_gap feature with
a /gap_type of "centromere" or "telomere" should be used instead to
indicate the locations of centromeres and telomeres within a genome
assembly.
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Feature Key assembly_gap
Definition gap between two components of a CON-division record that
is part of a genome assembly
Mandatory qualifiers /estimated_length=unknown or <integer>
/gap_type="TYPE"
/linkage_evidence="TYPE" (Note: Mandatory only if the
/gap_type is "within scaffold" or "repeat within scaffold"
For all other types of assembly_gap features, use of the
/linkage_evidence qualifier is invalid.)
Comment the location span of the assembly_gap feature for an unknown
gap is 100 bp, with the 100 bp indicated as 100 "n"'s in the
sequence. Where estimated length is indicated by an integer,
this is indicated by the same number of "n"'s in the sequence.
No upper or lower limit is set on the size of the gap.
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Qualifier /gap_type=TYPE
Definition kind of gap connecting components in records of a genome
assembly, or the kind of biological gap in a record that
is part of a genome assembly
Value format "between scaffolds", "within scaffold", "telomere",
"centromere", "short arm", "heterochromatin",
"repeat within scaffold", "repeat between scaffolds"
Example /gap_type="between scaffolds"
/gap_type="within scaffold"
Comment This qualifier is used only for assembly_gap features and
its values are controlled by the AGP Specification version 2.0:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genome/assembly/agp/AGP_Update.shtml **
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Qualifier /linkage_evidence=TYPE
Definition type of evidence establishing linkage across an assembly_gap.
Only allowed to be used with assembly_gap features that have
a /gap_type value of "within scaffold" or "repeat within scaffold"
Value format "paired-ends", "align genus", "align xgenus", "align trnscpt",
"within clone", "clone contig", "map", "strobe", "unspecified"
Example /linkage_evidence="paired-ends"
/linkage_evidence="within clone"
Comment This qualifier is used only for assembly_gap features and its
values are controlled by the AGP Specification version 2.0
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genome/assembly/agp/AGP_Update.shtml **
** The current URL for the AGP 2.0 specification is temporary. When a permanent link
becomes available, the Feature Table will be updated accordingly.
Although these new features and qualifiers are allowed as of Oct 15 2011,
it is unlikely that they will begin to appear on sequence records before
December 1st. However, users should begin preparing for them now, to prevent
processing problems later.
1.3.4 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
info@ncbi.nlm.nih.gov
Our apologies for any inconvenience that these changes may cause.
1.3.5 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 186.0. Consider gbgss146.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
October 15 2011
NCBI-GenBank Flat File Release 186.0
GSS Sequences (Part 1)
87119 loci, 64001369 bases, from 87119 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "146" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
There are no changes scheduled for implementation in the February 2012
GenBank Release.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1684 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbbct1.seq - Bacterial sequence entries, part 1.
96. gbbct10.seq - Bacterial sequence entries, part 10.
97. gbbct11.seq - Bacterial sequence entries, part 11.
98. gbbct12.seq - Bacterial sequence entries, part 12.
99. gbbct13.seq - Bacterial sequence entries, part 13.
100. gbbct14.seq - Bacterial sequence entries, part 14.
101. gbbct15.seq - Bacterial sequence entries, part 15.
102. gbbct16.seq - Bacterial sequence entries, part 16.
103. gbbct17.seq - Bacterial sequence entries, part 17.
104. gbbct18.seq - Bacterial sequence entries, part 18.
105. gbbct19.seq - Bacterial sequence entries, part 19.
106. gbbct2.seq - Bacterial sequence entries, part 2.
107. gbbct20.seq - Bacterial sequence entries, part 20.
108. gbbct21.seq - Bacterial sequence entries, part 21.
109. gbbct22.seq - Bacterial sequence entries, part 22.
110. gbbct23.seq - Bacterial sequence entries, part 23.
111. gbbct24.seq - Bacterial sequence entries, part 24.
112. gbbct25.seq - Bacterial sequence entries, part 25.
113. gbbct26.seq - Bacterial sequence entries, part 26.
114. gbbct27.seq - Bacterial sequence entries, part 27.
115. gbbct28.seq - Bacterial sequence entries, part 28.
116. gbbct29.seq - Bacterial sequence entries, part 29.
117. gbbct3.seq - Bacterial sequence entries, part 3.
118. gbbct30.seq - Bacterial sequence entries, part 30.
119. gbbct31.seq - Bacterial sequence entries, part 31.
120. gbbct32.seq - Bacterial sequence entries, part 32.
121. gbbct33.seq - Bacterial sequence entries, part 33.
122. gbbct34.seq - Bacterial sequence entries, part 34.
123. gbbct35.seq - Bacterial sequence entries, part 35.
124. gbbct36.seq - Bacterial sequence entries, part 36.
125. gbbct37.seq - Bacterial sequence entries, part 37.
126. gbbct38.seq - Bacterial sequence entries, part 38.
127. gbbct39.seq - Bacterial sequence entries, part 39.
128. gbbct4.seq - Bacterial sequence entries, part 4.
129. gbbct40.seq - Bacterial sequence entries, part 40.
130. gbbct41.seq - Bacterial sequence entries, part 41.
131. gbbct42.seq - Bacterial sequence entries, part 42.
132. gbbct43.seq - Bacterial sequence entries, part 43.
133. gbbct44.seq - Bacterial sequence entries, part 44.
134. gbbct45.seq - Bacterial sequence entries, part 45.
135. gbbct46.seq - Bacterial sequence entries, part 46.
136. gbbct47.seq - Bacterial sequence entries, part 47.
137. gbbct48.seq - Bacterial sequence entries, part 48.
138. gbbct49.seq - Bacterial sequence entries, part 49.
139. gbbct5.seq - Bacterial sequence entries, part 5.
140. gbbct50.seq - Bacterial sequence entries, part 50.
141. gbbct51.seq - Bacterial sequence entries, part 51.
142. gbbct52.seq - Bacterial sequence entries, part 52.
143. gbbct53.seq - Bacterial sequence entries, part 53.
144. gbbct54.seq - Bacterial sequence entries, part 54.
145. gbbct55.seq - Bacterial sequence entries, part 55.
146. gbbct56.seq - Bacterial sequence entries, part 56.
147. gbbct57.seq - Bacterial sequence entries, part 57.
148. gbbct58.seq - Bacterial sequence entries, part 58.
149. gbbct59.seq - Bacterial sequence entries, part 59.
150. gbbct6.seq - Bacterial sequence entries, part 6.
151. gbbct60.seq - Bacterial sequence entries, part 60.
152. gbbct61.seq - Bacterial sequence entries, part 61.
153. gbbct62.seq - Bacterial sequence entries, part 62.
154. gbbct63.seq - Bacterial sequence entries, part 63.
155. gbbct64.seq - Bacterial sequence entries, part 64.
156. gbbct65.seq - Bacterial sequence entries, part 65.
157. gbbct66.seq - Bacterial sequence entries, part 66.
158. gbbct67.seq - Bacterial sequence entries, part 67.
159. gbbct68.seq - Bacterial sequence entries, part 68.
160. gbbct69.seq - Bacterial sequence entries, part 69.
161. gbbct7.seq - Bacterial sequence entries, part 7.
162. gbbct70.seq - Bacterial sequence entries, part 70.
163. gbbct71.seq - Bacterial sequence entries, part 71.
164. gbbct72.seq - Bacterial sequence entries, part 72.
165. gbbct73.seq - Bacterial sequence entries, part 73.
166. gbbct74.seq - Bacterial sequence entries, part 74.
167. gbbct75.seq - Bacterial sequence entries, part 75.
168. gbbct76.seq - Bacterial sequence entries, part 76.
169. gbbct77.seq - Bacterial sequence entries, part 77.
170. gbbct8.seq - Bacterial sequence entries, part 8.
171. gbbct9.seq - Bacterial sequence entries, part 9.
172. gbchg.txt - Accession numbers of entries updated since the previous release.
173. gbcon1.seq - Constructed sequence entries, part 1.
174. gbcon10.seq - Constructed sequence entries, part 10.
175. gbcon100.seq - Constructed sequence entries, part 100.
176. gbcon101.seq - Constructed sequence entries, part 101.
177. gbcon102.seq - Constructed sequence entries, part 102.
178. gbcon103.seq - Constructed sequence entries, part 103.
179. gbcon104.seq - Constructed sequence entries, part 104.
180. gbcon105.seq - Constructed sequence entries, part 105.
181. gbcon106.seq - Constructed sequence entries, part 106.
182. gbcon107.seq - Constructed sequence entries, part 107.
183. gbcon108.seq - Constructed sequence entries, part 108.
184. gbcon109.seq - Constructed sequence entries, part 109.
185. gbcon11.seq - Constructed sequence entries, part 11.
186. gbcon110.seq - Constructed sequence entries, part 110.
187. gbcon111.seq - Constructed sequence entries, part 111.
188. gbcon112.seq - Constructed sequence entries, part 112.
189. gbcon113.seq - Constructed sequence entries, part 113.
190. gbcon114.seq - Constructed sequence entries, part 114.
191. gbcon115.seq - Constructed sequence entries, part 115.
192. gbcon116.seq - Constructed sequence entries, part 116.
193. gbcon117.seq - Constructed sequence entries, part 117.
194. gbcon118.seq - Constructed sequence entries, part 118.
195. gbcon119.seq - Constructed sequence entries, part 119.
196. gbcon12.seq - Constructed sequence entries, part 12.
197. gbcon120.seq - Constructed sequence entries, part 120.
198. gbcon121.seq - Constructed sequence entries, part 121.
199. gbcon122.seq - Constructed sequence entries, part 122.
200. gbcon123.seq - Constructed sequence entries, part 123.
201. gbcon124.seq - Constructed sequence entries, part 124.
202. gbcon125.seq - Constructed sequence entries, part 125.
203. gbcon126.seq - Constructed sequence entries, part 126.
204. gbcon127.seq - Constructed sequence entries, part 127.
205. gbcon128.seq - Constructed sequence entries, part 128.
206. gbcon129.seq - Constructed sequence entries, part 129.
207. gbcon13.seq - Constructed sequence entries, part 13.
208. gbcon130.seq - Constructed sequence entries, part 130.
209. gbcon131.seq - Constructed sequence entries, part 131.
210. gbcon132.seq - Constructed sequence entries, part 132.
211. gbcon133.seq - Constructed sequence entries, part 133.
212. gbcon134.seq - Constructed sequence entries, part 134.
213. gbcon135.seq - Constructed sequence entries, part 135.
214. gbcon136.seq - Constructed sequence entries, part 136.
215. gbcon137.seq - Constructed sequence entries, part 137.
216. gbcon138.seq - Constructed sequence entries, part 138.
217. gbcon139.seq - Constructed sequence entries, part 139.
218. gbcon14.seq - Constructed sequence entries, part 14.
219. gbcon140.seq - Constructed sequence entries, part 140.
220. gbcon141.seq - Constructed sequence entries, part 141.
221. gbcon142.seq - Constructed sequence entries, part 142.
222. gbcon143.seq - Constructed sequence entries, part 143.
223. gbcon144.seq - Constructed sequence entries, part 144.
224. gbcon145.seq - Constructed sequence entries, part 145.
225. gbcon146.seq - Constructed sequence entries, part 146.
226. gbcon147.seq - Constructed sequence entries, part 147.
227. gbcon148.seq - Constructed sequence entries, part 148.
228. gbcon149.seq - Constructed sequence entries, part 149.
229. gbcon15.seq - Constructed sequence entries, part 15.
230. gbcon150.seq - Constructed sequence entries, part 150.
231. gbcon151.seq - Constructed sequence entries, part 151.
232. gbcon152.seq - Constructed sequence entries, part 152.
233. gbcon16.seq - Constructed sequence entries, part 16.
234. gbcon17.seq - Constructed sequence entries, part 17.
235. gbcon18.seq - Constructed sequence entries, part 18.
236. gbcon19.seq - Constructed sequence entries, part 19.
237. gbcon2.seq - Constructed sequence entries, part 2.
238. gbcon20.seq - Constructed sequence entries, part 20.
239. gbcon21.seq - Constructed sequence entries, part 21.
240. gbcon22.seq - Constructed sequence entries, part 22.
241. gbcon23.seq - Constructed sequence entries, part 23.
242. gbcon24.seq - Constructed sequence entries, part 24.
243. gbcon25.seq - Constructed sequence entries, part 25.
244. gbcon26.seq - Constructed sequence entries, part 26.
245. gbcon27.seq - Constructed sequence entries, part 27.
246. gbcon28.seq - Constructed sequence entries, part 28.
247. gbcon29.seq - Constructed sequence entries, part 29.
248. gbcon3.seq - Constructed sequence entries, part 3.
249. gbcon30.seq - Constructed sequence entries, part 30.
250. gbcon31.seq - Constructed sequence entries, part 31.
251. gbcon32.seq - Constructed sequence entries, part 32.
252. gbcon33.seq - Constructed sequence entries, part 33.
253. gbcon34.seq - Constructed sequence entries, part 34.
254. gbcon35.seq - Constructed sequence entries, part 35.
255. gbcon36.seq - Constructed sequence entries, part 36.
256. gbcon37.seq - Constructed sequence entries, part 37.
257. gbcon38.seq - Constructed sequence entries, part 38.
258. gbcon39.seq - Constructed sequence entries, part 39.
259. gbcon4.seq - Constructed sequence entries, part 4.
260. gbcon40.seq - Constructed sequence entries, part 40.
261. gbcon41.seq - Constructed sequence entries, part 41.
262. gbcon42.seq - Constructed sequence entries, part 42.
263. gbcon43.seq - Constructed sequence entries, part 43.
264. gbcon44.seq - Constructed sequence entries, part 44.
265. gbcon45.seq - Constructed sequence entries, part 45.
266. gbcon46.seq - Constructed sequence entries, part 46.
267. gbcon47.seq - Constructed sequence entries, part 47.
268. gbcon48.seq - Constructed sequence entries, part 48.
269. gbcon49.seq - Constructed sequence entries, part 49.
270. gbcon5.seq - Constructed sequence entries, part 5.
271. gbcon50.seq - Constructed sequence entries, part 50.
272. gbcon51.seq - Constructed sequence entries, part 51.
273. gbcon52.seq - Constructed sequence entries, part 52.
274. gbcon53.seq - Constructed sequence entries, part 53.
275. gbcon54.seq - Constructed sequence entries, part 54.
276. gbcon55.seq - Constructed sequence entries, part 55.
277. gbcon56.seq - Constructed sequence entries, part 56.
278. gbcon57.seq - Constructed sequence entries, part 57.
279. gbcon58.seq - Constructed sequence entries, part 58.
280. gbcon59.seq - Constructed sequence entries, part 59.
281. gbcon6.seq - Constructed sequence entries, part 6.
282. gbcon60.seq - Constructed sequence entries, part 60.
283. gbcon61.seq - Constructed sequence entries, part 61.
284. gbcon62.seq - Constructed sequence entries, part 62.
285. gbcon63.seq - Constructed sequence entries, part 63.
286. gbcon64.seq - Constructed sequence entries, part 64.
287. gbcon65.seq - Constructed sequence entries, part 65.
288. gbcon66.seq - Constructed sequence entries, part 66.
289. gbcon67.seq - Constructed sequence entries, part 67.
290. gbcon68.seq - Constructed sequence entries, part 68.
291. gbcon69.seq - Constructed sequence entries, part 69.
292. gbcon7.seq - Constructed sequence entries, part 7.
293. gbcon70.seq - Constructed sequence entries, part 70.
294. gbcon71.seq - Constructed sequence entries, part 71.
295. gbcon72.seq - Constructed sequence entries, part 72.
296. gbcon73.seq - Constructed sequence entries, part 73.
297. gbcon74.seq - Constructed sequence entries, part 74.
298. gbcon75.seq - Constructed sequence entries, part 75.
299. gbcon76.seq - Constructed sequence entries, part 76.
300. gbcon77.seq - Constructed sequence entries, part 77.
301. gbcon78.seq - Constructed sequence entries, part 78.
302. gbcon79.seq - Constructed sequence entries, part 79.
303. gbcon8.seq - Constructed sequence entries, part 8.
304. gbcon80.seq - Constructed sequence entries, part 80.
305. gbcon81.seq - Constructed sequence entries, part 81.
306. gbcon82.seq - Constructed sequence entries, part 82.
307. gbcon83.seq - Constructed sequence entries, part 83.
308. gbcon84.seq - Constructed sequence entries, part 84.
309. gbcon85.seq - Constructed sequence entries, part 85.
310. gbcon86.seq - Constructed sequence entries, part 86.
311. gbcon87.seq - Constructed sequence entries, part 87.
312. gbcon88.seq - Constructed sequence entries, part 88.
313. gbcon89.seq - Constructed sequence entries, part 89.
314. gbcon9.seq - Constructed sequence entries, part 9.
315. gbcon90.seq - Constructed sequence entries, part 90.
316. gbcon91.seq - Constructed sequence entries, part 91.
317. gbcon92.seq - Constructed sequence entries, part 92.
318. gbcon93.seq - Constructed sequence entries, part 93.
319. gbcon94.seq - Constructed sequence entries, part 94.
320. gbcon95.seq - Constructed sequence entries, part 95.
321. gbcon96.seq - Constructed sequence entries, part 96.
322. gbcon97.seq - Constructed sequence entries, part 97.
323. gbcon98.seq - Constructed sequence entries, part 98.
324. gbcon99.seq - Constructed sequence entries, part 99.
325. gbdel.txt - Accession numbers of entries deleted since the previous release.
326. gbenv1.seq - Environmental sampling sequence entries, part 1.
327. gbenv10.seq - Environmental sampling sequence entries, part 10.
328. gbenv11.seq - Environmental sampling sequence entries, part 11.
329. gbenv12.seq - Environmental sampling sequence entries, part 12.
330. gbenv13.seq - Environmental sampling sequence entries, part 13.
331. gbenv14.seq - Environmental sampling sequence entries, part 14.
332. gbenv15.seq - Environmental sampling sequence entries, part 15.
333. gbenv16.seq - Environmental sampling sequence entries, part 16.
334. gbenv17.seq - Environmental sampling sequence entries, part 17.
335. gbenv18.seq - Environmental sampling sequence entries, part 18.
336. gbenv19.seq - Environmental sampling sequence entries, part 19.
337. gbenv2.seq - Environmental sampling sequence entries, part 2.
338. gbenv20.seq - Environmental sampling sequence entries, part 20.
339. gbenv21.seq - Environmental sampling sequence entries, part 21.
340. gbenv22.seq - Environmental sampling sequence entries, part 22.
341. gbenv23.seq - Environmental sampling sequence entries, part 23.
342. gbenv24.seq - Environmental sampling sequence entries, part 24.
343. gbenv25.seq - Environmental sampling sequence entries, part 25.
344. gbenv26.seq - Environmental sampling sequence entries, part 26.
345. gbenv27.seq - Environmental sampling sequence entries, part 27.
346. gbenv28.seq - Environmental sampling sequence entries, part 28.
347. gbenv29.seq - Environmental sampling sequence entries, part 29.
348. gbenv3.seq - Environmental sampling sequence entries, part 3.
349. gbenv30.seq - Environmental sampling sequence entries, part 30.
350. gbenv31.seq - Environmental sampling sequence entries, part 31.
351. gbenv32.seq - Environmental sampling sequence entries, part 32.
352. gbenv33.seq - Environmental sampling sequence entries, part 33.
353. gbenv34.seq - Environmental sampling sequence entries, part 34.
354. gbenv35.seq - Environmental sampling sequence entries, part 35.
355. gbenv36.seq - Environmental sampling sequence entries, part 36.
356. gbenv37.seq - Environmental sampling sequence entries, part 37.
357. gbenv38.seq - Environmental sampling sequence entries, part 38.
358. gbenv39.seq - Environmental sampling sequence entries, part 39.
359. gbenv4.seq - Environmental sampling sequence entries, part 4.
360. gbenv40.seq - Environmental sampling sequence entries, part 40.
361. gbenv41.seq - Environmental sampling sequence entries, part 41.
362. gbenv42.seq - Environmental sampling sequence entries, part 42.
363. gbenv43.seq - Environmental sampling sequence entries, part 43.
364. gbenv5.seq - Environmental sampling sequence entries, part 5.
365. gbenv6.seq - Environmental sampling sequence entries, part 6.
366. gbenv7.seq - Environmental sampling sequence entries, part 7.
367. gbenv8.seq - Environmental sampling sequence entries, part 8.
368. gbenv9.seq - Environmental sampling sequence entries, part 9.
369. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
370. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
371. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
372. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
373. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
374. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
375. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
376. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
377. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
378. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
379. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
380. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
381. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
382. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
383. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
384. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
385. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
386. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
387. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
388. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
389. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
390. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
391. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
392. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
393. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
394. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
395. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
396. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
397. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
398. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
399. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
400. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
401. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
402. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
403. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
404. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
405. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
406. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
407. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
408. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
409. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
410. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
411. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
412. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
413. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
414. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
415. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
416. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
417. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
418. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
419. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
420. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
421. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
422. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
423. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
424. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
425. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
426. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
427. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
428. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
429. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
430. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
431. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
432. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
433. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
434. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
435. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
436. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
437. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
438. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
439. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
440. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
441. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
442. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
443. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
444. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
445. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
446. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
447. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
448. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
449. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
450. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
451. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
452. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
453. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
454. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
455. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
456. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
457. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
458. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
459. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
460. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
461. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
462. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
463. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
464. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
465. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
466. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
467. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
468. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
469. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
470. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
471. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
472. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
473. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
474. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
475. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
476. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
477. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
478. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
479. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
480. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
481. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
482. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
483. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
484. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
485. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
486. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
487. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
488. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
489. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
490. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
491. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
492. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
493. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
494. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
495. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
496. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
497. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
498. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
499. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
500. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
501. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
502. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
503. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
504. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
505. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
506. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
507. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
508. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
509. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
510. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
511. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
512. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
513. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
514. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
515. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
516. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
517. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
518. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
519. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
520. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
521. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
522. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
523. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
524. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
525. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
526. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
527. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
528. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
529. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
530. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
531. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
532. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
533. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
534. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
535. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
536. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
537. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
538. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
539. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
540. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
541. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
542. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
543. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
544. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
545. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
546. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
547. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
548. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
549. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
550. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
551. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
552. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
553. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
554. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
555. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
556. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
557. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
558. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
559. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
560. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
561. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
562. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
563. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
564. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
565. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
566. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
567. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
568. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
569. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
570. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
571. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
572. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
573. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
574. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
575. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
576. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
577. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
578. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
579. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
580. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
581. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
582. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
583. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
584. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
585. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
586. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
587. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
588. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
589. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
590. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
591. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
592. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
593. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
594. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
595. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
596. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
597. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
598. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
599. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
600. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
601. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
602. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
603. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
604. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
605. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
606. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
607. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
608. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
609. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
610. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
611. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
612. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
613. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
614. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
615. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
616. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
617. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
618. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
619. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
620. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
621. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
622. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
623. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
624. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
625. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
626. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
627. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
628. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
629. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
630. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
631. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
632. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
633. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
634. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
635. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
636. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
637. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
638. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
639. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
640. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
641. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
642. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
643. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
644. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
645. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
646. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
647. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
648. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
649. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
650. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
651. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
652. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
653. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
654. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
655. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
656. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
657. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
658. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
659. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
660. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
661. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
662. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
663. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
664. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
665. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
666. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
667. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
668. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
669. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
670. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
671. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
672. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
673. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
674. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
675. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
676. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
677. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
678. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
679. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
680. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
681. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
682. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
683. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
684. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
685. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
686. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
687. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
688. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
689. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
690. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
691. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
692. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
693. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
694. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
695. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
696. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
697. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
698. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
699. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
700. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
701. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
702. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
703. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
704. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
705. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
706. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
707. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
708. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
709. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
710. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
711. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
712. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
713. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
714. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
715. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
716. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
717. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
718. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
719. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
720. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
721. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
722. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
723. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
724. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
725. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
726. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
727. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
728. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
729. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
730. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
731. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
732. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
733. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
734. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
735. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
736. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
737. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
738. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
739. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
740. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
741. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
742. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
743. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
744. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
745. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
746. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
747. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
748. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
749. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
750. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
751. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
752. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
753. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
754. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
755. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
756. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
757. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
758. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
759. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
760. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
761. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
762. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
763. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
764. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
765. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
766. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
767. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
768. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
769. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
770. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
771. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
772. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
773. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
774. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
775. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
776. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
777. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
778. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
779. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
780. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
781. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
782. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
783. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
784. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
785. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
786. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
787. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
788. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
789. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
790. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
791. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
792. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
793. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
794. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
795. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
796. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
797. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
798. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
799. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
800. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
801. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
802. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
803. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
804. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
805. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
806. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
807. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
808. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
809. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
810. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
811. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
812. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
813. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
814. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
815. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
816. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
817. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
818. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
819. gbgen.idx - Index of the entries according to gene symbols.
820. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
821. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
822. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
823. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
824. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
825. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
826. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
827. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
828. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
829. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
830. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
831. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
832. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
833. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
834. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
835. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
836. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
837. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
838. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
839. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
840. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
841. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
842. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
843. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
844. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
845. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
846. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
847. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
848. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
849. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
850. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
851. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
852. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
853. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
854. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
855. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
856. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
857. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
858. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
859. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
860. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
861. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
862. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
863. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
864. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
865. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
866. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
867. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
868. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
869. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
870. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
871. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
872. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
873. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
874. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
875. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
876. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
877. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
878. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
879. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
880. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
881. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
882. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
883. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
884. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
885. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
886. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
887. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
888. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
889. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
890. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
891. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
892. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
893. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
894. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
895. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
896. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
897. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
898. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
899. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
900. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
901. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
902. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
903. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
904. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
905. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
906. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
907. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
908. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
909. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
910. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
911. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
912. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
913. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
914. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
915. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
916. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
917. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
918. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
919. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
920. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
921. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
922. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
923. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
924. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
925. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
926. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
927. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
928. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
929. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
930. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
931. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
932. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
933. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
934. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
935. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
936. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
937. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
938. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
939. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
940. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
941. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
942. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
943. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
944. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
945. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
946. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
947. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
948. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
949. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
950. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
951. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
952. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
953. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
954. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
955. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
956. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
957. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
958. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
959. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
960. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
961. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
962. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
963. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
964. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
965. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
966. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
967. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
968. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
969. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
970. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
971. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
972. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
973. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
974. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
975. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
976. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
977. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
978. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
979. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
980. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
981. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
982. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
983. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
984. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
985. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
986. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
987. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
988. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
989. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
990. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
991. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
992. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
993. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
994. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
995. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
996. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
997. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
998. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
999. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1000. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1001. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1002. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1003. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1004. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1005. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1006. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1007. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1008. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1009. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1010. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1011. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1012. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1013. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1014. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1015. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1016. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1017. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1018. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1019. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1020. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1021. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1022. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1023. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1024. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1025. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1026. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1027. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1028. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1029. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1030. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1031. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1032. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1033. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1034. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1035. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1036. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1037. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1038. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1039. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1040. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1041. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1042. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1043. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1044. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1045. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1046. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1047. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1048. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1049. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1050. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1051. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1052. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1053. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1054. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1055. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1056. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1057. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1058. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1059. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1060. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1061. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1062. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1063. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1064. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1065. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1066. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1067. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1068. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1069. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1070. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1071. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1072. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1073. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1074. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1075. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1076. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1077. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1078. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1079. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1080. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1081. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1082. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1083. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1084. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1085. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1086. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1087. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1088. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1089. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1090. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1091. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1092. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1093. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1094. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1095. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1096. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1097. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1098. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1099. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1100. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1101. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1102. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1103. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1104. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1105. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1106. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1107. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1108. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1109. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1110. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1111. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1112. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1113. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1114. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1115. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1116. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1117. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1118. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1119. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1120. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1121. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1122. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1123. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1124. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1125. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1126. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1127. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1128. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1129. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1130. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1131. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1132. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1133. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1134. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1135. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1136. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1137. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1138. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1139. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1140. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1141. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1142. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1143. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1144. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1145. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1146. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1147. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1148. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1149. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1150. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1151. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1152. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1153. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1154. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1155. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1156. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1157. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1158. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1159. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1160. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1161. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1162. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1163. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1164. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1165. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1166. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1167. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1168. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1169. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1170. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1171. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1172. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1173. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1174. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1175. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1176. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1177. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1178. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1179. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1180. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1181. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1182. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1183. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1184. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1185. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1186. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1187. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1188. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1189. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1190. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1191. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1192. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1193. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1194. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1195. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1196. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1197. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1198. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1199. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1200. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1201. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1202. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1203. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1204. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1205. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1206. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1207. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1208. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1209. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1210. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1211. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1212. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1213. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1214. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1215. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1216. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1217. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1218. gbinv1.seq - Invertebrate sequence entries, part 1.
1219. gbinv10.seq - Invertebrate sequence entries, part 10.
1220. gbinv11.seq - Invertebrate sequence entries, part 11.
1221. gbinv12.seq - Invertebrate sequence entries, part 12.
1222. gbinv13.seq - Invertebrate sequence entries, part 13.
1223. gbinv14.seq - Invertebrate sequence entries, part 14.
1224. gbinv15.seq - Invertebrate sequence entries, part 15.
1225. gbinv16.seq - Invertebrate sequence entries, part 16.
1226. gbinv17.seq - Invertebrate sequence entries, part 17.
1227. gbinv18.seq - Invertebrate sequence entries, part 18.
1228. gbinv19.seq - Invertebrate sequence entries, part 19.
1229. gbinv2.seq - Invertebrate sequence entries, part 2.
1230. gbinv20.seq - Invertebrate sequence entries, part 20.
1231. gbinv21.seq - Invertebrate sequence entries, part 21.
1232. gbinv22.seq - Invertebrate sequence entries, part 22.
1233. gbinv23.seq - Invertebrate sequence entries, part 23.
1234. gbinv24.seq - Invertebrate sequence entries, part 24.
1235. gbinv25.seq - Invertebrate sequence entries, part 25.
1236. gbinv26.seq - Invertebrate sequence entries, part 26.
1237. gbinv27.seq - Invertebrate sequence entries, part 27.
1238. gbinv28.seq - Invertebrate sequence entries, part 28.
1239. gbinv29.seq - Invertebrate sequence entries, part 29.
1240. gbinv3.seq - Invertebrate sequence entries, part 3.
1241. gbinv30.seq - Invertebrate sequence entries, part 30.
1242. gbinv4.seq - Invertebrate sequence entries, part 4.
1243. gbinv5.seq - Invertebrate sequence entries, part 5.
1244. gbinv6.seq - Invertebrate sequence entries, part 6.
1245. gbinv7.seq - Invertebrate sequence entries, part 7.
1246. gbinv8.seq - Invertebrate sequence entries, part 8.
1247. gbinv9.seq - Invertebrate sequence entries, part 9.
1248. gbjou1.idx - Index of the entries according to journal citation, part 1.
1249. gbjou10.idx - Index of the entries according to journal citation, part 10.
1250. gbjou11.idx - Index of the entries according to journal citation, part 11.
1251. gbjou12.idx - Index of the entries according to journal citation, part 12.
1252. gbjou2.idx - Index of the entries according to journal citation, part 2.
1253. gbjou3.idx - Index of the entries according to journal citation, part 3.
1254. gbjou4.idx - Index of the entries according to journal citation, part 4.
1255. gbjou5.idx - Index of the entries according to journal citation, part 5.
1256. gbjou6.idx - Index of the entries according to journal citation, part 6.
1257. gbjou7.idx - Index of the entries according to journal citation, part 7.
1258. gbjou8.idx - Index of the entries according to journal citation, part 8.
1259. gbjou9.idx - Index of the entries according to journal citation, part 9.
1260. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1261. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1262. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1263. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1264. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1265. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1266. gbmam1.seq - Other mammalian sequence entries, part 1.
1267. gbmam2.seq - Other mammalian sequence entries, part 2.
1268. gbmam3.seq - Other mammalian sequence entries, part 3.
1269. gbmam4.seq - Other mammalian sequence entries, part 4.
1270. gbmam5.seq - Other mammalian sequence entries, part 5.
1271. gbmam6.seq - Other mammalian sequence entries, part 6.
1272. gbmam7.seq - Other mammalian sequence entries, part 7.
1273. gbnew.txt - Accession numbers of entries new since the previous release.
1274. gbpat1.seq - Patent sequence entries, part 1.
1275. gbpat10.seq - Patent sequence entries, part 10.
1276. gbpat100.seq - Patent sequence entries, part 100.
1277. gbpat101.seq - Patent sequence entries, part 101.
1278. gbpat102.seq - Patent sequence entries, part 102.
1279. gbpat103.seq - Patent sequence entries, part 103.
1280. gbpat104.seq - Patent sequence entries, part 104.
1281. gbpat105.seq - Patent sequence entries, part 105.
1282. gbpat106.seq - Patent sequence entries, part 106.
1283. gbpat107.seq - Patent sequence entries, part 107.
1284. gbpat108.seq - Patent sequence entries, part 108.
1285. gbpat109.seq - Patent sequence entries, part 109.
1286. gbpat11.seq - Patent sequence entries, part 11.
1287. gbpat110.seq - Patent sequence entries, part 110.
1288. gbpat111.seq - Patent sequence entries, part 111.
1289. gbpat112.seq - Patent sequence entries, part 112.
1290. gbpat113.seq - Patent sequence entries, part 113.
1291. gbpat114.seq - Patent sequence entries, part 114.
1292. gbpat115.seq - Patent sequence entries, part 115.
1293. gbpat116.seq - Patent sequence entries, part 116.
1294. gbpat117.seq - Patent sequence entries, part 117.
1295. gbpat118.seq - Patent sequence entries, part 118.
1296. gbpat119.seq - Patent sequence entries, part 119.
1297. gbpat12.seq - Patent sequence entries, part 12.
1298. gbpat120.seq - Patent sequence entries, part 120.
1299. gbpat121.seq - Patent sequence entries, part 121.
1300. gbpat122.seq - Patent sequence entries, part 122.
1301. gbpat123.seq - Patent sequence entries, part 123.
1302. gbpat124.seq - Patent sequence entries, part 124.
1303. gbpat125.seq - Patent sequence entries, part 125.
1304. gbpat126.seq - Patent sequence entries, part 126.
1305. gbpat127.seq - Patent sequence entries, part 127.
1306. gbpat128.seq - Patent sequence entries, part 128.
1307. gbpat129.seq - Patent sequence entries, part 129.
1308. gbpat13.seq - Patent sequence entries, part 13.
1309. gbpat130.seq - Patent sequence entries, part 130.
1310. gbpat131.seq - Patent sequence entries, part 131.
1311. gbpat132.seq - Patent sequence entries, part 132.
1312. gbpat133.seq - Patent sequence entries, part 133.
1313. gbpat134.seq - Patent sequence entries, part 134.
1314. gbpat135.seq - Patent sequence entries, part 135.
1315. gbpat136.seq - Patent sequence entries, part 136.
1316. gbpat137.seq - Patent sequence entries, part 137.
1317. gbpat138.seq - Patent sequence entries, part 138.
1318. gbpat139.seq - Patent sequence entries, part 139.
1319. gbpat14.seq - Patent sequence entries, part 14.
1320. gbpat140.seq - Patent sequence entries, part 140.
1321. gbpat141.seq - Patent sequence entries, part 141.
1322. gbpat142.seq - Patent sequence entries, part 142.
1323. gbpat143.seq - Patent sequence entries, part 143.
1324. gbpat144.seq - Patent sequence entries, part 144.
1325. gbpat145.seq - Patent sequence entries, part 145.
1326. gbpat146.seq - Patent sequence entries, part 146.
1327. gbpat147.seq - Patent sequence entries, part 147.
1328. gbpat148.seq - Patent sequence entries, part 148.
1329. gbpat149.seq - Patent sequence entries, part 149.
1330. gbpat15.seq - Patent sequence entries, part 15.
1331. gbpat150.seq - Patent sequence entries, part 150.
1332. gbpat151.seq - Patent sequence entries, part 151.
1333. gbpat152.seq - Patent sequence entries, part 152.
1334. gbpat153.seq - Patent sequence entries, part 153.
1335. gbpat154.seq - Patent sequence entries, part 154.
1336. gbpat155.seq - Patent sequence entries, part 155.
1337. gbpat156.seq - Patent sequence entries, part 156.
1338. gbpat157.seq - Patent sequence entries, part 157.
1339. gbpat158.seq - Patent sequence entries, part 158.
1340. gbpat159.seq - Patent sequence entries, part 159.
1341. gbpat16.seq - Patent sequence entries, part 16.
1342. gbpat160.seq - Patent sequence entries, part 160.
1343. gbpat161.seq - Patent sequence entries, part 161.
1344. gbpat162.seq - Patent sequence entries, part 162.
1345. gbpat163.seq - Patent sequence entries, part 163.
1346. gbpat164.seq - Patent sequence entries, part 164.
1347. gbpat165.seq - Patent sequence entries, part 165.
1348. gbpat166.seq - Patent sequence entries, part 166.
1349. gbpat167.seq - Patent sequence entries, part 167.
1350. gbpat168.seq - Patent sequence entries, part 168.
1351. gbpat169.seq - Patent sequence entries, part 169.
1352. gbpat17.seq - Patent sequence entries, part 17.
1353. gbpat170.seq - Patent sequence entries, part 170.
1354. gbpat171.seq - Patent sequence entries, part 171.
1355. gbpat18.seq - Patent sequence entries, part 18.
1356. gbpat19.seq - Patent sequence entries, part 19.
1357. gbpat2.seq - Patent sequence entries, part 2.
1358. gbpat20.seq - Patent sequence entries, part 20.
1359. gbpat21.seq - Patent sequence entries, part 21.
1360. gbpat22.seq - Patent sequence entries, part 22.
1361. gbpat23.seq - Patent sequence entries, part 23.
1362. gbpat24.seq - Patent sequence entries, part 24.
1363. gbpat25.seq - Patent sequence entries, part 25.
1364. gbpat26.seq - Patent sequence entries, part 26.
1365. gbpat27.seq - Patent sequence entries, part 27.
1366. gbpat28.seq - Patent sequence entries, part 28.
1367. gbpat29.seq - Patent sequence entries, part 29.
1368. gbpat3.seq - Patent sequence entries, part 3.
1369. gbpat30.seq - Patent sequence entries, part 30.
1370. gbpat31.seq - Patent sequence entries, part 31.
1371. gbpat32.seq - Patent sequence entries, part 32.
1372. gbpat33.seq - Patent sequence entries, part 33.
1373. gbpat34.seq - Patent sequence entries, part 34.
1374. gbpat35.seq - Patent sequence entries, part 35.
1375. gbpat36.seq - Patent sequence entries, part 36.
1376. gbpat37.seq - Patent sequence entries, part 37.
1377. gbpat38.seq - Patent sequence entries, part 38.
1378. gbpat39.seq - Patent sequence entries, part 39.
1379. gbpat4.seq - Patent sequence entries, part 4.
1380. gbpat40.seq - Patent sequence entries, part 40.
1381. gbpat41.seq - Patent sequence entries, part 41.
1382. gbpat42.seq - Patent sequence entries, part 42.
1383. gbpat43.seq - Patent sequence entries, part 43.
1384. gbpat44.seq - Patent sequence entries, part 44.
1385. gbpat45.seq - Patent sequence entries, part 45.
1386. gbpat46.seq - Patent sequence entries, part 46.
1387. gbpat47.seq - Patent sequence entries, part 47.
1388. gbpat48.seq - Patent sequence entries, part 48.
1389. gbpat49.seq - Patent sequence entries, part 49.
1390. gbpat5.seq - Patent sequence entries, part 5.
1391. gbpat50.seq - Patent sequence entries, part 50.
1392. gbpat51.seq - Patent sequence entries, part 51.
1393. gbpat52.seq - Patent sequence entries, part 52.
1394. gbpat53.seq - Patent sequence entries, part 53.
1395. gbpat54.seq - Patent sequence entries, part 54.
1396. gbpat55.seq - Patent sequence entries, part 55.
1397. gbpat56.seq - Patent sequence entries, part 56.
1398. gbpat57.seq - Patent sequence entries, part 57.
1399. gbpat58.seq - Patent sequence entries, part 58.
1400. gbpat59.seq - Patent sequence entries, part 59.
1401. gbpat6.seq - Patent sequence entries, part 6.
1402. gbpat60.seq - Patent sequence entries, part 60.
1403. gbpat61.seq - Patent sequence entries, part 61.
1404. gbpat62.seq - Patent sequence entries, part 62.
1405. gbpat63.seq - Patent sequence entries, part 63.
1406. gbpat64.seq - Patent sequence entries, part 64.
1407. gbpat65.seq - Patent sequence entries, part 65.
1408. gbpat66.seq - Patent sequence entries, part 66.
1409. gbpat67.seq - Patent sequence entries, part 67.
1410. gbpat68.seq - Patent sequence entries, part 68.
1411. gbpat69.seq - Patent sequence entries, part 69.
1412. gbpat7.seq - Patent sequence entries, part 7.
1413. gbpat70.seq - Patent sequence entries, part 70.
1414. gbpat71.seq - Patent sequence entries, part 71.
1415. gbpat72.seq - Patent sequence entries, part 72.
1416. gbpat73.seq - Patent sequence entries, part 73.
1417. gbpat74.seq - Patent sequence entries, part 74.
1418. gbpat75.seq - Patent sequence entries, part 75.
1419. gbpat76.seq - Patent sequence entries, part 76.
1420. gbpat77.seq - Patent sequence entries, part 77.
1421. gbpat78.seq - Patent sequence entries, part 78.
1422. gbpat79.seq - Patent sequence entries, part 79.
1423. gbpat8.seq - Patent sequence entries, part 8.
1424. gbpat80.seq - Patent sequence entries, part 80.
1425. gbpat81.seq - Patent sequence entries, part 81.
1426. gbpat82.seq - Patent sequence entries, part 82.
1427. gbpat83.seq - Patent sequence entries, part 83.
1428. gbpat84.seq - Patent sequence entries, part 84.
1429. gbpat85.seq - Patent sequence entries, part 85.
1430. gbpat86.seq - Patent sequence entries, part 86.
1431. gbpat87.seq - Patent sequence entries, part 87.
1432. gbpat88.seq - Patent sequence entries, part 88.
1433. gbpat89.seq - Patent sequence entries, part 89.
1434. gbpat9.seq - Patent sequence entries, part 9.
1435. gbpat90.seq - Patent sequence entries, part 90.
1436. gbpat91.seq - Patent sequence entries, part 91.
1437. gbpat92.seq - Patent sequence entries, part 92.
1438. gbpat93.seq - Patent sequence entries, part 93.
1439. gbpat94.seq - Patent sequence entries, part 94.
1440. gbpat95.seq - Patent sequence entries, part 95.
1441. gbpat96.seq - Patent sequence entries, part 96.
1442. gbpat97.seq - Patent sequence entries, part 97.
1443. gbpat98.seq - Patent sequence entries, part 98.
1444. gbpat99.seq - Patent sequence entries, part 99.
1445. gbphg1.seq - Phage sequence entries, part 1.
1446. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1447. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1448. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1449. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1450. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1451. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1452. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1453. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1454. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1455. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1456. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1457. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1458. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1459. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1460. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1461. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1462. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1463. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1464. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1465. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1466. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1467. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1468. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1469. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1470. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1471. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1472. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1473. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1474. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1475. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1476. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1477. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1478. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1479. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1480. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1481. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1482. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1483. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1484. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1485. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1486. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1487. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1488. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1489. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1490. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1491. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1492. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1493. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1494. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1495. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1496. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1497. gbpri1.seq - Primate sequence entries, part 1.
1498. gbpri10.seq - Primate sequence entries, part 10.
1499. gbpri11.seq - Primate sequence entries, part 11.
1500. gbpri12.seq - Primate sequence entries, part 12.
1501. gbpri13.seq - Primate sequence entries, part 13.
1502. gbpri14.seq - Primate sequence entries, part 14.
1503. gbpri15.seq - Primate sequence entries, part 15.
1504. gbpri16.seq - Primate sequence entries, part 16.
1505. gbpri17.seq - Primate sequence entries, part 17.
1506. gbpri18.seq - Primate sequence entries, part 18.
1507. gbpri19.seq - Primate sequence entries, part 19.
1508. gbpri2.seq - Primate sequence entries, part 2.
1509. gbpri20.seq - Primate sequence entries, part 20.
1510. gbpri21.seq - Primate sequence entries, part 21.
1511. gbpri22.seq - Primate sequence entries, part 22.
1512. gbpri23.seq - Primate sequence entries, part 23.
1513. gbpri24.seq - Primate sequence entries, part 24.
1514. gbpri25.seq - Primate sequence entries, part 25.
1515. gbpri26.seq - Primate sequence entries, part 26.
1516. gbpri27.seq - Primate sequence entries, part 27.
1517. gbpri28.seq - Primate sequence entries, part 28.
1518. gbpri29.seq - Primate sequence entries, part 29.
1519. gbpri3.seq - Primate sequence entries, part 3.
1520. gbpri30.seq - Primate sequence entries, part 30.
1521. gbpri31.seq - Primate sequence entries, part 31.
1522. gbpri32.seq - Primate sequence entries, part 32.
1523. gbpri33.seq - Primate sequence entries, part 33.
1524. gbpri34.seq - Primate sequence entries, part 34.
1525. gbpri35.seq - Primate sequence entries, part 35.
1526. gbpri36.seq - Primate sequence entries, part 36.
1527. gbpri37.seq - Primate sequence entries, part 37.
1528. gbpri38.seq - Primate sequence entries, part 38.
1529. gbpri39.seq - Primate sequence entries, part 39.
1530. gbpri4.seq - Primate sequence entries, part 4.
1531. gbpri40.seq - Primate sequence entries, part 40.
1532. gbpri41.seq - Primate sequence entries, part 41.
1533. gbpri42.seq - Primate sequence entries, part 42.
1534. gbpri43.seq - Primate sequence entries, part 43.
1535. gbpri44.seq - Primate sequence entries, part 44.
1536. gbpri5.seq - Primate sequence entries, part 5.
1537. gbpri6.seq - Primate sequence entries, part 6.
1538. gbpri7.seq - Primate sequence entries, part 7.
1539. gbpri8.seq - Primate sequence entries, part 8.
1540. gbpri9.seq - Primate sequence entries, part 9.
1541. gbrel.txt - Release notes (this document).
1542. gbrod1.seq - Rodent sequence entries, part 1.
1543. gbrod10.seq - Rodent sequence entries, part 10.
1544. gbrod11.seq - Rodent sequence entries, part 11.
1545. gbrod12.seq - Rodent sequence entries, part 12.
1546. gbrod13.seq - Rodent sequence entries, part 13.
1547. gbrod14.seq - Rodent sequence entries, part 14.
1548. gbrod15.seq - Rodent sequence entries, part 15.
1549. gbrod16.seq - Rodent sequence entries, part 16.
1550. gbrod17.seq - Rodent sequence entries, part 17.
1551. gbrod18.seq - Rodent sequence entries, part 18.
1552. gbrod19.seq - Rodent sequence entries, part 19.
1553. gbrod2.seq - Rodent sequence entries, part 2.
1554. gbrod20.seq - Rodent sequence entries, part 20.
1555. gbrod21.seq - Rodent sequence entries, part 21.
1556. gbrod22.seq - Rodent sequence entries, part 22.
1557. gbrod23.seq - Rodent sequence entries, part 23.
1558. gbrod24.seq - Rodent sequence entries, part 24.
1559. gbrod25.seq - Rodent sequence entries, part 25.
1560. gbrod26.seq - Rodent sequence entries, part 26.
1561. gbrod27.seq - Rodent sequence entries, part 27.
1562. gbrod28.seq - Rodent sequence entries, part 28.
1563. gbrod29.seq - Rodent sequence entries, part 29.
1564. gbrod3.seq - Rodent sequence entries, part 3.
1565. gbrod4.seq - Rodent sequence entries, part 4.
1566. gbrod5.seq - Rodent sequence entries, part 5.
1567. gbrod6.seq - Rodent sequence entries, part 6.
1568. gbrod7.seq - Rodent sequence entries, part 7.
1569. gbrod8.seq - Rodent sequence entries, part 8.
1570. gbrod9.seq - Rodent sequence entries, part 9.
1571. gbsdr1.txt - Short directory of the data bank, part 1.
1572. gbsdr2.txt - Short directory of the data bank, part 2.
1573. gbsdr3.txt - Short directory of the data bank, part 3.
1574. gbsec.idx - Index of the entries according to secondary accession number.
1575. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1576. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1577. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1578. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1579. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1580. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1581. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1582. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1583. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1584. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1585. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1586. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1587. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1588. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1589. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1590. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1591. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1592. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1593. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1594. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1595. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1596. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1597. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1598. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1599. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1600. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1601. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1602. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1603. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1604. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1605. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1606. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1607. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1608. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1609. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1610. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1611. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1612. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1613. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1614. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1615. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1616. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1617. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1618. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1619. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1620. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1621. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1622. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1623. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1624. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1625. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1626. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1627. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1628. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1629. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1630. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1631. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1632. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1633. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1634. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1635. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1636. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1637. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1638. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1639. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1640. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1641. gbuna1.seq - Unannotated sequence entries, part 1.
1642. gbvrl1.seq - Viral sequence entries, part 1.
1643. gbvrl10.seq - Viral sequence entries, part 10.
1644. gbvrl11.seq - Viral sequence entries, part 11.
1645. gbvrl12.seq - Viral sequence entries, part 12.
1646. gbvrl13.seq - Viral sequence entries, part 13.
1647. gbvrl14.seq - Viral sequence entries, part 14.
1648. gbvrl15.seq - Viral sequence entries, part 15.
1649. gbvrl16.seq - Viral sequence entries, part 16.
1650. gbvrl17.seq - Viral sequence entries, part 17.
1651. gbvrl18.seq - Viral sequence entries, part 18.
1652. gbvrl19.seq - Viral sequence entries, part 19.
1653. gbvrl2.seq - Viral sequence entries, part 2.
1654. gbvrl3.seq - Viral sequence entries, part 3.
1655. gbvrl4.seq - Viral sequence entries, part 4.
1656. gbvrl5.seq - Viral sequence entries, part 5.
1657. gbvrl6.seq - Viral sequence entries, part 6.
1658. gbvrl7.seq - Viral sequence entries, part 7.
1659. gbvrl8.seq - Viral sequence entries, part 8.
1660. gbvrl9.seq - Viral sequence entries, part 9.
1661. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1662. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1663. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1664. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1665. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1666. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1667. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1668. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1669. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1670. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1671. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1672. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1673. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1674. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1675. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1676. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1677. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1678. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1679. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1680. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1681. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1682. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1683. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1684. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 186.0 flatfiles require roughly 518 GB (sequence
files only) or 557 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1836988688 gbacc1.idx
2341553643 gbacc2.idx
801914922 gbacc3.idx
188677816 gbaut1.idx
184345008 gbaut10.idx
240689912 gbaut11.idx
183796184 gbaut12.idx
183909435 gbaut13.idx
183672835 gbaut14.idx
183871449 gbaut15.idx
184000865 gbaut16.idx
184720820 gbaut17.idx
202128846 gbaut18.idx
188805120 gbaut19.idx
226836902 gbaut2.idx
183846401 gbaut20.idx
186616559 gbaut21.idx
236131163 gbaut22.idx
210420690 gbaut23.idx
185943470 gbaut24.idx
184377590 gbaut25.idx
185503510 gbaut26.idx
186639886 gbaut27.idx
184412480 gbaut28.idx
183902391 gbaut29.idx
212688225 gbaut3.idx
205811945 gbaut30.idx
217543066 gbaut31.idx
183939073 gbaut32.idx
184057017 gbaut33.idx
184263408 gbaut34.idx
183896739 gbaut35.idx
188972984 gbaut36.idx
239161204 gbaut37.idx
185573330 gbaut38.idx
185428948 gbaut39.idx
183932104 gbaut4.idx
190493820 gbaut40.idx
186072654 gbaut41.idx
194676404 gbaut42.idx
235169604 gbaut43.idx
190152713 gbaut44.idx
196768626 gbaut45.idx
186725629 gbaut46.idx
184196260 gbaut47.idx
185080615 gbaut48.idx
188211532 gbaut49.idx
211628840 gbaut5.idx
184157264 gbaut50.idx
233953914 gbaut51.idx
185428704 gbaut52.idx
183829644 gbaut53.idx
196440268 gbaut54.idx
200975384 gbaut55.idx
184233358 gbaut56.idx
185643519 gbaut57.idx
185142280 gbaut58.idx
184710171 gbaut59.idx
189765694 gbaut6.idx
190198562 gbaut60.idx
187022556 gbaut61.idx
192301729 gbaut62.idx
185333435 gbaut63.idx
186892428 gbaut64.idx
184618378 gbaut65.idx
183880128 gbaut66.idx
184437911 gbaut67.idx
184036570 gbaut68.idx
187405916 gbaut69.idx
187170170 gbaut7.idx
187258336 gbaut70.idx
184849342 gbaut71.idx
202676810 gbaut72.idx
184323117 gbaut73.idx
248707612 gbaut74.idx
183926073 gbaut75.idx
185737231 gbaut76.idx
187245307 gbaut77.idx
183902477 gbaut78.idx
213946902 gbaut79.idx
191917334 gbaut8.idx
186256727 gbaut80.idx
213866540 gbaut81.idx
204994253 gbaut82.idx
190173443 gbaut83.idx
184712376 gbaut84.idx
185053989 gbaut85.idx
212431707 gbaut86.idx
185718157 gbaut87.idx
192265478 gbaut88.idx
201250208 gbaut89.idx
185527943 gbaut9.idx
184407942 gbaut90.idx
173123926 gbaut91.idx
245958065 gbbct1.seq
243883372 gbbct10.seq
247600630 gbbct11.seq
247739748 gbbct12.seq
86621187 gbbct13.seq
243121258 gbbct14.seq
249783378 gbbct15.seq
245549915 gbbct16.seq
248628237 gbbct17.seq
248244259 gbbct18.seq
249285374 gbbct19.seq
244174428 gbbct2.seq
246200686 gbbct20.seq
245695766 gbbct21.seq
217808715 gbbct22.seq
242806498 gbbct23.seq
241843495 gbbct24.seq
248678472 gbbct25.seq
247877968 gbbct26.seq
249389971 gbbct27.seq
244188196 gbbct28.seq
247136189 gbbct29.seq
247138812 gbbct3.seq
249999634 gbbct30.seq
249762398 gbbct31.seq
249791675 gbbct32.seq
242939612 gbbct33.seq
243142268 gbbct34.seq
149271812 gbbct35.seq
243876513 gbbct36.seq
246112838 gbbct37.seq
242769096 gbbct38.seq
239637752 gbbct39.seq
244905202 gbbct4.seq
247213064 gbbct40.seq
246865504 gbbct41.seq
245887041 gbbct42.seq
244941925 gbbct43.seq
248039357 gbbct44.seq
249505839 gbbct45.seq
243631846 gbbct46.seq
117766347 gbbct47.seq
245585578 gbbct48.seq
246900859 gbbct49.seq
187866534 gbbct5.seq
243975128 gbbct50.seq
248203697 gbbct51.seq
248860905 gbbct52.seq
246442439 gbbct53.seq
243071397 gbbct54.seq
244494175 gbbct55.seq
243337674 gbbct56.seq
242455962 gbbct57.seq
238701011 gbbct58.seq
238162696 gbbct59.seq
242126470 gbbct6.seq
43717604 gbbct60.seq
6887368 gbbct61.seq
14093174 gbbct62.seq
23158271 gbbct63.seq
45090217 gbbct64.seq
87758866 gbbct65.seq
169951015 gbbct66.seq
250000241 gbbct67.seq
249999260 gbbct68.seq
248355331 gbbct69.seq
247361938 gbbct7.seq
239229757 gbbct70.seq
249773560 gbbct71.seq
247251841 gbbct72.seq
249722037 gbbct73.seq
249998405 gbbct74.seq
250000225 gbbct75.seq
249999641 gbbct76.seq
227545820 gbbct77.seq
247175707 gbbct8.seq
244861409 gbbct9.seq
12007351 gbchg.txt
249999381 gbcon1.seq
249996514 gbcon10.seq
249995660 gbcon100.seq
249998605 gbcon101.seq
249998936 gbcon102.seq
250000223 gbcon103.seq
156342446 gbcon104.seq
249996812 gbcon105.seq
249993767 gbcon106.seq
249992301 gbcon107.seq
249998322 gbcon108.seq
71615782 gbcon109.seq
249997306 gbcon11.seq
249997862 gbcon110.seq
249998650 gbcon111.seq
208522809 gbcon112.seq
250000256 gbcon113.seq
250000098 gbcon114.seq
249995503 gbcon115.seq
249706532 gbcon116.seq
149700445 gbcon117.seq
249914315 gbcon118.seq
249998866 gbcon119.seq
248436817 gbcon12.seq
179894056 gbcon120.seq
249997285 gbcon121.seq
250000110 gbcon122.seq
249999490 gbcon123.seq
249225574 gbcon124.seq
21073904 gbcon125.seq
249998180 gbcon126.seq
249965234 gbcon127.seq
249704347 gbcon128.seq
249994924 gbcon129.seq
247344550 gbcon13.seq
249997859 gbcon130.seq
177486331 gbcon131.seq
249999839 gbcon132.seq
249985338 gbcon133.seq
249819716 gbcon134.seq
249993762 gbcon135.seq
249999846 gbcon136.seq
248313325 gbcon137.seq
250000042 gbcon138.seq
249995170 gbcon139.seq
249997550 gbcon14.seq
159567680 gbcon140.seq
249994092 gbcon141.seq
249995878 gbcon142.seq
249847073 gbcon143.seq
250000188 gbcon144.seq
249982669 gbcon145.seq
249998911 gbcon146.seq
249998095 gbcon147.seq
249988435 gbcon148.seq
249998562 gbcon149.seq
77626717 gbcon15.seq
249999746 gbcon150.seq
126917907 gbcon151.seq
18852786 gbcon152.seq
249998119 gbcon16.seq
249998839 gbcon17.seq
241153400 gbcon18.seq
250000143 gbcon19.seq
249654446 gbcon2.seq
248022413 gbcon20.seq
122899681 gbcon21.seq
249998511 gbcon22.seq
120044016 gbcon23.seq
249996870 gbcon24.seq
249946702 gbcon25.seq
249999165 gbcon26.seq
249999892 gbcon27.seq
186019801 gbcon28.seq
249999799 gbcon29.seq
249767877 gbcon3.seq
249997310 gbcon30.seq
249999856 gbcon31.seq
249999952 gbcon32.seq
247968343 gbcon33.seq
232547195 gbcon34.seq
249999237 gbcon35.seq
249996869 gbcon36.seq
249995921 gbcon37.seq
249996351 gbcon38.seq
249999450 gbcon39.seq
249980011 gbcon4.seq
249997210 gbcon40.seq
61183731 gbcon41.seq
249997486 gbcon42.seq
249994070 gbcon43.seq
249999391 gbcon44.seq
249997743 gbcon45.seq
249994859 gbcon46.seq
43089049 gbcon47.seq
249993995 gbcon48.seq
249996310 gbcon49.seq
249994359 gbcon5.seq
249994442 gbcon50.seq
249997248 gbcon51.seq
250000078 gbcon52.seq
36404971 gbcon53.seq
249993185 gbcon54.seq
249998119 gbcon55.seq
249995170 gbcon56.seq
249998154 gbcon57.seq
249998078 gbcon58.seq
152679523 gbcon59.seq
249990922 gbcon6.seq
249999955 gbcon60.seq
249999066 gbcon61.seq
249997558 gbcon62.seq
249998625 gbcon63.seq
183609322 gbcon64.seq
249999870 gbcon65.seq
249997967 gbcon66.seq
249997138 gbcon67.seq
249995207 gbcon68.seq
245488804 gbcon69.seq
249994251 gbcon7.seq
250000182 gbcon70.seq
249998695 gbcon71.seq
249998372 gbcon72.seq
249996966 gbcon73.seq
250000007 gbcon74.seq
96627683 gbcon75.seq
249993448 gbcon76.seq
249995119 gbcon77.seq
249997383 gbcon78.seq
249995948 gbcon79.seq
1242649 gbcon8.seq
249999042 gbcon80.seq
62682749 gbcon81.seq
249997771 gbcon82.seq
249996653 gbcon83.seq
249999445 gbcon84.seq
249999590 gbcon85.seq
249998149 gbcon86.seq
21674116 gbcon87.seq
249998140 gbcon88.seq
249997503 gbcon89.seq
249997708 gbcon9.seq
249996940 gbcon90.seq
249995720 gbcon91.seq
197881888 gbcon92.seq
249993974 gbcon93.seq
249996060 gbcon94.seq
249999726 gbcon95.seq
249998645 gbcon96.seq
249996901 gbcon97.seq
133265984 gbcon98.seq
249994222 gbcon99.seq
1036411 gbdel.txt
250000234 gbenv1.seq
249998769 gbenv10.seq
55644397 gbenv11.seq
249992833 gbenv12.seq
249998792 gbenv13.seq
249998193 gbenv14.seq
249997092 gbenv15.seq
249999093 gbenv16.seq
250000027 gbenv17.seq
242453510 gbenv18.seq
249999792 gbenv19.seq
249951517 gbenv2.seq
249998664 gbenv20.seq
249999862 gbenv21.seq
249999391 gbenv22.seq
126984021 gbenv23.seq
249998342 gbenv24.seq
249998788 gbenv25.seq
250000224 gbenv26.seq
250000205 gbenv27.seq
249998027 gbenv28.seq
98691680 gbenv29.seq
249998522 gbenv3.seq
249998069 gbenv30.seq
249999189 gbenv31.seq
249999448 gbenv32.seq
249999649 gbenv33.seq
133772226 gbenv34.seq
249996865 gbenv35.seq
249999040 gbenv36.seq
249996907 gbenv37.seq
249998531 gbenv38.seq
249999081 gbenv39.seq
250000191 gbenv4.seq
249999344 gbenv40.seq
249997376 gbenv41.seq
249998278 gbenv42.seq
15275522 gbenv43.seq
249997787 gbenv5.seq
199828395 gbenv6.seq
249998474 gbenv7.seq
249999164 gbenv8.seq
249998663 gbenv9.seq
524292008 gbest1.seq
524289074 gbest10.seq
524288778 gbest100.seq
524288833 gbest101.seq
524290452 gbest102.seq
524288973 gbest103.seq
355880285 gbest104.seq
524290739 gbest105.seq
524290766 gbest106.seq
497549721 gbest107.seq
388466620 gbest108.seq
387583252 gbest109.seq
524290873 gbest11.seq
383134801 gbest110.seq
384255866 gbest111.seq
384330768 gbest112.seq
381681060 gbest113.seq
391876539 gbest114.seq
387828747 gbest115.seq
386115234 gbest116.seq
384278538 gbest117.seq
411752507 gbest118.seq
524288776 gbest119.seq
524291034 gbest12.seq
524288945 gbest120.seq
524290906 gbest121.seq
524289142 gbest122.seq
524289615 gbest123.seq
464132445 gbest124.seq
524291745 gbest125.seq
524291580 gbest126.seq
524289399 gbest127.seq
524291046 gbest128.seq
524291345 gbest129.seq
156625823 gbest13.seq
524289232 gbest130.seq
524290348 gbest131.seq
524291728 gbest132.seq
524289021 gbest133.seq
524291691 gbest134.seq
524290085 gbest135.seq
524290315 gbest136.seq
273120700 gbest137.seq
524289576 gbest138.seq
524290808 gbest139.seq
524289059 gbest14.seq
524288732 gbest140.seq
524289869 gbest141.seq
524291732 gbest142.seq
524292557 gbest143.seq
524291158 gbest144.seq
524292949 gbest145.seq
524290150 gbest146.seq
524290120 gbest147.seq
524292630 gbest148.seq
524288875 gbest149.seq
524290761 gbest15.seq
524290754 gbest150.seq
477323442 gbest151.seq
524291481 gbest152.seq
524288755 gbest153.seq
524290806 gbest154.seq
524291159 gbest155.seq
524290648 gbest156.seq
524290244 gbest157.seq
524288933 gbest158.seq
524288965 gbest159.seq
524289293 gbest16.seq
498875804 gbest160.seq
524291138 gbest161.seq
524291204 gbest162.seq
524290931 gbest163.seq
246717351 gbest164.seq
524291394 gbest165.seq
524292589 gbest166.seq
524289569 gbest167.seq
524292460 gbest168.seq
524289782 gbest169.seq
524290890 gbest17.seq
524290136 gbest170.seq
524290499 gbest171.seq
524289348 gbest172.seq
524290943 gbest173.seq
524289934 gbest174.seq
524290947 gbest175.seq
524292201 gbest176.seq
524289113 gbest177.seq
99504677 gbest178.seq
524289321 gbest179.seq
524290478 gbest18.seq
524289070 gbest180.seq
524289276 gbest181.seq
524289413 gbest182.seq
524288916 gbest183.seq
524289640 gbest184.seq
524291362 gbest185.seq
524292174 gbest186.seq
524289861 gbest187.seq
524291086 gbest188.seq
524295553 gbest189.seq
524289798 gbest19.seq
524289916 gbest190.seq
456269322 gbest191.seq
524292122 gbest192.seq
524294602 gbest193.seq
524289274 gbest194.seq
524290484 gbest195.seq
524296357 gbest196.seq
524291748 gbest197.seq
524290059 gbest198.seq
524289088 gbest199.seq
524289694 gbest2.seq
524288894 gbest20.seq
524291323 gbest200.seq
524291154 gbest201.seq
524289224 gbest202.seq
524290647 gbest203.seq
524289566 gbest204.seq
96681995 gbest205.seq
524289515 gbest206.seq
524291512 gbest207.seq
524289488 gbest208.seq
524289590 gbest209.seq
524290258 gbest21.seq
524289505 gbest210.seq
524289825 gbest211.seq
524292125 gbest212.seq
524289680 gbest213.seq
524289985 gbest214.seq
524290341 gbest215.seq
429113346 gbest216.seq
524291220 gbest217.seq
524289160 gbest218.seq
524290688 gbest219.seq
511736959 gbest22.seq
524289647 gbest220.seq
524289531 gbest221.seq
524289998 gbest222.seq
524289219 gbest223.seq
524289797 gbest224.seq
524289922 gbest225.seq
524292471 gbest226.seq
524289597 gbest227.seq
524292597 gbest228.seq
524291497 gbest229.seq
500420432 gbest23.seq
374265867 gbest230.seq
524291984 gbest231.seq
524290729 gbest232.seq
524289568 gbest233.seq
524290083 gbest234.seq
524289654 gbest235.seq
524289219 gbest236.seq
524292092 gbest237.seq
524289348 gbest238.seq
524288912 gbest239.seq
509313832 gbest24.seq
524290398 gbest240.seq
524291444 gbest241.seq
524291240 gbest242.seq
524292170 gbest243.seq
524290007 gbest244.seq
49717216 gbest245.seq
524288791 gbest246.seq
524289055 gbest247.seq
524288976 gbest248.seq
524289062 gbest249.seq
320074347 gbest25.seq
524289204 gbest250.seq
524290815 gbest251.seq
524290794 gbest252.seq
524289386 gbest253.seq
524291087 gbest254.seq
524291625 gbest255.seq
524290910 gbest256.seq
238733254 gbest257.seq
524290229 gbest258.seq
524289476 gbest259.seq
524289651 gbest26.seq
524289258 gbest260.seq
524290220 gbest261.seq
524289730 gbest262.seq
524291816 gbest263.seq
524290013 gbest264.seq
524290437 gbest265.seq
524292138 gbest266.seq
524291611 gbest267.seq
288389840 gbest268.seq
524289868 gbest269.seq
524290384 gbest27.seq
524289317 gbest270.seq
524291183 gbest271.seq
524289421 gbest272.seq
524288893 gbest273.seq
524290367 gbest274.seq
524292375 gbest275.seq
524289005 gbest276.seq
524290987 gbest277.seq
524288984 gbest278.seq
524289432 gbest279.seq
524289573 gbest28.seq
295075726 gbest280.seq
524292218 gbest281.seq
524291705 gbest282.seq
524289206 gbest283.seq
524289937 gbest284.seq
524290162 gbest285.seq
524290187 gbest286.seq
524289634 gbest287.seq
524290540 gbest288.seq
524289289 gbest289.seq
524291648 gbest29.seq
524291358 gbest290.seq
524291217 gbest291.seq
230436031 gbest292.seq
524290421 gbest293.seq
524290362 gbest294.seq
524290162 gbest295.seq
524291478 gbest296.seq
524290585 gbest297.seq
524291045 gbest298.seq
524291256 gbest299.seq
497701912 gbest3.seq
524289197 gbest30.seq
524290554 gbest300.seq
479536031 gbest301.seq
485177448 gbest302.seq
486568728 gbest303.seq
314612459 gbest304.seq
524290941 gbest305.seq
524289808 gbest306.seq
524291283 gbest307.seq
524293446 gbest308.seq
524290053 gbest309.seq
524289971 gbest31.seq
524289827 gbest310.seq
524289698 gbest311.seq
524288824 gbest312.seq
524292863 gbest313.seq
524290363 gbest314.seq
524290255 gbest315.seq
524290308 gbest316.seq
512634022 gbest317.seq
524289440 gbest318.seq
524290224 gbest319.seq
524291802 gbest32.seq
524290144 gbest320.seq
524290214 gbest321.seq
524292228 gbest322.seq
524288981 gbest323.seq
524289590 gbest324.seq
524288851 gbest325.seq
524290837 gbest326.seq
524289506 gbest327.seq
524290648 gbest328.seq
524289402 gbest329.seq
524290891 gbest33.seq
524291426 gbest330.seq
265779956 gbest331.seq
524290600 gbest332.seq
524289381 gbest333.seq
524289853 gbest334.seq
524293392 gbest335.seq
524291417 gbest336.seq
524290174 gbest337.seq
524290738 gbest338.seq
524292471 gbest339.seq
519168849 gbest34.seq
524288832 gbest340.seq
524290663 gbest341.seq
524291863 gbest342.seq
524290557 gbest343.seq
524292140 gbest344.seq
342955890 gbest345.seq
524291567 gbest346.seq
524290674 gbest347.seq
524289259 gbest348.seq
524289297 gbest349.seq
492713599 gbest35.seq
524289847 gbest350.seq
524291289 gbest351.seq
524292525 gbest352.seq
524289193 gbest353.seq
524291674 gbest354.seq
524289217 gbest355.seq
524288924 gbest356.seq
524291845 gbest357.seq
524288754 gbest358.seq
503825700 gbest359.seq
494456277 gbest36.seq
524289502 gbest360.seq
524288833 gbest361.seq
524292104 gbest362.seq
524289321 gbest363.seq
524291060 gbest364.seq
524289246 gbest365.seq
524289037 gbest366.seq
524291454 gbest367.seq
524290225 gbest368.seq
524289377 gbest369.seq
493350210 gbest37.seq
462310508 gbest370.seq
524290811 gbest371.seq
524291642 gbest372.seq
524289514 gbest373.seq
524289698 gbest374.seq
524290929 gbest375.seq
524289136 gbest376.seq
510621282 gbest377.seq
524290677 gbest378.seq
524290408 gbest379.seq
487986033 gbest38.seq
524290567 gbest380.seq
524290213 gbest381.seq
243237228 gbest382.seq
524290778 gbest383.seq
524290239 gbest384.seq
524289060 gbest385.seq
524291267 gbest386.seq
524288726 gbest387.seq
524289527 gbest388.seq
524289637 gbest389.seq
493314905 gbest39.seq
524289697 gbest390.seq
524290037 gbest391.seq
524291445 gbest392.seq
524288996 gbest393.seq
351887099 gbest394.seq
524288812 gbest395.seq
524289154 gbest396.seq
524289586 gbest397.seq
524292554 gbest398.seq
524289098 gbest399.seq
524288944 gbest4.seq
113124437 gbest40.seq
524291905 gbest400.seq
524291795 gbest401.seq
524291180 gbest402.seq
524289445 gbest403.seq
524290474 gbest404.seq
524289349 gbest405.seq
524291301 gbest406.seq
448368085 gbest407.seq
524290058 gbest408.seq
524291154 gbest409.seq
524289314 gbest41.seq
524292958 gbest410.seq
524292414 gbest411.seq
524290839 gbest412.seq
524291860 gbest413.seq
524289118 gbest414.seq
524288764 gbest415.seq
524288830 gbest416.seq
524288966 gbest417.seq
524289857 gbest418.seq
524291419 gbest419.seq
524291610 gbest42.seq
524291902 gbest420.seq
524290764 gbest421.seq
31705988 gbest422.seq
524289516 gbest423.seq
524291737 gbest424.seq
524289042 gbest425.seq
524290517 gbest426.seq
524292362 gbest427.seq
524288825 gbest428.seq
524288779 gbest429.seq
524290507 gbest43.seq
524289873 gbest430.seq
524291757 gbest431.seq
524289928 gbest432.seq
524290320 gbest433.seq
524289948 gbest434.seq
495238432 gbest435.seq
524291543 gbest436.seq
524289057 gbest437.seq
524289109 gbest438.seq
524290724 gbest439.seq
524289688 gbest44.seq
524290428 gbest440.seq
524289054 gbest441.seq
524290571 gbest442.seq
524292352 gbest443.seq
524291127 gbest444.seq
524288886 gbest445.seq
524289208 gbest446.seq
365664905 gbest447.seq
524289187 gbest448.seq
524291274 gbest449.seq
524290948 gbest45.seq
267580033 gbest450.seq
524291044 gbest46.seq
524291229 gbest47.seq
524290748 gbest48.seq
524291292 gbest49.seq
524289625 gbest5.seq
524289713 gbest50.seq
524290962 gbest51.seq
524290660 gbest52.seq
524290374 gbest53.seq
272208245 gbest54.seq
524290953 gbest55.seq
524289827 gbest56.seq
524290438 gbest57.seq
524290438 gbest58.seq
524289001 gbest59.seq
524288762 gbest6.seq
524290645 gbest60.seq
524289866 gbest61.seq
524290309 gbest62.seq
524288857 gbest63.seq
524289558 gbest64.seq
524290265 gbest65.seq
524292797 gbest66.seq
464722319 gbest67.seq
524290606 gbest68.seq
524290843 gbest69.seq
524290789 gbest7.seq
524289260 gbest70.seq
524290256 gbest71.seq
524290468 gbest72.seq
524289907 gbest73.seq
524292321 gbest74.seq
524289970 gbest75.seq
524289923 gbest76.seq
524289851 gbest77.seq
524290180 gbest78.seq
524290649 gbest79.seq
524289317 gbest8.seq
203954566 gbest80.seq
524289591 gbest81.seq
524289366 gbest82.seq
524289171 gbest83.seq
524291302 gbest84.seq
524289470 gbest85.seq
524291414 gbest86.seq
524290335 gbest87.seq
524291416 gbest88.seq
524290818 gbest89.seq
524292211 gbest9.seq
524291137 gbest90.seq
524292099 gbest91.seq
448416560 gbest92.seq
524288741 gbest93.seq
524290991 gbest94.seq
524289485 gbest95.seq
524289150 gbest96.seq
524288878 gbest97.seq
524292054 gbest98.seq
524290750 gbest99.seq
169885408 gbgen.idx
524288964 gbgss1.seq
524291442 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524290642 gbgss103.seq
418359951 gbgss104.seq
524290801 gbgss105.seq
524290943 gbgss106.seq
524290652 gbgss107.seq
524289339 gbgss108.seq
524289785 gbgss109.seq
524292161 gbgss11.seq
524291091 gbgss110.seq
524290077 gbgss111.seq
524289903 gbgss112.seq
524290560 gbgss113.seq
524290818 gbgss114.seq
524289833 gbgss115.seq
55545257 gbgss116.seq
524289667 gbgss117.seq
524288912 gbgss118.seq
524288723 gbgss119.seq
524289997 gbgss12.seq
524290440 gbgss120.seq
524290549 gbgss121.seq
524289653 gbgss122.seq
524291736 gbgss123.seq
524291481 gbgss124.seq
524289727 gbgss125.seq
524289147 gbgss126.seq
524290900 gbgss127.seq
524290264 gbgss128.seq
231414286 gbgss129.seq
524288852 gbgss13.seq
524288892 gbgss130.seq
524290941 gbgss131.seq
524288773 gbgss132.seq
524289898 gbgss133.seq
524289884 gbgss134.seq
524290213 gbgss135.seq
524289102 gbgss136.seq
524292138 gbgss137.seq
524290208 gbgss138.seq
515994483 gbgss139.seq
524288998 gbgss14.seq
516017128 gbgss140.seq
96692958 gbgss141.seq
524289438 gbgss142.seq
524289560 gbgss143.seq
524290293 gbgss144.seq
371611675 gbgss145.seq
249999767 gbgss146.seq
249999448 gbgss147.seq
249999357 gbgss148.seq
249998042 gbgss149.seq
524290063 gbgss15.seq
28618823 gbgss150.seq
249997137 gbgss151.seq
250000033 gbgss152.seq
249998542 gbgss153.seq
249998333 gbgss154.seq
224919493 gbgss155.seq
249998415 gbgss156.seq
249998761 gbgss157.seq
249998880 gbgss158.seq
249997750 gbgss159.seq
524290859 gbgss16.seq
189046598 gbgss160.seq
249999433 gbgss161.seq
249998390 gbgss162.seq
249999267 gbgss163.seq
249998392 gbgss164.seq
249998723 gbgss165.seq
76677866 gbgss166.seq
249997579 gbgss167.seq
2077145 gbgss168.seq
79542394 gbgss169.seq
524290670 gbgss17.seq
249999009 gbgss170.seq
250000259 gbgss171.seq
87380505 gbgss172.seq
249999685 gbgss173.seq
249998355 gbgss174.seq
249998984 gbgss175.seq
202719103 gbgss176.seq
249999232 gbgss177.seq
249999013 gbgss178.seq
249998851 gbgss179.seq
524290328 gbgss18.seq
246250899 gbgss180.seq
249999268 gbgss181.seq
249997406 gbgss182.seq
249999279 gbgss183.seq
243520281 gbgss184.seq
249999336 gbgss185.seq
249997150 gbgss186.seq
249998209 gbgss187.seq
249997376 gbgss188.seq
122294651 gbgss189.seq
314841901 gbgss19.seq
249998013 gbgss190.seq
250000031 gbgss191.seq
249999974 gbgss192.seq
249998152 gbgss193.seq
94058788 gbgss194.seq
249998892 gbgss195.seq
249999850 gbgss196.seq
249998239 gbgss197.seq
249999582 gbgss198.seq
176390240 gbgss199.seq
524289433 gbgss2.seq
524288952 gbgss20.seq
249999236 gbgss200.seq
249997993 gbgss201.seq
249998006 gbgss202.seq
249999353 gbgss203.seq
95926739 gbgss204.seq
249999461 gbgss205.seq
249999350 gbgss206.seq
249998406 gbgss207.seq
249998619 gbgss208.seq
249999398 gbgss209.seq
524289034 gbgss21.seq
249999995 gbgss210.seq
17245248 gbgss211.seq
249999424 gbgss212.seq
249999963 gbgss213.seq
249997369 gbgss214.seq
43648880 gbgss215.seq
52862187 gbgss216.seq
249997605 gbgss217.seq
249998837 gbgss218.seq
249998422 gbgss219.seq
524291398 gbgss22.seq
249998900 gbgss220.seq
30266551 gbgss221.seq
249997658 gbgss222.seq
249997580 gbgss223.seq
249998996 gbgss224.seq
249999984 gbgss225.seq
28042636 gbgss226.seq
249997655 gbgss227.seq
249998570 gbgss228.seq
249997955 gbgss229.seq
524290800 gbgss23.seq
249998842 gbgss230.seq
249999591 gbgss231.seq
249998244 gbgss232.seq
178918094 gbgss233.seq
249999812 gbgss234.seq
249998926 gbgss235.seq
249999095 gbgss236.seq
220154622 gbgss237.seq
250000034 gbgss238.seq
249997956 gbgss239.seq
524291392 gbgss24.seq
250000074 gbgss240.seq
249998729 gbgss241.seq
195288113 gbgss242.seq
249999561 gbgss243.seq
249998751 gbgss244.seq
249999600 gbgss245.seq
249999029 gbgss246.seq
249999714 gbgss247.seq
16550601 gbgss248.seq
524290581 gbgss25.seq
524290713 gbgss26.seq
524290348 gbgss27.seq
524288854 gbgss28.seq
524289528 gbgss29.seq
524291784 gbgss3.seq
524289655 gbgss30.seq
38849864 gbgss31.seq
524289075 gbgss32.seq
524290723 gbgss33.seq
524288828 gbgss34.seq
524289728 gbgss35.seq
524289696 gbgss36.seq
524289533 gbgss37.seq
524289071 gbgss38.seq
509087433 gbgss39.seq
524288885 gbgss4.seq
524290362 gbgss40.seq
524289231 gbgss41.seq
524291640 gbgss42.seq
28732657 gbgss43.seq
524288882 gbgss44.seq
524291090 gbgss45.seq
524290976 gbgss46.seq
524290985 gbgss47.seq
209346767 gbgss48.seq
524291863 gbgss49.seq
168343373 gbgss5.seq
524291582 gbgss50.seq
524290401 gbgss51.seq
524290464 gbgss52.seq
524290548 gbgss53.seq
524290689 gbgss54.seq
524289963 gbgss55.seq
524289945 gbgss56.seq
524290428 gbgss57.seq
524291284 gbgss58.seq
524290900 gbgss59.seq
524290951 gbgss6.seq
5856233 gbgss60.seq
524289023 gbgss61.seq
524290882 gbgss62.seq
524290246 gbgss63.seq
457238462 gbgss64.seq
524291037 gbgss65.seq
524291022 gbgss66.seq
524290625 gbgss67.seq
524289509 gbgss68.seq
524291296 gbgss69.seq
524291098 gbgss7.seq
524289361 gbgss70.seq
524291755 gbgss71.seq
524288723 gbgss72.seq
524289701 gbgss73.seq
524291169 gbgss74.seq
524290322 gbgss75.seq
524291711 gbgss76.seq
32081037 gbgss77.seq
524289473 gbgss78.seq
524291931 gbgss79.seq
524292289 gbgss8.seq
524289482 gbgss80.seq
524290066 gbgss81.seq
524289701 gbgss82.seq
524291196 gbgss83.seq
524290880 gbgss84.seq
524289902 gbgss85.seq
524291820 gbgss86.seq
524289216 gbgss87.seq
524290299 gbgss88.seq
369802312 gbgss89.seq
524290754 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
249992912 gbhtc1.seq
249998309 gbhtc10.seq
203719899 gbhtc11.seq
249997534 gbhtc12.seq
249996368 gbhtc13.seq
56090298 gbhtc14.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
83873876 gbhtc8.seq
249999684 gbhtc9.seq
249904748 gbhtg1.seq
249863408 gbhtg10.seq
249917503 gbhtg100.seq
249844944 gbhtg101.seq
249902534 gbhtg102.seq
249958863 gbhtg103.seq
5671243 gbhtg104.seq
249923070 gbhtg105.seq
249870507 gbhtg106.seq
249954144 gbhtg107.seq
249774696 gbhtg108.seq
249964106 gbhtg109.seq
1107147 gbhtg11.seq
249827788 gbhtg110.seq
249911997 gbhtg111.seq
249893255 gbhtg112.seq
249912206 gbhtg113.seq
191115280 gbhtg114.seq
249974219 gbhtg115.seq
249840707 gbhtg116.seq
249986568 gbhtg117.seq
249791891 gbhtg118.seq
249796285 gbhtg119.seq
249658387 gbhtg12.seq
54045006 gbhtg120.seq
249792713 gbhtg121.seq
249995363 gbhtg122.seq
249795284 gbhtg123.seq
249905084 gbhtg124.seq
249961276 gbhtg125.seq
135522584 gbhtg126.seq
249793216 gbhtg127.seq
249693112 gbhtg128.seq
249763470 gbhtg129.seq
249699749 gbhtg13.seq
249945885 gbhtg130.seq
249771412 gbhtg131.seq
249959213 gbhtg132.seq
249887212 gbhtg133.seq
249952128 gbhtg134.seq
249894635 gbhtg135.seq
37204597 gbhtg136.seq
249765870 gbhtg14.seq
249760883 gbhtg15.seq
249872612 gbhtg16.seq
249832528 gbhtg17.seq
249983662 gbhtg18.seq
249677291 gbhtg19.seq
249994630 gbhtg2.seq
249988730 gbhtg20.seq
237145184 gbhtg21.seq
249760624 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761207 gbhtg26.seq
249891641 gbhtg27.seq
249961480 gbhtg28.seq
249848514 gbhtg29.seq
249950135 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249920767 gbhtg33.seq
249929437 gbhtg34.seq
249919058 gbhtg35.seq
249852033 gbhtg36.seq
249814604 gbhtg37.seq
249767419 gbhtg38.seq
249627604 gbhtg39.seq
249984089 gbhtg4.seq
249839726 gbhtg40.seq
224363115 gbhtg41.seq
249889211 gbhtg42.seq
249786801 gbhtg43.seq
249972417 gbhtg44.seq
249775813 gbhtg45.seq
249928134 gbhtg46.seq
249597238 gbhtg47.seq
249865052 gbhtg48.seq
249793005 gbhtg49.seq
249882044 gbhtg5.seq
249922691 gbhtg50.seq
235040940 gbhtg51.seq
249732550 gbhtg52.seq
249918496 gbhtg53.seq
249801065 gbhtg54.seq
249971361 gbhtg55.seq
249962512 gbhtg56.seq
18795863 gbhtg57.seq
249918734 gbhtg58.seq
249805918 gbhtg59.seq
249898460 gbhtg6.seq
249931678 gbhtg60.seq
249965766 gbhtg61.seq
226497721 gbhtg62.seq
249954240 gbhtg63.seq
249905771 gbhtg64.seq
249911228 gbhtg65.seq
249866240 gbhtg66.seq
249930142 gbhtg67.seq
16400292 gbhtg68.seq
249960711 gbhtg69.seq
249933725 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249976464 gbhtg72.seq
225297470 gbhtg73.seq
249811185 gbhtg74.seq
249874975 gbhtg75.seq
249797849 gbhtg76.seq
249959610 gbhtg77.seq
244236501 gbhtg78.seq
249883367 gbhtg79.seq
249933567 gbhtg8.seq
249988070 gbhtg80.seq
249839493 gbhtg81.seq
249838775 gbhtg82.seq
216752366 gbhtg83.seq
249912287 gbhtg84.seq
249753930 gbhtg85.seq
249788636 gbhtg86.seq
249773916 gbhtg87.seq
221377039 gbhtg88.seq
249971787 gbhtg89.seq
249923766 gbhtg9.seq
249954241 gbhtg90.seq
249906002 gbhtg91.seq
249891916 gbhtg92.seq
209912004 gbhtg93.seq
249866103 gbhtg94.seq
249975867 gbhtg95.seq
249904055 gbhtg96.seq
249804025 gbhtg97.seq
168109739 gbhtg98.seq
249744688 gbhtg99.seq
249997383 gbinv1.seq
249997768 gbinv10.seq
161562374 gbinv11.seq
250000212 gbinv12.seq
249996134 gbinv13.seq
249999757 gbinv14.seq
148387478 gbinv15.seq
249346527 gbinv16.seq
248695001 gbinv17.seq
249999680 gbinv18.seq
249998984 gbinv19.seq
249951554 gbinv2.seq
249996935 gbinv20.seq
69941968 gbinv21.seq
249992098 gbinv22.seq
249996367 gbinv23.seq
250000137 gbinv24.seq
250000158 gbinv25.seq
249999651 gbinv26.seq
249997623 gbinv27.seq
249997488 gbinv28.seq
249936091 gbinv29.seq
214077524 gbinv3.seq
20529577 gbinv30.seq
249996940 gbinv4.seq
249999469 gbinv5.seq
250000143 gbinv6.seq
224649236 gbinv7.seq
249997585 gbinv8.seq
249998145 gbinv9.seq
139883394 gbjou1.idx
286258726 gbjou10.idx
263630296 gbjou11.idx
184975184 gbjou12.idx
139639158 gbjou2.idx
149393342 gbjou3.idx
190273769 gbjou4.idx
271793290 gbjou5.idx
275568277 gbjou6.idx
281337312 gbjou7.idx
283605924 gbjou8.idx
305714489 gbjou9.idx
324410246 gbkey1.idx
180066061 gbkey2.idx
183223114 gbkey3.idx
216660042 gbkey4.idx
183462680 gbkey5.idx
106745841 gbkey6.idx
249971396 gbmam1.seq
249977727 gbmam2.seq
249951518 gbmam3.seq
249999074 gbmam4.seq
249999439 gbmam5.seq
249996616 gbmam6.seq
178734461 gbmam7.seq
37799748 gbnew.txt
249999688 gbpat1.seq
250000066 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192934308 gbpat107.seq
249999769 gbpat108.seq
249999627 gbpat109.seq
179522265 gbpat11.seq
249999169 gbpat110.seq
80117336 gbpat111.seq
249999251 gbpat112.seq
250000013 gbpat113.seq
249978955 gbpat114.seq
249999878 gbpat115.seq
249849703 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
249999231 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
249994005 gbpat13.seq
249997452 gbpat130.seq
66832984 gbpat131.seq
249992315 gbpat132.seq
249999867 gbpat133.seq
250000197 gbpat134.seq
249999821 gbpat135.seq
45151156 gbpat136.seq
249998039 gbpat137.seq
250000068 gbpat138.seq
249999988 gbpat139.seq
250000080 gbpat14.seq
86028783 gbpat140.seq
249999922 gbpat141.seq
249999885 gbpat142.seq
249998973 gbpat143.seq
63534417 gbpat144.seq
249997259 gbpat145.seq
249998106 gbpat146.seq
249999335 gbpat147.seq
249999902 gbpat148.seq
249999342 gbpat149.seq
249996509 gbpat15.seq
249997292 gbpat150.seq
222063924 gbpat151.seq
250000249 gbpat152.seq
249999893 gbpat153.seq
249999893 gbpat154.seq
220539897 gbpat155.seq
249999753 gbpat156.seq
249998945 gbpat157.seq
250000149 gbpat158.seq
11330901 gbpat159.seq
249999147 gbpat16.seq
249997013 gbpat160.seq
249997482 gbpat161.seq
249999720 gbpat162.seq
249997412 gbpat163.seq
35336717 gbpat164.seq
249998568 gbpat165.seq
249997741 gbpat166.seq
250000189 gbpat167.seq
249999269 gbpat168.seq
250000082 gbpat169.seq
65866387 gbpat17.seq
249998153 gbpat170.seq
246395191 gbpat171.seq
250000027 gbpat18.seq
249999801 gbpat19.seq
249999763 gbpat2.seq
249999076 gbpat20.seq
249994882 gbpat21.seq
185815087 gbpat22.seq
249999907 gbpat23.seq
249838032 gbpat24.seq
249999188 gbpat25.seq
250000065 gbpat26.seq
71180933 gbpat27.seq
249983437 gbpat28.seq
249999262 gbpat29.seq
249998426 gbpat3.seq
250000216 gbpat30.seq
249999940 gbpat31.seq
249999636 gbpat32.seq
180161695 gbpat33.seq
249997730 gbpat34.seq
249999961 gbpat35.seq
249998966 gbpat36.seq
249999898 gbpat37.seq
130526128 gbpat38.seq
249995261 gbpat39.seq
249999756 gbpat4.seq
249979840 gbpat40.seq
249999077 gbpat41.seq
249998929 gbpat42.seq
249999195 gbpat43.seq
249816223 gbpat44.seq
249999190 gbpat45.seq
249999692 gbpat46.seq
171260350 gbpat47.seq
249999855 gbpat48.seq
249998527 gbpat49.seq
71790242 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164688826 gbpat56.seq
249881328 gbpat57.seq
249997007 gbpat58.seq
249999411 gbpat59.seq
249999527 gbpat6.seq
249999118 gbpat60.seq
134917207 gbpat61.seq
249998246 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999532 gbpat67.seq
144886744 gbpat68.seq
250000113 gbpat69.seq
249999799 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244402927 gbpat72.seq
248968678 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999937 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249996070 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
249999823 gbpat82.seq
249999742 gbpat83.seq
93329421 gbpat84.seq
249153657 gbpat85.seq
249998925 gbpat86.seq
249999067 gbpat87.seq
249999347 gbpat88.seq
249999476 gbpat89.seq
249998073 gbpat9.seq
249998929 gbpat90.seq
145288703 gbpat91.seq
249998977 gbpat92.seq
249998980 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196964910 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
160647288 gbphg1.seq
249998465 gbpln1.seq
249998880 gbpln10.seq
250000097 gbpln11.seq
249875998 gbpln12.seq
214506486 gbpln13.seq
249998215 gbpln14.seq
249985349 gbpln15.seq
249996352 gbpln16.seq
249410143 gbpln17.seq
249979838 gbpln18.seq
249606502 gbpln19.seq
249813070 gbpln2.seq
250000190 gbpln20.seq
33382277 gbpln21.seq
249994441 gbpln22.seq
97573049 gbpln23.seq
249998659 gbpln24.seq
250000256 gbpln25.seq
248862439 gbpln26.seq
203148524 gbpln27.seq
247978482 gbpln28.seq
249995193 gbpln29.seq
249837402 gbpln3.seq
249995344 gbpln30.seq
249999940 gbpln31.seq
249998578 gbpln32.seq
217272380 gbpln33.seq
249997916 gbpln34.seq
249997966 gbpln35.seq
249999674 gbpln36.seq
249997708 gbpln37.seq
135370470 gbpln38.seq
249893576 gbpln39.seq
249845484 gbpln4.seq
249999714 gbpln40.seq
249999994 gbpln41.seq
249435710 gbpln42.seq
249998161 gbpln43.seq
115997610 gbpln44.seq
249999790 gbpln45.seq
250000133 gbpln46.seq
249998040 gbpln47.seq
250000162 gbpln48.seq
249999174 gbpln49.seq
249876333 gbpln5.seq
249999220 gbpln50.seq
70066069 gbpln51.seq
249943223 gbpln6.seq
249996652 gbpln7.seq
187399899 gbpln8.seq
249998108 gbpln9.seq
148950307 gbpri1.seq
249830111 gbpri10.seq
129166622 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902427 gbpri16.seq
249876185 gbpri17.seq
249991978 gbpri18.seq
249902736 gbpri19.seq
249828843 gbpri2.seq
249871464 gbpri20.seq
249969201 gbpri21.seq
249999341 gbpri22.seq
8194048 gbpri23.seq
177481056 gbpri24.seq
249996132 gbpri25.seq
211364614 gbpri26.seq
249876551 gbpri27.seq
249832462 gbpri28.seq
249948820 gbpri29.seq
249927696 gbpri3.seq
249937231 gbpri30.seq
249957235 gbpri31.seq
249854829 gbpri32.seq
249968208 gbpri33.seq
249999199 gbpri34.seq
95851922 gbpri35.seq
249993971 gbpri36.seq
249998537 gbpri37.seq
249973146 gbpri38.seq
249996570 gbpri39.seq
249989122 gbpri4.seq
250000016 gbpri40.seq
178253407 gbpri41.seq
249998290 gbpri42.seq
249998417 gbpri43.seq
2411937 gbpri44.seq
249744730 gbpri5.seq
249982318 gbpri6.seq
249971406 gbpri7.seq
249775742 gbpri8.seq
249970958 gbpri9.seq
315136 gbrel.txt
249965627 gbrod1.seq
249952616 gbrod10.seq
60961015 gbrod11.seq
249871284 gbrod12.seq
249783783 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249885197 gbrod17.seq
249873165 gbrod18.seq
234765149 gbrod19.seq
249942176 gbrod2.seq
249812485 gbrod20.seq
249924095 gbrod21.seq
230155519 gbrod22.seq
249992720 gbrod23.seq
250000022 gbrod24.seq
249945267 gbrod25.seq
249902066 gbrod26.seq
249999318 gbrod27.seq
249999948 gbrod28.seq
157461026 gbrod29.seq
249785229 gbrod3.seq
249743057 gbrod4.seq
249987585 gbrod5.seq
249985583 gbrod6.seq
249746791 gbrod7.seq
249760313 gbrod8.seq
249867062 gbrod9.seq
3800777847 gbsdr1.txt
5686561265 gbsdr2.txt
2606620131 gbsdr3.txt
153116315 gbsec.idx
249997185 gbsts1.seq
249997720 gbsts10.seq
210919464 gbsts11.seq
249996524 gbsts12.seq
249999349 gbsts13.seq
249999346 gbsts14.seq
249999572 gbsts15.seq
24470469 gbsts16.seq
249999107 gbsts17.seq
249997782 gbsts18.seq
250000230 gbsts19.seq
249999957 gbsts2.seq
146601374 gbsts20.seq
249999302 gbsts3.seq
250000060 gbsts4.seq
39162150 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249998706 gbsts9.seq
249999399 gbsyn1.seq
249998704 gbsyn2.seq
49490372 gbsyn3.seq
249999677 gbtsa1.seq
249996692 gbtsa10.seq
249999040 gbtsa11.seq
89577387 gbtsa12.seq
249997835 gbtsa13.seq
249999221 gbtsa14.seq
249998017 gbtsa15.seq
250000059 gbtsa16.seq
167332404 gbtsa17.seq
250000170 gbtsa18.seq
249999456 gbtsa19.seq
249999837 gbtsa2.seq
249999674 gbtsa20.seq
249998853 gbtsa21.seq
249998324 gbtsa22.seq
86745703 gbtsa23.seq
249998710 gbtsa24.seq
249998743 gbtsa25.seq
249997584 gbtsa26.seq
249998300 gbtsa27.seq
249999214 gbtsa28.seq
249996662 gbtsa29.seq
250000222 gbtsa3.seq
119544061 gbtsa30.seq
250000015 gbtsa31.seq
249998533 gbtsa32.seq
249998813 gbtsa33.seq
249999396 gbtsa34.seq
148167803 gbtsa35.seq
249998927 gbtsa36.seq
249999152 gbtsa37.seq
249997910 gbtsa38.seq
249997209 gbtsa39.seq
249999115 gbtsa4.seq
250000217 gbtsa40.seq
249999263 gbtsa41.seq
249999332 gbtsa42.seq
100887885 gbtsa43.seq
82924795 gbtsa5.seq
249999422 gbtsa6.seq
249998425 gbtsa7.seq
249997712 gbtsa8.seq
249997802 gbtsa9.seq
483272 gbuna1.seq
249998656 gbvrl1.seq
249993611 gbvrl10.seq
80362152 gbvrl11.seq
249998658 gbvrl12.seq
249999123 gbvrl13.seq
249998793 gbvrl14.seq
249999877 gbvrl15.seq
249999558 gbvrl16.seq
249996422 gbvrl17.seq
249997111 gbvrl18.seq
74343802 gbvrl19.seq
249997808 gbvrl2.seq
249998626 gbvrl3.seq
249998927 gbvrl4.seq
178996386 gbvrl5.seq
249996371 gbvrl6.seq
249995318 gbvrl7.seq
249998537 gbvrl8.seq
249997678 gbvrl9.seq
249911358 gbvrt1.seq
249762539 gbvrt10.seq
249940020 gbvrt11.seq
185678776 gbvrt12.seq
249995062 gbvrt13.seq
249952465 gbvrt14.seq
249989514 gbvrt15.seq
249999532 gbvrt16.seq
249999452 gbvrt17.seq
249997709 gbvrt18.seq
96622619 gbvrt19.seq
249998319 gbvrt2.seq
249958369 gbvrt20.seq
249998882 gbvrt21.seq
250000207 gbvrt22.seq
249963607 gbvrt23.seq
195066897 gbvrt24.seq
249927727 gbvrt3.seq
249998530 gbvrt4.seq
88363164 gbvrt5.seq
249999800 gbvrt6.seq
249995207 gbvrt7.seq
249818397 gbvrt8.seq
249951536 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 61326 87069481
BCT10 59 115338437
BCT11 106 116532735
BCT12 85 114553152
BCT13 16094 32241010
BCT14 53934 85390363
BCT15 93 110189094
BCT16 151 93915681
BCT17 61 112455059
BCT18 52 112042350
BCT19 46 114233015
BCT2 77 108456158
BCT20 58 114931588
BCT21 67 111284815
BCT22 36 96325907
BCT23 40 106881287
BCT24 58 105533856
BCT25 74 111675186
BCT26 55 110045255
BCT27 63 106845575
BCT28 55 109391288
BCT29 52 108559385
BCT3 52 112222201
BCT30 46 110496749
BCT31 95 109522868
BCT32 59 110966729
BCT33 67 108616570
BCT34 123 106326491
BCT35 35 64734494
BCT36 202 109105429
BCT37 51 109861512
BCT38 40 106911174
BCT39 54 104252121
BCT4 56 108403366
BCT40 58 107350200
BCT41 44 110960713
BCT42 80 107599606
BCT43 52 108571742
BCT44 46 107138318
BCT45 69 109010656
BCT46 69 107419673
BCT47 56 53617798
BCT48 67 107603750
BCT49 63 105184773
BCT5 38310 69864041
BCT50 49 104991871
BCT51 55 108636299
BCT52 55 108838606
BCT53 65 109544347
BCT54 56 102535788
BCT55 53 108932898
BCT56 62 110888751
BCT57 62 106876890
BCT58 234 101660890
BCT59 106 93623325
BCT6 39043 82651336
BCT60 323 16011156
BCT61 1589 2511877
BCT62 3179 5215895
BCT63 6347 7901828
BCT64 12648 15076611
BCT65 25628 27748212
BCT66 50523 53965402
BCT67 76530 77431425
BCT68 71815 77221045
BCT69 8476 96045062
BCT7 5523 96146382
BCT70 5284 100110266
BCT71 2994 107953057
BCT72 64 115956397
BCT73 7574 111834779
BCT74 43476 90826184
BCT75 79677 76973084
BCT76 77321 79383068
BCT77 43054 83565896
BCT8 13866 90149060
BCT9 6715 96271813
ENV1 94560 71228865
ENV10 83131 87251437
ENV11 20048 17357810
ENV12 84810 80888385
ENV13 120620 43451255
ENV14 88782 78178750
ENV15 96735 67817124
ENV16 96123 63443144
ENV17 90207 68396180
ENV18 62549 84459720
ENV19 69532 85606513
ENV2 88456 70421762
ENV20 94240 72047110
ENV21 128636 31373040
ENV22 123352 29531526
ENV23 63138 14125004
ENV24 123211 49880671
ENV25 97687 68129479
ENV26 117076 55598174
ENV27 137907 52342897
ENV28 105393 60919472
ENV29 33843 33385740
ENV3 93817 72070703
ENV30 71058 96548027
ENV31 95623 69639811
ENV32 107872 43891018
ENV33 89810 67190655
ENV34 56534 35361831
ENV35 111406 47254754
ENV36 104051 58875362
ENV37 83455 80654968
ENV38 70388 95663757
ENV39 83068 78365612
ENV4 79671 85043329
ENV40 109851 54766915
ENV41 112528 57858958
ENV42 97045 68933743
ENV43 6340 4350562
ENV5 88754 86409978
ENV6 84206 48439161
ENV7 131779 31253773
ENV8 86481 70556703
ENV9 93329 72923888
EST1 158932 61578479
EST10 167449 72157693
EST100 226246 140244228
EST101 227650 115512157
EST102 201352 104759214
EST103 171846 101001632
EST104 102126 80217780
EST105 165115 110910500
EST106 168492 110404328
EST107 117045 68088832
EST108 63862 23524922
EST109 64111 22728110
EST11 169551 73990710
EST110 64333 23423738
EST111 64295 27229760
EST112 64309 21906722
EST113 65711 25952841
EST114 63772 27851303
EST115 64287 26250735
EST116 64524 26961819
EST117 64245 25129930
EST118 61225 38053414
EST119 162221 77029806
EST12 166812 70069138
EST120 174877 86174524
EST121 158380 92882006
EST122 149629 95740598
EST123 153465 89562014
EST124 126102 78376586
EST125 202965 99365751
EST126 153470 79485397
EST127 157984 84332718
EST128 155616 89074097
EST129 149671 79530249
EST13 72705 34876658
EST130 174549 101427867
EST131 200117 116375887
EST132 182466 99500529
EST133 162794 84335553
EST134 158384 80343399
EST135 146271 89300169
EST136 142040 85621992
EST137 93547 49250507
EST138 188174 107230956
EST139 232244 102005310
EST14 217695 109285016
EST140 152949 89658052
EST141 168243 91528235
EST142 146977 87176235
EST143 137592 86859849
EST144 157584 95380358
EST145 146230 76528628
EST146 123465 64403702
EST147 121766 65838388
EST148 129199 54539674
EST149 127611 50728680
EST15 168607 105336506
EST150 128332 51059563
EST151 119628 45497831
EST152 171987 86431419
EST153 180108 80413973
EST154 154640 109509473
EST155 211717 129303978
EST156 215418 119841849
EST157 174371 93026469
EST158 147134 111968477
EST159 134254 83215438
EST16 178903 112375673
EST160 156293 97463904
EST161 150015 80099442
EST162 141996 81782604
EST163 168909 94489345
EST164 73127 43929275
EST165 154647 96039721
EST166 188788 106010503
EST167 142855 78239967
EST168 135318 71833347
EST169 169012 94243879
EST17 195359 112894197
EST170 179606 103224367
EST171 150944 94319521
EST172 171466 83787562
EST173 129274 86098370
EST174 182921 107888611
EST175 164700 93082046
EST176 112254 66489423
EST177 164134 93649141
EST178 34024 21458566
EST179 169057 101105966
EST18 190585 121534640
EST180 181519 127676908
EST181 148866 106517189
EST182 190688 99355890
EST183 152818 115933511
EST184 144134 86913214
EST185 145429 82980293
EST186 177762 71910538
EST187 149526 84416267
EST188 155111 97052601
EST189 162534 99713837
EST19 159270 114061826
EST190 142492 88407244
EST191 161962 94314860
EST192 133751 89892309
EST193 131214 88385686
EST194 144974 89318157
EST195 134034 89306024
EST196 123962 87046239
EST197 173234 92429218
EST198 173993 95865745
EST199 173452 96319355
EST2 161860 61550624
EST20 187057 99421374
EST200 171166 96071620
EST201 168260 94205403
EST202 172248 95869353
EST203 173457 95045379
EST204 174007 95566480
EST205 32241 17539516
EST206 191221 103857793
EST207 202340 106572270
EST208 174708 105322475
EST209 183788 103897173
EST21 217142 106473483
EST210 197127 118575608
EST211 195603 116481485
EST212 182817 121345287
EST213 174142 104988790
EST214 214292 146889287
EST215 237615 107490631
EST216 139184 108090593
EST217 150611 101325422
EST218 146717 90968134
EST219 206003 111613964
EST22 198689 65854508
EST220 171846 113707459
EST221 99894 91366320
EST222 142700 110417702
EST223 160861 94612232
EST224 145634 106233342
EST225 216451 100672334
EST226 144151 101917132
EST227 137850 96875222
EST228 140442 100765989
EST229 121104 86078223
EST23 140919 40078602
EST230 95726 61643929
EST231 141471 91741484
EST232 133065 98059995
EST233 137723 98127199
EST234 123943 84430809
EST235 132773 86783449
EST236 158089 116662159
EST237 143350 117072713
EST238 133623 113074142
EST239 154955 95490210
EST24 103789 28104160
EST240 178004 112869396
EST241 146342 92413476
EST242 179485 112603453
EST243 164510 122349747
EST244 139127 103160789
EST245 12892 10361887
EST246 164720 100631642
EST247 231344 97062636
EST248 152024 113248134
EST249 179418 65090716
EST25 121694 50973646
EST250 216999 50009383
EST251 212372 82251167
EST252 171168 131296449
EST253 165241 101374921
EST254 168820 107570382
EST255 164416 111391200
EST256 166494 117223162
EST257 86955 44523514
EST258 187527 98342383
EST259 176377 111574122
EST26 213567 97235467
EST260 165301 109204494
EST261 233165 110648014
EST262 278243 120126946
EST263 183426 111861504
EST264 187451 36835066
EST265 259302 124375583
EST266 151681 94570434
EST267 161058 104999385
EST268 96468 56224592
EST269 173960 118516619
EST27 219254 110181984
EST270 183544 98668495
EST271 172298 113450704
EST272 182190 105422658
EST273 207959 36663663
EST274 190924 56138308
EST275 185637 105844530
EST276 187402 118290177
EST277 173072 113368890
EST278 179914 102608802
EST279 156414 104382218
EST28 190354 88484191
EST280 111526 37304179
EST281 129600 81610404
EST282 132914 85973481
EST283 156201 100488841
EST284 259869 27442053
EST285 263840 24257439
EST286 146393 105988849
EST287 168770 109355829
EST288 161510 102926505
EST289 155850 91032920
EST29 157931 68869158
EST290 264482 32055739
EST291 164953 108230062
EST292 74061 43081711
EST293 184861 111105312
EST294 149154 90958928
EST295 195241 109667361
EST296 164384 114890485
EST297 161989 104421777
EST298 189169 113833213
EST299 179328 100251464
EST3 153644 54437600
EST30 171511 69599612
EST300 181383 103369646
EST301 188354 64352233
EST302 187451 69725319
EST303 187275 70867111
EST304 122724 47148663
EST305 187185 91785806
EST306 182038 133328103
EST307 149734 86313697
EST308 154223 90726305
EST309 128769 100384088
EST31 149119 63286460
EST310 157095 97917499
EST311 170093 97327103
EST312 155002 96979360
EST313 170487 98323060
EST314 157479 105228946
EST315 145590 101435616
EST316 165035 106667773
EST317 156841 115346378
EST318 182350 153688521
EST319 172870 94250967
EST32 168269 76124897
EST320 134288 85081875
EST321 144101 99204276
EST322 140733 93930760
EST323 139813 91376583
EST324 145668 101529445
EST325 151004 101274436
EST326 179216 106360768
EST327 149680 86814073
EST328 151777 86252807
EST329 155069 112518617
EST33 174101 66739185
EST330 158736 94844239
EST331 74695 49654901
EST332 138874 86895051
EST333 153401 95218013
EST334 205674 106155989
EST335 114630 63130236
EST336 103098 65541951
EST337 132620 88727872
EST338 138968 87932614
EST339 122736 75528305
EST34 122487 43016182
EST340 216915 82876497
EST341 181976 86153964
EST342 157263 95358336
EST343 178133 108909216
EST344 150991 90140367
EST345 83985 55256758
EST346 134775 90087103
EST347 146792 95463863
EST348 186794 116615562
EST349 158508 90548567
EST35 97396 29888300
EST350 174744 100158744
EST351 175974 129599488
EST352 80780 48929197
EST353 86315 48529032
EST354 146130 84298661
EST355 131105 77318164
EST356 158044 41832001
EST357 158945 31643797
EST358 157007 50204733
EST359 183194 119442683
EST36 97796 30592629
EST360 247411 114270670
EST361 250794 114843051
EST362 175681 99443055
EST363 142340 92335399
EST364 137895 86154090
EST365 156657 93377517
EST366 194929 119811931
EST367 222416 58984859
EST368 185023 113012720
EST369 222088 121751698
EST37 96710 29344301
EST370 140061 67438644
EST371 172245 96252364
EST372 156756 102795306
EST373 195018 134351805
EST374 174170 135838783
EST375 173559 117720807
EST376 164126 97459246
EST377 169242 109856593
EST378 201899 111004187
EST379 192507 100072380
EST38 98631 29838971
EST380 196930 125849029
EST381 187706 126333979
EST382 95841 62825467
EST383 207712 138438415
EST384 215741 136643207
EST385 210551 167719640
EST386 182998 114117591
EST387 192857 106504596
EST388 170238 17305329
EST389 159981 13424443
EST39 99462 31214409
EST390 157075 25488375
EST391 158757 32094576
EST392 158784 32026326
EST393 151030 74156276
EST394 112908 60951032
EST395 174540 117870682
EST396 168070 104557955
EST397 161846 108175546
EST398 142736 95576122
EST399 141812 100927822
EST4 170812 67108330
EST40 23412 5974147
EST400 148632 95833394
EST401 177682 127447479
EST402 152819 98124428
EST403 169687 71441300
EST404 167922 26449925
EST405 163202 97952568
EST406 154579 103420369
EST407 148239 96709040
EST408 137182 79317706
EST409 195040 106730268
EST41 100939 53072419
EST410 174186 126104187
EST411 132906 91258721
EST412 131762 89392018
EST413 154389 96443191
EST414 172672 96051563
EST415 181583 97867801
EST416 136459 86956323
EST417 177544 110670729
EST418 172599 99406781
EST419 110115 75738911
EST42 119743 50936518
EST420 79725 60948058
EST421 107431 70543443
EST422 10964 7039129
EST423 153970 83828884
EST424 127918 78048982
EST425 137042 90729391
EST426 141999 83405020
EST427 167362 97568858
EST428 163166 89897911
EST429 186478 113072870
EST43 164226 85713541
EST430 134269 90019136
EST431 179646 84292333
EST432 165415 83417178
EST433 147356 83561242
EST434 194903 116892725
EST435 130232 74007213
EST436 138498 93043801
EST437 168177 72913512
EST438 191058 81409324
EST439 206009 86772150
EST44 166541 67593246
EST440 208592 95590119
EST441 216069 124793463
EST442 163328 101539614
EST443 182186 114849665
EST444 137931 95609233
EST445 174775 104049203
EST446 156222 84941951
EST447 108430 61816058
EST448 162665 61491578
EST449 168158 61388361
EST45 166224 87628943
EST450 83554 31925150
EST46 170505 87070423
EST47 162152 87609672
EST48 162766 82200783
EST49 157564 91124148
EST5 168996 66194437
EST50 161276 90972236
EST51 158797 98381511
EST52 157174 69444234
EST53 150537 82915673
EST54 81556 49893233
EST55 167810 67437632
EST56 160506 76554679
EST57 169012 93203050
EST58 156509 101556430
EST59 157528 100171055
EST6 171504 66930687
EST60 163286 100737727
EST61 160622 106106186
EST62 172745 73925449
EST63 173098 100995758
EST64 151312 80226023
EST65 151189 84176520
EST66 158943 99339438
EST67 137439 78869222
EST68 143246 84949107
EST69 196196 109259343
EST7 169800 72720649
EST70 198065 103913914
EST71 211428 118588609
EST72 192227 113441035
EST73 193736 114107827
EST74 160362 86307977
EST75 133200 62208509
EST76 136978 68752120
EST77 158519 108107804
EST78 155599 85618343
EST79 144501 78803079
EST8 179404 72869764
EST80 55928 37619223
EST81 182736 94291775
EST82 211409 123400305
EST83 214004 114923333
EST84 209542 98561345
EST85 208755 91073565
EST86 148578 90296265
EST87 144373 83813351
EST88 162680 81162672
EST89 159964 80838973
EST9 168515 69281418
EST90 152170 103082687
EST91 152468 99396291
EST92 133266 75530318
EST93 152417 115330544
EST94 141962 104565648
EST95 145436 105498584
EST96 139338 88127114
EST97 153142 86314564
EST98 174623 107227687
EST99 243862 149434211
GSS1 200064 87618344
GSS10 132040 60283372
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167238 128921102
GSS104 149783 82569304
GSS105 191527 120854119
GSS106 167754 112128998
GSS107 197330 115526115
GSS108 204979 134771775
GSS109 209811 138227419
GSS11 137026 73963307
GSS110 207578 140849257
GSS111 206236 142442604
GSS112 205252 143736524
GSS113 205174 143940262
GSS114 202120 146640781
GSS115 182321 139886386
GSS116 18402 10868805
GSS117 132848 84052151
GSS118 169611 80019194
GSS119 184545 79632195
GSS12 147892 75892162
GSS120 170318 148382271
GSS121 178761 122101974
GSS122 184777 149531015
GSS123 192469 124834726
GSS124 187625 137647444
GSS125 192651 126497530
GSS126 189221 96872152
GSS127 165909 151781588
GSS128 164442 116093124
GSS129 72663 49006416
GSS13 145394 68606548
GSS130 171039 155483517
GSS131 172723 154180802
GSS132 172116 155501394
GSS133 173773 154311856
GSS134 174061 152721060
GSS135 184042 145572037
GSS136 180024 146309329
GSS137 163722 112645723
GSS138 214844 84093959
GSS139 265737 40936659
GSS14 169809 84775490
GSS140 265733 40959700
GSS141 49822 7636037
GSS142 257639 58116823
GSS143 247420 64679570
GSS144 195059 78979857
GSS145 135919 35833184
GSS146 87119 64001369
GSS147 83555 62807125
GSS148 103680 48622736
GSS149 68577 58472590
GSS15 161100 97663213
GSS150 7664 7016149
GSS151 68591 57924394
GSS152 69224 56650935
GSS153 69460 56187403
GSS154 71202 55998401
GSS155 68561 51865315
GSS156 75915 58209304
GSS157 87237 74898207
GSS158 81830 44609896
GSS159 92677 45029689
GSS16 172836 87033749
GSS160 63209 47603494
GSS161 77435 61351403
GSS162 69655 58699293
GSS163 67711 62706526
GSS164 62009 53369632
GSS165 95592 42925428
GSS166 21061 4909542
GSS167 112938 70877522
GSS168 822 559311
GSS169 23226 28867035
GSS17 183523 113501533
GSS170 109043 70652585
GSS171 84533 34668223
GSS172 35815 22222733
GSS173 103304 62490220
GSS174 102329 63761256
GSS175 104268 67656826
GSS176 82099 41276456
GSS177 83102 54651503
GSS178 95673 61335435
GSS179 107323 78547443
GSS18 192358 114305774
GSS180 106375 76684757
GSS181 106058 79947480
GSS182 103996 80016519
GSS183 76374 51039123
GSS184 104572 63292187
GSS185 109868 66415305
GSS186 106205 59313311
GSS187 68379 37446344
GSS188 69561 38732329
GSS189 37157 17778905
GSS19 114075 52103409
GSS190 85481 46023427
GSS191 97119 55907586
GSS192 94982 49597190
GSS193 96286 55922591
GSS194 42132 23615490
GSS195 114638 43642267
GSS196 117085 39368203
GSS197 108676 55514545
GSS198 101471 78372335
GSS199 69893 44870648
GSS2 182294 92190539
GSS20 181789 101771260
GSS200 95891 36542252
GSS201 95417 37268709
GSS202 96671 35161518
GSS203 94285 39167432
GSS204 37736 17626556
GSS205 103939 66277823
GSS206 94551 61190929
GSS207 95128 60357048
GSS208 94773 60868501
GSS209 75675 70017159
GSS21 166208 114173594
GSS210 75117 74330280
GSS211 4473 7127270
GSS212 83736 28233267
GSS213 84219 27346468
GSS214 84926 25909272
GSS215 14851 4422302
GSS216 16547 7508221
GSS217 92648 59635081
GSS218 84624 52490775
GSS219 94061 50735685
GSS22 169506 97609042
GSS220 88579 48354065
GSS221 10731 5841916
GSS222 90648 56882510
GSS223 89662 61882079
GSS224 88553 63641206
GSS225 89283 62505584
GSS226 9890 7129098
GSS227 87995 63795538
GSS228 90217 62488977
GSS229 94639 59914104
GSS23 187251 126687349
GSS230 74309 63030713
GSS231 84243 78883806
GSS232 83030 80583817
GSS233 70509 52677201
GSS234 117650 64297121
GSS235 108874 55446727
GSS236 107533 52125503
GSS237 96658 43251344
GSS238 109801 49060015
GSS239 98194 46325477
GSS24 194057 130219707
GSS240 73059 72225597
GSS241 76682 71142435
GSS242 72980 46435649
GSS243 94787 57200301
GSS244 93517 59081345
GSS245 93900 58510429
GSS246 94714 57307691
GSS247 94279 58016121
GSS248 6701 3333254
GSS25 177481 105207105
GSS26 185918 107808246
GSS27 170600 151419573
GSS28 190494 146229226
GSS29 151147 106441309
GSS3 174947 87827711
GSS30 192446 132128206
GSS31 13634 8776287
GSS32 196044 127318947
GSS33 216659 116231837
GSS34 218573 113602417
GSS35 219720 112025390
GSS36 213958 121897898
GSS37 198560 156434224
GSS38 194991 146802885
GSS39 197241 73368303
GSS4 167154 85100900
GSS40 185065 97681837
GSS41 189783 125959643
GSS42 170343 158769399
GSS43 9054 5887224
GSS44 183999 100320381
GSS45 173032 121667203
GSS46 185089 124655109
GSS47 190835 122398633
GSS48 70733 62564650
GSS49 171799 101963548
GSS5 53443 31616565
GSS50 167647 103037030
GSS51 167798 102616122
GSS52 184194 121477291
GSS53 184774 116632196
GSS54 181686 122485290
GSS55 187531 113994336
GSS56 189392 134519036
GSS57 178947 104938173
GSS58 195715 120562907
GSS59 179925 133347062
GSS6 161617 84471320
GSS60 1898 1718384
GSS61 172844 138948397
GSS62 161635 111553347
GSS63 161673 111572480
GSS64 158827 107592995
GSS65 156768 129062324
GSS66 170185 142553826
GSS67 179844 117096102
GSS68 204911 127968663
GSS69 193332 110756601
GSS7 165323 79361698
GSS70 244049 126052608
GSS71 160171 106288253
GSS72 159383 119832589
GSS73 162663 124539385
GSS74 162629 124600629
GSS75 175123 108965694
GSS76 190294 140110654
GSS77 12990 7552045
GSS78 199135 126616367
GSS79 170370 111603100
GSS8 165782 88979927
GSS80 200718 131518447
GSS81 214948 86011305
GSS82 187080 100057507
GSS83 131104 91989085
GSS84 146939 117974637
GSS85 139562 116979023
GSS86 142823 114217730
GSS87 143960 119802766
GSS88 141946 115786817
GSS89 104815 87300351
GSS9 137999 67157686
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 63431 67180460
HTC11 62746 57492888
HTC12 66993 60073171
HTC13 68556 69499762
HTC14 20703 14108795
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 62355 78487812
HTG1 1318 188771164
HTG10 1298 186333849
HTG100 990 189440077
HTG101 996 189331054
HTG102 985 189419172
HTG103 1161 190563478
HTG104 30 4314892
HTG105 1087 189850160
HTG106 1044 189719158
HTG107 1389 191502319
HTG108 1296 190824903
HTG109 1617 191198960
HTG11 6 837687
HTG110 1367 191900638
HTG111 1298 192103378
HTG112 1292 190466082
HTG113 1091 190324774
HTG114 874 139597723
HTG115 1513 182381556
HTG116 992 192165745
HTG117 930 180610165
HTG118 1076 193680790
HTG119 1103 193010481
HTG12 1451 183826000
HTG120 223 41874974
HTG121 1028 189410054
HTG122 1055 192800345
HTG123 1163 191976448
HTG124 1083 192972209
HTG125 1084 193078263
HTG126 593 104617287
HTG127 1121 192542900
HTG128 1080 192285706
HTG129 1078 192289925
HTG13 875 191579912
HTG130 1164 192055711
HTG131 1170 192107893
HTG132 1080 192192754
HTG133 1052 192417640
HTG134 1144 191420090
HTG135 1471 187713161
HTG136 207 26918285
HTG14 753 192058598
HTG15 745 191952430
HTG16 786 192030578
HTG17 798 191859978
HTG18 775 192103394
HTG19 2069 170638342
HTG2 2470 186037380
HTG20 1096 187413748
HTG21 887 180042173
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190515178
HTG29 939 189964220
HTG3 2513 185208586
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189501635
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191697068
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2550 188439001
HTG40 1049 189067591
HTG41 1089 167537350
HTG42 1256 188119418
HTG43 1169 188010126
HTG44 1150 188080035
HTG45 1117 191232412
HTG46 1269 190645783
HTG47 1176 190820823
HTG48 1128 191224702
HTG49 1046 191244150
HTG5 1283 185453274
HTG50 1030 189619303
HTG51 1042 178756613
HTG52 968 190052338
HTG53 1105 190148899
HTG54 1046 190181725
HTG55 1014 189831932
HTG56 969 189170679
HTG57 81 14306584
HTG58 1010 189386550
HTG59 1031 189892226
HTG6 1273 185124562
HTG60 1076 187298961
HTG61 1126 188302580
HTG62 993 171883775
HTG63 1086 189624557
HTG64 1065 189501278
HTG65 1168 188823064
HTG66 1179 187455992
HTG67 1282 184472933
HTG68 93 12034677
HTG69 1221 185314622
HTG7 1276 185375030
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187688204
HTG73 1020 170303770
HTG74 1118 188293510
HTG75 1103 190775743
HTG76 1135 190787344
HTG77 1182 190871034
HTG78 1096 185997580
HTG79 1171 190202119
HTG8 1459 184608562
HTG80 1115 190062169
HTG81 1213 189874691
HTG82 1120 189645029
HTG83 959 164682536
HTG84 1228 188383308
HTG85 1251 187687552
HTG86 1141 189904095
HTG87 1144 189635018
HTG88 980 168283811
HTG89 1182 189963238
HTG9 1200 186916809
HTG90 1104 190233697
HTG91 1146 190150275
HTG92 1107 190418689
HTG93 968 160184166
HTG94 1056 190751264
HTG95 1161 191033671
HTG96 1031 189156227
HTG97 1071 189524206
HTG98 685 127675409
HTG99 1018 189641315
INV1 94144 48349738
INV10 83540 65303806
INV11 53919 42809424
INV12 84924 66270033
INV13 81125 67009184
INV14 78255 68214402
INV15 45398 41386316
INV16 34506 110908020
INV17 276 155680507
INV18 59042 93007979
INV19 74543 61586682
INV2 15300 164990220
INV20 73718 53757555
INV21 19668 12823368
INV22 55632 88070367
INV23 73037 47987586
INV24 73023 47887464
INV25 75265 52023459
INV26 72714 49199344
INV27 73215 49767584
INV28 70012 50105882
INV29 50059 83749336
INV3 1309 149154684
INV30 1153 8864014
INV4 16916 128360348
INV5 78530 72603515
INV6 54177 94853494
INV7 47329 82093600
INV8 80588 71782131
INV9 59348 85944714
MAM1 15193 162546587
MAM2 21280 155842912
MAM3 57523 84760862
MAM4 10256 180825870
MAM5 79556 74680090
MAM6 52858 118443848
MAM7 55127 44162793
PAT1 222547 70116852
PAT10 124492 102559129
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224731 34113482
PAT109 250080 15844362
PAT11 98580 64113533
PAT110 180680 63680037
PAT111 51647 26043244
PAT112 114191 110462189
PAT113 137704 83281015
PAT114 164154 99345808
PAT115 158877 103325984
PAT116 137417 114988187
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142065 62828791
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105888 59875034
PAT130 44618 171217879
PAT131 9167 47581637
PAT132 33645 178334734
PAT133 153558 109675196
PAT134 178705 90913377
PAT135 136049 115324159
PAT136 35501 10009256
PAT137 203662 47737230
PAT138 277828 9627968
PAT139 220409 46465135
PAT14 103650 50160806
PAT140 106719 2881142
PAT141 270386 21672571
PAT142 186752 61240505
PAT143 109802 106056534
PAT144 47514 9550017
PAT145 87300 88252619
PAT146 78467 95592643
PAT147 145221 77687807
PAT148 167503 71383908
PAT149 121471 92947696
PAT15 121150 53321659
PAT150 102962 85404157
PAT151 165548 45989168
PAT152 270022 5130418
PAT153 269978 5129582
PAT154 269978 5129582
PAT155 237888 4519872
PAT156 269396 5118524
PAT157 235715 25782943
PAT158 204521 46982512
PAT159 11011 386637
PAT16 113145 61277722
PAT160 165317 74871979
PAT161 91688 126658582
PAT162 172595 71660689
PAT163 137855 72262761
PAT164 9530 13980165
PAT165 93111 87244841
PAT166 91739 79911553
PAT167 83227 91467368
PAT168 118875 56039980
PAT169 97963 134992366
PAT17 39141 16227175
PAT170 162150 74817711
PAT171 211573 45132307
PAT18 146771 52594264
PAT19 153705 78039102
PAT2 194541 84646278
PAT20 104995 118172564
PAT21 133550 95503155
PAT22 84598 79322013
PAT23 123566 103406367
PAT24 119412 105655419
PAT25 145492 86671235
PAT26 175170 64298181
PAT27 71360 1784000
PAT28 102171 77387698
PAT29 93958 87647590
PAT3 171983 95893688
PAT30 119943 61672014
PAT31 96649 78966375
PAT32 128385 55033926
PAT33 92204 51115231
PAT34 111299 78151838
PAT35 138103 29119101
PAT36 158499 24085905
PAT37 114684 49015396
PAT38 44863 54579873
PAT39 95734 83197609
PAT4 153734 106066478
PAT40 100230 70978875
PAT41 136206 39303264
PAT42 143780 35446924
PAT43 123731 64746991
PAT44 104355 81197550
PAT45 93445 74211542
PAT46 113255 66591457
PAT47 65218 54831902
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57195 23949265
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92813 89405535
PAT59 106520 74781286
PAT6 170642 91909261
PAT60 122361 64031080
PAT61 67421 30296794
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154786 88238970
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131210 96924023
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94633 88060720
PAT83 93691 93465245
PAT84 34070 33980300
PAT85 83459 93185861
PAT86 15570 180450165
PAT87 164902 19209976
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129398 101135301
PAT90 175304 3330776
PAT91 101388 1926372
PAT92 169171 12412246
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140780 2674820
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6285 65412253
PLN1 59926 93463173
PLN10 37437 49341612
PLN11 40285 65707763
PLN12 22493 123983569
PLN13 21103 99490646
PLN14 17578 144865462
PLN15 17634 146278605
PLN16 17564 146392665
PLN17 24586 128622194
PLN18 6000 149205408
PLN19 1266 170315035
PLN2 35728 120161203
PLN20 14156 155895387
PLN21 7103 8352153
PLN22 67256 69764648
PLN23 29372 31563580
PLN24 76970 76380284
PLN25 65429 81414725
PLN26 44720 113937333
PLN27 34 75811684
PLN28 7 95178561
PLN29 3221 146999678
PLN3 1371 178659253
PLN30 24414 133234946
PLN31 60207 88077020
PLN32 76447 77202326
PLN33 87397 45935818
PLN34 80397 71718429
PLN35 77987 75766440
PLN36 80051 70462089
PLN37 82109 75758894
PLN38 56650 30132100
PLN39 101363 57273545
PLN4 1841 185795876
PLN40 80419 70242455
PLN41 45890 98809051
PLN42 29237 128557189
PLN43 35277 120369599
PLN44 39594 30838008
PLN45 81866 72101718
PLN46 63372 83724076
PLN47 82022 66220880
PLN48 96756 57370804
PLN49 75189 76065653
PLN5 1840 194252368
PLN50 67698 83505588
PLN51 12397 26712969
PLN6 1718 194388080
PLN7 41317 116818464
PLN8 57551 57229514
PLN9 73073 75872678
PRI1 23016 59646733
PRI10 1273 179328175
PRI11 772 93611734
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193666240
PRI18 1099 194310776
PRI19 1166 193657185
PRI2 18207 149518337
PRI20 1747 191731171
PRI21 2653 189798198
PRI22 19156 160472134
PRI23 1526 3656824
PRI24 31573 84616058
PRI25 61950 78204676
PRI26 31351 70630978
PRI27 8521 161714261
PRI28 2251 180515319
PRI29 1618 181509288
PRI3 1433 175223269
PRI30 2007 181705860
PRI31 1958 180727178
PRI32 13182 156344101
PRI33 1328 183749995
PRI34 41721 106651233
PRI35 22913 33113175
PRI36 32189 63608729
PRI37 20137 117669283
PRI38 18568 147184451
PRI39 66602 86841579
PRI4 1284 185574563
PRI40 49475 89694324
PRI41 39350 72157634
PRI42 49771 92743021
PRI43 60562 97712745
PRI44 93 1547959
PRI5 1322 184207047
PRI6 1182 180012329
PRI7 1246 181112619
PRI8 1212 178337989
PRI9 1366 174642897
ROD1 32272 140831988
ROD10 987 181481529
ROD11 232 44057446
ROD12 1034 185475616
ROD13 940 182703335
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185811349
ROD18 1190 190474838
ROD19 16713 146157502
ROD2 915 175393737
ROD20 20349 148361268
ROD21 1132 182075942
ROD22 1079 168068566
ROD23 13609 162595725
ROD24 38836 69261008
ROD25 21801 104569268
ROD26 1508 187778262
ROD27 135062 36437421
ROD28 84327 70409782
ROD29 43481 50200099
ROD3 905 173297900
ROD4 900 173792415
ROD5 923 174315076
ROD6 966 178209811
ROD7 968 179457909
ROD8 979 181267813
ROD9 994 181774273
STS1 85281 36762778
STS10 57907 44420267
STS11 48910 37503235
STS12 57924 43637361
STS13 64284 42850769
STS14 93606 34184225
STS15 104286 26517062
STS16 10116 2741066
STS17 103611 27476228
STS18 86930 34448685
STS19 99734 33367534
STS2 84354 49850361
STS20 54327 20642138
STS3 66846 26362713
STS4 76990 36946037
STS5 8457 4958885
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55716 37767321
SYN1 43101 76641817
SYN2 49307 68417061
SYN3 8164 18002166
TSA1 120505 38243959
TSA10 111305 38201579
TSA11 97415 30582150
TSA12 41714 15071160
TSA13 86486 70566494
TSA14 121991 38853496
TSA15 134870 35826510
TSA16 60982 79709095
TSA17 39421 53478178
TSA18 74910 95012391
TSA19 107699 49259264
TSA2 113528 41670793
TSA20 105562 50321458
TSA21 102874 54070302
TSA22 106086 46899520
TSA23 28507 19316896
TSA24 66573 59369298
TSA25 90220 62304560
TSA26 90402 75486281
TSA27 81331 74963187
TSA28 113013 34953409
TSA29 105599 51725635
TSA3 110398 41018342
TSA30 42865 35419439
TSA31 117006 42754122
TSA32 100254 55661219
TSA33 102697 54264987
TSA34 82809 85483158
TSA35 66108 27572755
TSA36 91228 72116539
TSA37 96017 56829726
TSA38 65386 106723497
TSA39 97261 72764134
TSA4 110952 45737441
TSA40 80699 75090547
TSA41 93445 82698736
TSA42 89317 71819141
TSA43 35296 23053697
TSA5 43145 10916057
TSA6 112460 59451131
TSA7 95611 66256273
TSA8 105745 68771636
TSA9 105926 64847592
UNA1 238 125011
VRL1 68456 68853819
VRL10 61385 72828120
VRL11 16049 23922693
VRL12 62819 71192980
VRL13 57847 72711571
VRL14 62759 65561568
VRL15 56962 73962654
VRL16 57698 72710846
VRL17 57150 71438600
VRL18 62138 70683914
VRL19 20576 20475260
VRL2 73586 64192857
VRL3 69358 61266502
VRL4 68345 69885400
VRL5 46501 48688636
VRL6 48252 77528882
VRL7 51386 72607834
VRL8 62400 72543180
VRL9 67883 66705120
VRT1 38667 128692952
VRT10 1256 189144082
VRT11 8274 177844568
VRT12 3994 136790703
VRT13 13095 170781188
VRT14 5350 182605112
VRT15 3936 186021840
VRT16 37670 134476492
VRT17 79828 68468972
VRT18 78414 66457916
VRT19 30221 24502651
VRT2 5181 187940109
VRT20 69852 80013325
VRT21 49052 117338288
VRT22 76227 63022804
VRT23 77350 58812938
VRT24 62726 46896308
VRT3 68572 82827797
VRT4 10471 167102341
VRT5 29179 23128761
VRT6 73012 66735777
VRT7 31732 63525748
VRT8 30652 111958169
VRT9 1202 189984871
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 186.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
19389131 15895544290 Homo sapiens
9297024 9123107910 Mus musculus
2187422 6506354371 Rattus norvegicus
2199230 5382894391 Bos taurus
3928465 5056774959 Zea mays
3226627 4818097747 Sus scrofa
1706623 3128271282 Danio rerio
228266 1352950153 Strongylocentrotus purpuratus
1347030 1253079650 Oryza sativa Japonica Group
1770217 1195170506 Nicotiana tabacum
1424329 1147240953 Xenopus (Silurana) tropicalis
2321408 1138974435 Arabidopsis thaliana
1225776 1062326437 Drosophila melanogaster
216415 1007768226 Pan troglodytes
749765 987556313 Vitis vinifera
1454888 948225965 Canis lupus familiaris
813456 898129282 Gallus gallus
1890259 895223341 Glycine max
82782 829872167 Macaca mulatta
738831 805901910 Solanum lycopersicum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 186.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 186.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Gert Roosen, Susan Schafer,
Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
