Release Notes For GenBank Release 186

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2011

               NCBI-GenBank Flat File Release 186.0

                    Distribution Release Notes

 144458648 loci, 132067413372 bases, from 144458648 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 186.0
1.2 Cutoff Date
1.3 Important Changes in Release 186.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 186.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 186.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 186.0, incorporates data available to the collaborating
databases as of October 13, 2011 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 186.0

1.3.1 Organizational changes

The total number of sequence data files increased by 23 with this release:

  - the BCT division is now composed of  77 files (+2)
  - the CON division is now composed of 152 files (+3)
  - the ENV division is now composed of  43 files (+1)
  - the EST division is now composed of 450 files (+3)
  - the HTC division is now composed of  14 files (-1)
  - the HTG division is now composed of 136 files (+1)
  - the INV division is now composed of  30 files (-1)
  - the PAT division is now composed of 171 files (+3)
  - the PLN division is now composed of  51 files (+1)
  - the PRI division is now composed of  44 files (+2)
  - the TSA division is now composed of  43 files (+8)
  - the VRL division is now composed of  19 files (+1)

The number of HTC division files decreased by one because nearly 37,000
high-throughput sequences for human cDNA clones were removed at the
submitter's request. 

The number of INV division files decreased by one because WGS project CABG01
has replaced approximately 19,000 (non-WGS) records for the Schistosoma mansoni
genome.

The total number of 'index' files increased by 2 with this release:

  - the AUT (author name) index is now composed of 91 files (+2)

1.3.2 New centromere and telomere features

  Telomeres and centromeres are essential features of chromosomes and
disrupting their structure affects the viability and life span of an
organism. Centromeric sequence varies from a compact, non-repetitive,
less than 150 base pair region in S. cerevisiae to a highly repetitive 
and complex region of several hundred thousands of base pairs in
eukaryote genomes. The sequence at the telomeric ends is unique compared
to the rest of the chromosome and protects the chromosome ends from
recombination, fusion to other chromosomes or degradation by nucleases.
Currently telomere and centromere features may be under-annotated since
there are no specific feature keys for them, hence the INSDC approved
the creation of two new features, which are now allowed as of the
October 15 2011 GenBank Release.

  These two features are intended for use when the centromere or telomere
have been actually been sequenced. These two new features are now legal as
of this GenBank Release 186.0 (October 15 2011).

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Feature Key          centromere

Definition           region of biological interest identified as a centromere
                     and which have been experimentally characterized

Optional qualifiers  /centromere_type=<centromere_type>
                     /citation=[number]
                     /db_xref="<database>:<identifier>"
                     /experiment="[CATEGORY:]text"
                     /inference="[CATEGORY:]TYPE[ (same species)][:EVIDENCE_BASIS]"
                     /note="text"
                     /standard_name="text"

Comment              the centromere feature describes the interval of DNA
                     that corresponds to a region where chromatids are held
                     and a kinetochore is formed

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Qualifier            /centromere_type=

Definition           type of centromere

Value format         point, regional

Example              /centromere_type=point

Comment              the values are case-insensitive, i.e. both "POINT" and
                     "point" are valid;

                     Definitions of the values:

                     regional : the DNA sequence consists of large arrays of
                     repetitive DNA, where the sequence of individual repeat
                     elements is similar but not identical

                     point : consist of well defined and conserved DNA
                     sequences that are sufficient to confirm centromere
                     identity and function

Important Note: The necessity of a /centromere_type qualifier is still under
discussion. If it is determined that the type can *always* be inferred based
on the organism alone (eg, 'point' for S. cerevisiae and 5 other budding yeasts,
'regional' for all other eukaryotes) then /centromere_type will not be
implemented.

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Feature Key          telomere

Definition           region of biological interest identified as a telomere
                     and which have been experimentally characterized

Optional qualifiers  /citation=[number]
                     /db_xref="<database>:<identifier>"
                     /experiment="[CATEGORY:]text"/note="text"
                     /inference="[CATEGORY:]TYPE[ (same species)][:EVIDENCE_BASIS]"
                     /note="text"
                     /rpt_unit_seq
                     /rpt_unit_range
                     /rpt_type
                     /standard_name="text"

Comment              the telomere feature describes the interval of DNA
                     that corresponds to a specific structure at the end of
                     the linear eukaryotic chromosome which is required for
                     the integrity and maintenance of the end; this region
                     is unique compared to the rest of the chromosome and
                     represents the physical end of the chromosome;

1.3.3 New assembly_gap feature, and /gap_type and /linkage_evidence qualifiers

  Complete genomes are often submitted to the INSDC via a small (or large)
set of independent sequence records, which can be assembled into chromosomes
and/or scaffolds. The CON-division records representing these scaffolds
and chromosomes are usually built using information provided in "AGP files"
provided by the submitter. See:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genome/assembly/agp/AGP_Update.shtml **

  The AGP 2.0 specification includes provisions for a variety of different
gap types, as well as information about whether a gap between two
scaffold or chromosome components is an unspanned gap or a spanned gap.
There is also biological gap-types: telomere, centromere and repeat.
AGP 2.0 also supports terminology to describe the type of evidence used
to establish the linkage connecting the components on either side of a
spanned gap within a scaffold or chromosome. Unfortunately, there is no
mechanism to represent any of this information in the Feature Table.

  To address this, the INSDC has decided to implement an assembly_gap
feature, and /gap_type and /linkage_evidence qualifiers, all of which
are now legal as of this October 15 2011 GenBank Release.

  The new centromere and telomere features (see Section 1.3.2) should 
only be used when the actual sequence of a centromere/telomere has been
determined. If this is not the case, then an assembly_gap feature with
a /gap_type of "centromere" or "telomere" should be used instead to 
indicate the locations of centromeres and telomeres within a genome
assembly.

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Feature Key          assembly_gap

Definition           gap between two components of a CON-division record that
                     is part of a genome assembly

Mandatory qualifiers /estimated_length=unknown or <integer>
                     /gap_type="TYPE"
                     /linkage_evidence="TYPE" (Note: Mandatory only if the
                       /gap_type is "within scaffold" or "repeat within scaffold"
                       For all other types of assembly_gap features, use of the
                       /linkage_evidence qualifier is invalid.)

Comment              the location span of the assembly_gap feature for an unknown
                     gap is 100 bp, with the 100 bp indicated as 100 "n"'s in the
                     sequence. Where estimated length is indicated by an integer,
                     this is indicated by the same number of "n"'s in the sequence.
                     No upper or lower limit is set on the size of the gap.

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Qualifier            /gap_type=TYPE

Definition           kind of gap connecting components in records of a genome
                     assembly, or the kind of biological gap in a record that
                     is part of a genome assembly

Value format         "between scaffolds", "within scaffold", "telomere",
                     "centromere", "short arm", "heterochromatin",
                     "repeat within scaffold", "repeat between scaffolds"

Example              /gap_type="between scaffolds"
                     /gap_type="within scaffold"

Comment              This qualifier is used only for assembly_gap features and
                     its values are controlled by the AGP Specification version 2.0:
                     http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genome/assembly/agp/AGP_Update.shtml **

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Qualifier            /linkage_evidence=TYPE

Definition           type of evidence establishing linkage across an assembly_gap.
                     Only allowed to be used with assembly_gap features that have
                     a /gap_type value of "within scaffold" or "repeat within scaffold"

Value format         "paired-ends", "align genus", "align xgenus", "align trnscpt",
                     "within clone", "clone contig", "map", "strobe", "unspecified"

Example              /linkage_evidence="paired-ends"
                     /linkage_evidence="within clone"

Comment              This qualifier is used only for assembly_gap features and its
                     values are controlled by the AGP Specification version 2.0
                     http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genome/assembly/agp/AGP_Update.shtml **

** The current URL for the AGP 2.0 specification is temporary. When a permanent link
   becomes available, the Feature Table will be updated accordingly.

  Although these new features and qualifiers are allowed as of Oct 15 2011,
it is unlikely that they will begin to appear on sequence records before
December 1st. However, users should begin preparing for them now, to prevent
processing problems later.

1.3.4 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.5 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 186.0. Consider gbgss146.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                         October 15 2011

                NCBI-GenBank Flat File Release 186.0

                           GSS Sequences (Part 1)

   87119 loci,    64001369 bases, from    87119 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "146" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

  There are no changes scheduled for implementation in the February 2012
GenBank Release.

  
1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1684 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbbct1.seq - Bacterial sequence entries, part 1.
96. gbbct10.seq - Bacterial sequence entries, part 10.
97. gbbct11.seq - Bacterial sequence entries, part 11.
98. gbbct12.seq - Bacterial sequence entries, part 12.
99. gbbct13.seq - Bacterial sequence entries, part 13.
100. gbbct14.seq - Bacterial sequence entries, part 14.
101. gbbct15.seq - Bacterial sequence entries, part 15.
102. gbbct16.seq - Bacterial sequence entries, part 16.
103. gbbct17.seq - Bacterial sequence entries, part 17.
104. gbbct18.seq - Bacterial sequence entries, part 18.
105. gbbct19.seq - Bacterial sequence entries, part 19.
106. gbbct2.seq - Bacterial sequence entries, part 2.
107. gbbct20.seq - Bacterial sequence entries, part 20.
108. gbbct21.seq - Bacterial sequence entries, part 21.
109. gbbct22.seq - Bacterial sequence entries, part 22.
110. gbbct23.seq - Bacterial sequence entries, part 23.
111. gbbct24.seq - Bacterial sequence entries, part 24.
112. gbbct25.seq - Bacterial sequence entries, part 25.
113. gbbct26.seq - Bacterial sequence entries, part 26.
114. gbbct27.seq - Bacterial sequence entries, part 27.
115. gbbct28.seq - Bacterial sequence entries, part 28.
116. gbbct29.seq - Bacterial sequence entries, part 29.
117. gbbct3.seq - Bacterial sequence entries, part 3.
118. gbbct30.seq - Bacterial sequence entries, part 30.
119. gbbct31.seq - Bacterial sequence entries, part 31.
120. gbbct32.seq - Bacterial sequence entries, part 32.
121. gbbct33.seq - Bacterial sequence entries, part 33.
122. gbbct34.seq - Bacterial sequence entries, part 34.
123. gbbct35.seq - Bacterial sequence entries, part 35.
124. gbbct36.seq - Bacterial sequence entries, part 36.
125. gbbct37.seq - Bacterial sequence entries, part 37.
126. gbbct38.seq - Bacterial sequence entries, part 38.
127. gbbct39.seq - Bacterial sequence entries, part 39.
128. gbbct4.seq - Bacterial sequence entries, part 4.
129. gbbct40.seq - Bacterial sequence entries, part 40.
130. gbbct41.seq - Bacterial sequence entries, part 41.
131. gbbct42.seq - Bacterial sequence entries, part 42.
132. gbbct43.seq - Bacterial sequence entries, part 43.
133. gbbct44.seq - Bacterial sequence entries, part 44.
134. gbbct45.seq - Bacterial sequence entries, part 45.
135. gbbct46.seq - Bacterial sequence entries, part 46.
136. gbbct47.seq - Bacterial sequence entries, part 47.
137. gbbct48.seq - Bacterial sequence entries, part 48.
138. gbbct49.seq - Bacterial sequence entries, part 49.
139. gbbct5.seq - Bacterial sequence entries, part 5.
140. gbbct50.seq - Bacterial sequence entries, part 50.
141. gbbct51.seq - Bacterial sequence entries, part 51.
142. gbbct52.seq - Bacterial sequence entries, part 52.
143. gbbct53.seq - Bacterial sequence entries, part 53.
144. gbbct54.seq - Bacterial sequence entries, part 54.
145. gbbct55.seq - Bacterial sequence entries, part 55.
146. gbbct56.seq - Bacterial sequence entries, part 56.
147. gbbct57.seq - Bacterial sequence entries, part 57.
148. gbbct58.seq - Bacterial sequence entries, part 58.
149. gbbct59.seq - Bacterial sequence entries, part 59.
150. gbbct6.seq - Bacterial sequence entries, part 6.
151. gbbct60.seq - Bacterial sequence entries, part 60.
152. gbbct61.seq - Bacterial sequence entries, part 61.
153. gbbct62.seq - Bacterial sequence entries, part 62.
154. gbbct63.seq - Bacterial sequence entries, part 63.
155. gbbct64.seq - Bacterial sequence entries, part 64.
156. gbbct65.seq - Bacterial sequence entries, part 65.
157. gbbct66.seq - Bacterial sequence entries, part 66.
158. gbbct67.seq - Bacterial sequence entries, part 67.
159. gbbct68.seq - Bacterial sequence entries, part 68.
160. gbbct69.seq - Bacterial sequence entries, part 69.
161. gbbct7.seq - Bacterial sequence entries, part 7.
162. gbbct70.seq - Bacterial sequence entries, part 70.
163. gbbct71.seq - Bacterial sequence entries, part 71.
164. gbbct72.seq - Bacterial sequence entries, part 72.
165. gbbct73.seq - Bacterial sequence entries, part 73.
166. gbbct74.seq - Bacterial sequence entries, part 74.
167. gbbct75.seq - Bacterial sequence entries, part 75.
168. gbbct76.seq - Bacterial sequence entries, part 76.
169. gbbct77.seq - Bacterial sequence entries, part 77.
170. gbbct8.seq - Bacterial sequence entries, part 8.
171. gbbct9.seq - Bacterial sequence entries, part 9.
172. gbchg.txt - Accession numbers of entries updated since the previous release.
173. gbcon1.seq - Constructed sequence entries, part 1.
174. gbcon10.seq - Constructed sequence entries, part 10.
175. gbcon100.seq - Constructed sequence entries, part 100.
176. gbcon101.seq - Constructed sequence entries, part 101.
177. gbcon102.seq - Constructed sequence entries, part 102.
178. gbcon103.seq - Constructed sequence entries, part 103.
179. gbcon104.seq - Constructed sequence entries, part 104.
180. gbcon105.seq - Constructed sequence entries, part 105.
181. gbcon106.seq - Constructed sequence entries, part 106.
182. gbcon107.seq - Constructed sequence entries, part 107.
183. gbcon108.seq - Constructed sequence entries, part 108.
184. gbcon109.seq - Constructed sequence entries, part 109.
185. gbcon11.seq - Constructed sequence entries, part 11.
186. gbcon110.seq - Constructed sequence entries, part 110.
187. gbcon111.seq - Constructed sequence entries, part 111.
188. gbcon112.seq - Constructed sequence entries, part 112.
189. gbcon113.seq - Constructed sequence entries, part 113.
190. gbcon114.seq - Constructed sequence entries, part 114.
191. gbcon115.seq - Constructed sequence entries, part 115.
192. gbcon116.seq - Constructed sequence entries, part 116.
193. gbcon117.seq - Constructed sequence entries, part 117.
194. gbcon118.seq - Constructed sequence entries, part 118.
195. gbcon119.seq - Constructed sequence entries, part 119.
196. gbcon12.seq - Constructed sequence entries, part 12.
197. gbcon120.seq - Constructed sequence entries, part 120.
198. gbcon121.seq - Constructed sequence entries, part 121.
199. gbcon122.seq - Constructed sequence entries, part 122.
200. gbcon123.seq - Constructed sequence entries, part 123.
201. gbcon124.seq - Constructed sequence entries, part 124.
202. gbcon125.seq - Constructed sequence entries, part 125.
203. gbcon126.seq - Constructed sequence entries, part 126.
204. gbcon127.seq - Constructed sequence entries, part 127.
205. gbcon128.seq - Constructed sequence entries, part 128.
206. gbcon129.seq - Constructed sequence entries, part 129.
207. gbcon13.seq - Constructed sequence entries, part 13.
208. gbcon130.seq - Constructed sequence entries, part 130.
209. gbcon131.seq - Constructed sequence entries, part 131.
210. gbcon132.seq - Constructed sequence entries, part 132.
211. gbcon133.seq - Constructed sequence entries, part 133.
212. gbcon134.seq - Constructed sequence entries, part 134.
213. gbcon135.seq - Constructed sequence entries, part 135.
214. gbcon136.seq - Constructed sequence entries, part 136.
215. gbcon137.seq - Constructed sequence entries, part 137.
216. gbcon138.seq - Constructed sequence entries, part 138.
217. gbcon139.seq - Constructed sequence entries, part 139.
218. gbcon14.seq - Constructed sequence entries, part 14.
219. gbcon140.seq - Constructed sequence entries, part 140.
220. gbcon141.seq - Constructed sequence entries, part 141.
221. gbcon142.seq - Constructed sequence entries, part 142.
222. gbcon143.seq - Constructed sequence entries, part 143.
223. gbcon144.seq - Constructed sequence entries, part 144.
224. gbcon145.seq - Constructed sequence entries, part 145.
225. gbcon146.seq - Constructed sequence entries, part 146.
226. gbcon147.seq - Constructed sequence entries, part 147.
227. gbcon148.seq - Constructed sequence entries, part 148.
228. gbcon149.seq - Constructed sequence entries, part 149.
229. gbcon15.seq - Constructed sequence entries, part 15.
230. gbcon150.seq - Constructed sequence entries, part 150.
231. gbcon151.seq - Constructed sequence entries, part 151.
232. gbcon152.seq - Constructed sequence entries, part 152.
233. gbcon16.seq - Constructed sequence entries, part 16.
234. gbcon17.seq - Constructed sequence entries, part 17.
235. gbcon18.seq - Constructed sequence entries, part 18.
236. gbcon19.seq - Constructed sequence entries, part 19.
237. gbcon2.seq - Constructed sequence entries, part 2.
238. gbcon20.seq - Constructed sequence entries, part 20.
239. gbcon21.seq - Constructed sequence entries, part 21.
240. gbcon22.seq - Constructed sequence entries, part 22.
241. gbcon23.seq - Constructed sequence entries, part 23.
242. gbcon24.seq - Constructed sequence entries, part 24.
243. gbcon25.seq - Constructed sequence entries, part 25.
244. gbcon26.seq - Constructed sequence entries, part 26.
245. gbcon27.seq - Constructed sequence entries, part 27.
246. gbcon28.seq - Constructed sequence entries, part 28.
247. gbcon29.seq - Constructed sequence entries, part 29.
248. gbcon3.seq - Constructed sequence entries, part 3.
249. gbcon30.seq - Constructed sequence entries, part 30.
250. gbcon31.seq - Constructed sequence entries, part 31.
251. gbcon32.seq - Constructed sequence entries, part 32.
252. gbcon33.seq - Constructed sequence entries, part 33.
253. gbcon34.seq - Constructed sequence entries, part 34.
254. gbcon35.seq - Constructed sequence entries, part 35.
255. gbcon36.seq - Constructed sequence entries, part 36.
256. gbcon37.seq - Constructed sequence entries, part 37.
257. gbcon38.seq - Constructed sequence entries, part 38.
258. gbcon39.seq - Constructed sequence entries, part 39.
259. gbcon4.seq - Constructed sequence entries, part 4.
260. gbcon40.seq - Constructed sequence entries, part 40.
261. gbcon41.seq - Constructed sequence entries, part 41.
262. gbcon42.seq - Constructed sequence entries, part 42.
263. gbcon43.seq - Constructed sequence entries, part 43.
264. gbcon44.seq - Constructed sequence entries, part 44.
265. gbcon45.seq - Constructed sequence entries, part 45.
266. gbcon46.seq - Constructed sequence entries, part 46.
267. gbcon47.seq - Constructed sequence entries, part 47.
268. gbcon48.seq - Constructed sequence entries, part 48.
269. gbcon49.seq - Constructed sequence entries, part 49.
270. gbcon5.seq - Constructed sequence entries, part 5.
271. gbcon50.seq - Constructed sequence entries, part 50.
272. gbcon51.seq - Constructed sequence entries, part 51.
273. gbcon52.seq - Constructed sequence entries, part 52.
274. gbcon53.seq - Constructed sequence entries, part 53.
275. gbcon54.seq - Constructed sequence entries, part 54.
276. gbcon55.seq - Constructed sequence entries, part 55.
277. gbcon56.seq - Constructed sequence entries, part 56.
278. gbcon57.seq - Constructed sequence entries, part 57.
279. gbcon58.seq - Constructed sequence entries, part 58.
280. gbcon59.seq - Constructed sequence entries, part 59.
281. gbcon6.seq - Constructed sequence entries, part 6.
282. gbcon60.seq - Constructed sequence entries, part 60.
283. gbcon61.seq - Constructed sequence entries, part 61.
284. gbcon62.seq - Constructed sequence entries, part 62.
285. gbcon63.seq - Constructed sequence entries, part 63.
286. gbcon64.seq - Constructed sequence entries, part 64.
287. gbcon65.seq - Constructed sequence entries, part 65.
288. gbcon66.seq - Constructed sequence entries, part 66.
289. gbcon67.seq - Constructed sequence entries, part 67.
290. gbcon68.seq - Constructed sequence entries, part 68.
291. gbcon69.seq - Constructed sequence entries, part 69.
292. gbcon7.seq - Constructed sequence entries, part 7.
293. gbcon70.seq - Constructed sequence entries, part 70.
294. gbcon71.seq - Constructed sequence entries, part 71.
295. gbcon72.seq - Constructed sequence entries, part 72.
296. gbcon73.seq - Constructed sequence entries, part 73.
297. gbcon74.seq - Constructed sequence entries, part 74.
298. gbcon75.seq - Constructed sequence entries, part 75.
299. gbcon76.seq - Constructed sequence entries, part 76.
300. gbcon77.seq - Constructed sequence entries, part 77.
301. gbcon78.seq - Constructed sequence entries, part 78.
302. gbcon79.seq - Constructed sequence entries, part 79.
303. gbcon8.seq - Constructed sequence entries, part 8.
304. gbcon80.seq - Constructed sequence entries, part 80.
305. gbcon81.seq - Constructed sequence entries, part 81.
306. gbcon82.seq - Constructed sequence entries, part 82.
307. gbcon83.seq - Constructed sequence entries, part 83.
308. gbcon84.seq - Constructed sequence entries, part 84.
309. gbcon85.seq - Constructed sequence entries, part 85.
310. gbcon86.seq - Constructed sequence entries, part 86.
311. gbcon87.seq - Constructed sequence entries, part 87.
312. gbcon88.seq - Constructed sequence entries, part 88.
313. gbcon89.seq - Constructed sequence entries, part 89.
314. gbcon9.seq - Constructed sequence entries, part 9.
315. gbcon90.seq - Constructed sequence entries, part 90.
316. gbcon91.seq - Constructed sequence entries, part 91.
317. gbcon92.seq - Constructed sequence entries, part 92.
318. gbcon93.seq - Constructed sequence entries, part 93.
319. gbcon94.seq - Constructed sequence entries, part 94.
320. gbcon95.seq - Constructed sequence entries, part 95.
321. gbcon96.seq - Constructed sequence entries, part 96.
322. gbcon97.seq - Constructed sequence entries, part 97.
323. gbcon98.seq - Constructed sequence entries, part 98.
324. gbcon99.seq - Constructed sequence entries, part 99.
325. gbdel.txt - Accession numbers of entries deleted since the previous release.
326. gbenv1.seq - Environmental sampling sequence entries, part 1.
327. gbenv10.seq - Environmental sampling sequence entries, part 10.
328. gbenv11.seq - Environmental sampling sequence entries, part 11.
329. gbenv12.seq - Environmental sampling sequence entries, part 12.
330. gbenv13.seq - Environmental sampling sequence entries, part 13.
331. gbenv14.seq - Environmental sampling sequence entries, part 14.
332. gbenv15.seq - Environmental sampling sequence entries, part 15.
333. gbenv16.seq - Environmental sampling sequence entries, part 16.
334. gbenv17.seq - Environmental sampling sequence entries, part 17.
335. gbenv18.seq - Environmental sampling sequence entries, part 18.
336. gbenv19.seq - Environmental sampling sequence entries, part 19.
337. gbenv2.seq - Environmental sampling sequence entries, part 2.
338. gbenv20.seq - Environmental sampling sequence entries, part 20.
339. gbenv21.seq - Environmental sampling sequence entries, part 21.
340. gbenv22.seq - Environmental sampling sequence entries, part 22.
341. gbenv23.seq - Environmental sampling sequence entries, part 23.
342. gbenv24.seq - Environmental sampling sequence entries, part 24.
343. gbenv25.seq - Environmental sampling sequence entries, part 25.
344. gbenv26.seq - Environmental sampling sequence entries, part 26.
345. gbenv27.seq - Environmental sampling sequence entries, part 27.
346. gbenv28.seq - Environmental sampling sequence entries, part 28.
347. gbenv29.seq - Environmental sampling sequence entries, part 29.
348. gbenv3.seq - Environmental sampling sequence entries, part 3.
349. gbenv30.seq - Environmental sampling sequence entries, part 30.
350. gbenv31.seq - Environmental sampling sequence entries, part 31.
351. gbenv32.seq - Environmental sampling sequence entries, part 32.
352. gbenv33.seq - Environmental sampling sequence entries, part 33.
353. gbenv34.seq - Environmental sampling sequence entries, part 34.
354. gbenv35.seq - Environmental sampling sequence entries, part 35.
355. gbenv36.seq - Environmental sampling sequence entries, part 36.
356. gbenv37.seq - Environmental sampling sequence entries, part 37.
357. gbenv38.seq - Environmental sampling sequence entries, part 38.
358. gbenv39.seq - Environmental sampling sequence entries, part 39.
359. gbenv4.seq - Environmental sampling sequence entries, part 4.
360. gbenv40.seq - Environmental sampling sequence entries, part 40.
361. gbenv41.seq - Environmental sampling sequence entries, part 41.
362. gbenv42.seq - Environmental sampling sequence entries, part 42.
363. gbenv43.seq - Environmental sampling sequence entries, part 43.
364. gbenv5.seq - Environmental sampling sequence entries, part 5.
365. gbenv6.seq - Environmental sampling sequence entries, part 6.
366. gbenv7.seq - Environmental sampling sequence entries, part 7.
367. gbenv8.seq - Environmental sampling sequence entries, part 8.
368. gbenv9.seq - Environmental sampling sequence entries, part 9.
369. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
370. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
371. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
372. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
373. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
374. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
375. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
376. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
377. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
378. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
379. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
380. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
381. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
382. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
383. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
384. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
385. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
386. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
387. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
388. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
389. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
390. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
391. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
392. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
393. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
394. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
395. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
396. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
397. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
398. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
399. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
400. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
401. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
402. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
403. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
404. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
405. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
406. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
407. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
408. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
409. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
410. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
411. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
412. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
413. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
414. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
415. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
416. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
417. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
418. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
419. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
420. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
421. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
422. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
423. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
424. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
425. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
426. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
427. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
428. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
429. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
430. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
431. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
432. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
433. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
434. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
435. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
436. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
437. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
438. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
439. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
440. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
441. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
442. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
443. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
444. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
445. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
446. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
447. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
448. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
449. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
450. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
451. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
452. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
453. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
454. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
455. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
456. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
457. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
458. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
459. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
460. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
461. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
462. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
463. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
464. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
465. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
466. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
467. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
468. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
469. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
470. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
471. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
472. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
473. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
474. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
475. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
476. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
477. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
478. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
479. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
480. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
481. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
482. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
483. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
484. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
485. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
486. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
487. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
488. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
489. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
490. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
491. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
492. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
493. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
494. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
495. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
496. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
497. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
498. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
499. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
500. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
501. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
502. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
503. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
504. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
505. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
506. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
507. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
508. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
509. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
510. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
511. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
512. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
513. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
514. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
515. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
516. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
517. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
518. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
519. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
520. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
521. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
522. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
523. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
524. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
525. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
526. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
527. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
528. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
529. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
530. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
531. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
532. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
533. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
534. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
535. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
536. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
537. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
538. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
539. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
540. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
541. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
542. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
543. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
544. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
545. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
546. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
547. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
548. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
549. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
550. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
551. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
552. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
553. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
554. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
555. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
556. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
557. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
558. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
559. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
560. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
561. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
562. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
563. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
564. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
565. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
566. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
567. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
568. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
569. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
570. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
571. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
572. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
573. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
574. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
575. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
576. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
577. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
578. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
579. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
580. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
581. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
582. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
583. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
584. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
585. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
586. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
587. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
588. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
589. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
590. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
591. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
592. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
593. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
594. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
595. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
596. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
597. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
598. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
599. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
600. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
601. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
602. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
603. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
604. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
605. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
606. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
607. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
608. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
609. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
610. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
611. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
612. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
613. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
614. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
615. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
616. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
617. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
618. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
619. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
620. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
621. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
622. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
623. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
624. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
625. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
626. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
627. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
628. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
629. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
630. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
631. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
632. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
633. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
634. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
635. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
636. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
637. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
638. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
639. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
640. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
641. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
642. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
643. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
644. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
645. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
646. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
647. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
648. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
649. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
650. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
651. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
652. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
653. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
654. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
655. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
656. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
657. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
658. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
659. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
660. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
661. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
662. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
663. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
664. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
665. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
666. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
667. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
668. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
669. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
670. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
671. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
672. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
673. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
674. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
675. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
676. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
677. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
678. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
679. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
680. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
681. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
682. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
683. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
684. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
685. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
686. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
687. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
688. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
689. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
690. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
691. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
692. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
693. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
694. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
695. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
696. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
697. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
698. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
699. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
700. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
701. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
702. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
703. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
704. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
705. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
706. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
707. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
708. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
709. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
710. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
711. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
712. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
713. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
714. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
715. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
716. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
717. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
718. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
719. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
720. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
721. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
722. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
723. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
724. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
725. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
726. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
727. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
728. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
729. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
730. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
731. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
732. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
733. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
734. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
735. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
736. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
737. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
738. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
739. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
740. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
741. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
742. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
743. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
744. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
745. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
746. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
747. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
748. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
749. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
750. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
751. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
752. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
753. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
754. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
755. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
756. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
757. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
758. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
759. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
760. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
761. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
762. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
763. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
764. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
765. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
766. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
767. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
768. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
769. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
770. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
771. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
772. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
773. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
774. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
775. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
776. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
777. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
778. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
779. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
780. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
781. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
782. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
783. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
784. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
785. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
786. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
787. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
788. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
789. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
790. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
791. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
792. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
793. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
794. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
795. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
796. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
797. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
798. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
799. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
800. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
801. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
802. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
803. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
804. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
805. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
806. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
807. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
808. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
809. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
810. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
811. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
812. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
813. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
814. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
815. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
816. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
817. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
818. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
819. gbgen.idx - Index of the entries according to gene symbols.
820. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
821. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
822. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
823. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
824. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
825. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
826. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
827. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
828. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
829. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
830. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
831. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
832. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
833. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
834. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
835. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
836. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
837. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
838. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
839. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
840. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
841. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
842. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
843. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
844. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
845. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
846. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
847. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
848. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
849. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
850. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
851. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
852. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
853. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
854. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
855. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
856. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
857. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
858. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
859. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
860. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
861. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
862. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
863. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
864. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
865. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
866. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
867. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
868. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
869. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
870. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
871. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
872. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
873. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
874. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
875. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
876. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
877. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
878. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
879. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
880. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
881. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
882. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
883. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
884. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
885. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
886. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
887. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
888. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
889. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
890. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
891. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
892. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
893. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
894. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
895. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
896. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
897. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
898. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
899. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
900. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
901. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
902. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
903. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
904. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
905. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
906. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
907. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
908. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
909. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
910. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
911. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
912. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
913. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
914. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
915. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
916. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
917. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
918. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
919. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
920. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
921. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
922. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
923. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
924. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
925. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
926. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
927. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
928. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
929. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
930. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
931. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
932. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
933. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
934. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
935. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
936. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
937. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
938. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
939. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
940. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
941. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
942. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
943. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
944. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
945. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
946. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
947. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
948. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
949. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
950. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
951. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
952. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
953. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
954. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
955. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
956. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
957. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
958. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
959. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
960. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
961. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
962. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
963. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
964. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
965. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
966. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
967. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
968. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
969. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
970. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
971. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
972. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
973. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
974. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
975. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
976. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
977. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
978. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
979. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
980. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
981. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
982. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
983. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
984. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
985. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
986. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
987. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
988. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
989. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
990. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
991. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
992. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
993. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
994. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
995. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
996. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
997. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
998. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
999. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1000. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1001. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1002. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1003. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1004. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1005. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1006. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1007. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1008. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1009. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1010. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1011. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1012. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1013. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1014. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1015. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1016. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1017. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1018. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1019. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1020. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1021. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1022. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1023. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1024. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1025. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1026. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1027. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1028. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1029. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1030. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1031. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1032. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1033. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1034. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1035. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1036. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1037. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1038. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1039. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1040. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1041. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1042. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1043. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1044. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1045. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1046. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1047. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1048. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1049. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1050. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1051. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1052. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1053. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1054. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1055. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1056. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1057. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1058. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1059. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1060. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1061. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1062. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1063. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1064. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1065. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1066. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1067. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1068. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1069. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1070. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1071. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1072. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1073. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1074. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1075. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1076. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1077. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1078. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1079. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1080. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1081. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1082. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1083. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1084. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1085. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1086. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1087. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1088. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1089. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1090. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1091. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1092. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1093. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1094. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1095. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1096. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1097. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1098. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1099. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1100. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1101. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1102. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1103. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1104. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1105. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1106. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1107. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1108. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1109. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1110. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1111. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1112. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1113. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1114. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1115. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1116. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1117. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1118. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1119. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1120. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1121. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1122. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1123. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1124. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1125. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1126. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1127. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1128. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1129. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1130. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1131. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1132. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1133. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1134. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1135. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1136. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1137. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1138. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1139. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1140. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1141. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1142. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1143. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1144. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1145. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1146. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1147. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1148. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1149. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1150. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1151. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1152. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1153. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1154. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1155. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1156. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1157. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1158. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1159. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1160. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1161. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1162. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1163. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1164. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1165. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1166. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1167. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1168. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1169. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1170. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1171. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1172. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1173. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1174. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1175. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1176. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1177. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1178. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1179. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1180. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1181. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1182. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1183. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1184. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1185. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1186. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1187. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1188. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1189. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1190. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1191. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1192. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1193. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1194. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1195. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1196. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1197. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1198. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1199. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1200. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1201. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1202. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1203. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1204. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1205. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1206. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1207. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1208. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1209. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1210. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1211. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1212. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1213. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1214. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1215. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1216. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1217. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1218. gbinv1.seq - Invertebrate sequence entries, part 1.
1219. gbinv10.seq - Invertebrate sequence entries, part 10.
1220. gbinv11.seq - Invertebrate sequence entries, part 11.
1221. gbinv12.seq - Invertebrate sequence entries, part 12.
1222. gbinv13.seq - Invertebrate sequence entries, part 13.
1223. gbinv14.seq - Invertebrate sequence entries, part 14.
1224. gbinv15.seq - Invertebrate sequence entries, part 15.
1225. gbinv16.seq - Invertebrate sequence entries, part 16.
1226. gbinv17.seq - Invertebrate sequence entries, part 17.
1227. gbinv18.seq - Invertebrate sequence entries, part 18.
1228. gbinv19.seq - Invertebrate sequence entries, part 19.
1229. gbinv2.seq - Invertebrate sequence entries, part 2.
1230. gbinv20.seq - Invertebrate sequence entries, part 20.
1231. gbinv21.seq - Invertebrate sequence entries, part 21.
1232. gbinv22.seq - Invertebrate sequence entries, part 22.
1233. gbinv23.seq - Invertebrate sequence entries, part 23.
1234. gbinv24.seq - Invertebrate sequence entries, part 24.
1235. gbinv25.seq - Invertebrate sequence entries, part 25.
1236. gbinv26.seq - Invertebrate sequence entries, part 26.
1237. gbinv27.seq - Invertebrate sequence entries, part 27.
1238. gbinv28.seq - Invertebrate sequence entries, part 28.
1239. gbinv29.seq - Invertebrate sequence entries, part 29.
1240. gbinv3.seq - Invertebrate sequence entries, part 3.
1241. gbinv30.seq - Invertebrate sequence entries, part 30.
1242. gbinv4.seq - Invertebrate sequence entries, part 4.
1243. gbinv5.seq - Invertebrate sequence entries, part 5.
1244. gbinv6.seq - Invertebrate sequence entries, part 6.
1245. gbinv7.seq - Invertebrate sequence entries, part 7.
1246. gbinv8.seq - Invertebrate sequence entries, part 8.
1247. gbinv9.seq - Invertebrate sequence entries, part 9.
1248. gbjou1.idx - Index of the entries according to journal citation, part 1.
1249. gbjou10.idx - Index of the entries according to journal citation, part 10.
1250. gbjou11.idx - Index of the entries according to journal citation, part 11.
1251. gbjou12.idx - Index of the entries according to journal citation, part 12.
1252. gbjou2.idx - Index of the entries according to journal citation, part 2.
1253. gbjou3.idx - Index of the entries according to journal citation, part 3.
1254. gbjou4.idx - Index of the entries according to journal citation, part 4.
1255. gbjou5.idx - Index of the entries according to journal citation, part 5.
1256. gbjou6.idx - Index of the entries according to journal citation, part 6.
1257. gbjou7.idx - Index of the entries according to journal citation, part 7.
1258. gbjou8.idx - Index of the entries according to journal citation, part 8.
1259. gbjou9.idx - Index of the entries according to journal citation, part 9.
1260. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1261. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1262. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1263. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1264. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1265. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1266. gbmam1.seq - Other mammalian sequence entries, part 1.
1267. gbmam2.seq - Other mammalian sequence entries, part 2.
1268. gbmam3.seq - Other mammalian sequence entries, part 3.
1269. gbmam4.seq - Other mammalian sequence entries, part 4.
1270. gbmam5.seq - Other mammalian sequence entries, part 5.
1271. gbmam6.seq - Other mammalian sequence entries, part 6.
1272. gbmam7.seq - Other mammalian sequence entries, part 7.
1273. gbnew.txt - Accession numbers of entries new since the previous release.
1274. gbpat1.seq - Patent sequence entries, part 1.
1275. gbpat10.seq - Patent sequence entries, part 10.
1276. gbpat100.seq - Patent sequence entries, part 100.
1277. gbpat101.seq - Patent sequence entries, part 101.
1278. gbpat102.seq - Patent sequence entries, part 102.
1279. gbpat103.seq - Patent sequence entries, part 103.
1280. gbpat104.seq - Patent sequence entries, part 104.
1281. gbpat105.seq - Patent sequence entries, part 105.
1282. gbpat106.seq - Patent sequence entries, part 106.
1283. gbpat107.seq - Patent sequence entries, part 107.
1284. gbpat108.seq - Patent sequence entries, part 108.
1285. gbpat109.seq - Patent sequence entries, part 109.
1286. gbpat11.seq - Patent sequence entries, part 11.
1287. gbpat110.seq - Patent sequence entries, part 110.
1288. gbpat111.seq - Patent sequence entries, part 111.
1289. gbpat112.seq - Patent sequence entries, part 112.
1290. gbpat113.seq - Patent sequence entries, part 113.
1291. gbpat114.seq - Patent sequence entries, part 114.
1292. gbpat115.seq - Patent sequence entries, part 115.
1293. gbpat116.seq - Patent sequence entries, part 116.
1294. gbpat117.seq - Patent sequence entries, part 117.
1295. gbpat118.seq - Patent sequence entries, part 118.
1296. gbpat119.seq - Patent sequence entries, part 119.
1297. gbpat12.seq - Patent sequence entries, part 12.
1298. gbpat120.seq - Patent sequence entries, part 120.
1299. gbpat121.seq - Patent sequence entries, part 121.
1300. gbpat122.seq - Patent sequence entries, part 122.
1301. gbpat123.seq - Patent sequence entries, part 123.
1302. gbpat124.seq - Patent sequence entries, part 124.
1303. gbpat125.seq - Patent sequence entries, part 125.
1304. gbpat126.seq - Patent sequence entries, part 126.
1305. gbpat127.seq - Patent sequence entries, part 127.
1306. gbpat128.seq - Patent sequence entries, part 128.
1307. gbpat129.seq - Patent sequence entries, part 129.
1308. gbpat13.seq - Patent sequence entries, part 13.
1309. gbpat130.seq - Patent sequence entries, part 130.
1310. gbpat131.seq - Patent sequence entries, part 131.
1311. gbpat132.seq - Patent sequence entries, part 132.
1312. gbpat133.seq - Patent sequence entries, part 133.
1313. gbpat134.seq - Patent sequence entries, part 134.
1314. gbpat135.seq - Patent sequence entries, part 135.
1315. gbpat136.seq - Patent sequence entries, part 136.
1316. gbpat137.seq - Patent sequence entries, part 137.
1317. gbpat138.seq - Patent sequence entries, part 138.
1318. gbpat139.seq - Patent sequence entries, part 139.
1319. gbpat14.seq - Patent sequence entries, part 14.
1320. gbpat140.seq - Patent sequence entries, part 140.
1321. gbpat141.seq - Patent sequence entries, part 141.
1322. gbpat142.seq - Patent sequence entries, part 142.
1323. gbpat143.seq - Patent sequence entries, part 143.
1324. gbpat144.seq - Patent sequence entries, part 144.
1325. gbpat145.seq - Patent sequence entries, part 145.
1326. gbpat146.seq - Patent sequence entries, part 146.
1327. gbpat147.seq - Patent sequence entries, part 147.
1328. gbpat148.seq - Patent sequence entries, part 148.
1329. gbpat149.seq - Patent sequence entries, part 149.
1330. gbpat15.seq - Patent sequence entries, part 15.
1331. gbpat150.seq - Patent sequence entries, part 150.
1332. gbpat151.seq - Patent sequence entries, part 151.
1333. gbpat152.seq - Patent sequence entries, part 152.
1334. gbpat153.seq - Patent sequence entries, part 153.
1335. gbpat154.seq - Patent sequence entries, part 154.
1336. gbpat155.seq - Patent sequence entries, part 155.
1337. gbpat156.seq - Patent sequence entries, part 156.
1338. gbpat157.seq - Patent sequence entries, part 157.
1339. gbpat158.seq - Patent sequence entries, part 158.
1340. gbpat159.seq - Patent sequence entries, part 159.
1341. gbpat16.seq - Patent sequence entries, part 16.
1342. gbpat160.seq - Patent sequence entries, part 160.
1343. gbpat161.seq - Patent sequence entries, part 161.
1344. gbpat162.seq - Patent sequence entries, part 162.
1345. gbpat163.seq - Patent sequence entries, part 163.
1346. gbpat164.seq - Patent sequence entries, part 164.
1347. gbpat165.seq - Patent sequence entries, part 165.
1348. gbpat166.seq - Patent sequence entries, part 166.
1349. gbpat167.seq - Patent sequence entries, part 167.
1350. gbpat168.seq - Patent sequence entries, part 168.
1351. gbpat169.seq - Patent sequence entries, part 169.
1352. gbpat17.seq - Patent sequence entries, part 17.
1353. gbpat170.seq - Patent sequence entries, part 170.
1354. gbpat171.seq - Patent sequence entries, part 171.
1355. gbpat18.seq - Patent sequence entries, part 18.
1356. gbpat19.seq - Patent sequence entries, part 19.
1357. gbpat2.seq - Patent sequence entries, part 2.
1358. gbpat20.seq - Patent sequence entries, part 20.
1359. gbpat21.seq - Patent sequence entries, part 21.
1360. gbpat22.seq - Patent sequence entries, part 22.
1361. gbpat23.seq - Patent sequence entries, part 23.
1362. gbpat24.seq - Patent sequence entries, part 24.
1363. gbpat25.seq - Patent sequence entries, part 25.
1364. gbpat26.seq - Patent sequence entries, part 26.
1365. gbpat27.seq - Patent sequence entries, part 27.
1366. gbpat28.seq - Patent sequence entries, part 28.
1367. gbpat29.seq - Patent sequence entries, part 29.
1368. gbpat3.seq - Patent sequence entries, part 3.
1369. gbpat30.seq - Patent sequence entries, part 30.
1370. gbpat31.seq - Patent sequence entries, part 31.
1371. gbpat32.seq - Patent sequence entries, part 32.
1372. gbpat33.seq - Patent sequence entries, part 33.
1373. gbpat34.seq - Patent sequence entries, part 34.
1374. gbpat35.seq - Patent sequence entries, part 35.
1375. gbpat36.seq - Patent sequence entries, part 36.
1376. gbpat37.seq - Patent sequence entries, part 37.
1377. gbpat38.seq - Patent sequence entries, part 38.
1378. gbpat39.seq - Patent sequence entries, part 39.
1379. gbpat4.seq - Patent sequence entries, part 4.
1380. gbpat40.seq - Patent sequence entries, part 40.
1381. gbpat41.seq - Patent sequence entries, part 41.
1382. gbpat42.seq - Patent sequence entries, part 42.
1383. gbpat43.seq - Patent sequence entries, part 43.
1384. gbpat44.seq - Patent sequence entries, part 44.
1385. gbpat45.seq - Patent sequence entries, part 45.
1386. gbpat46.seq - Patent sequence entries, part 46.
1387. gbpat47.seq - Patent sequence entries, part 47.
1388. gbpat48.seq - Patent sequence entries, part 48.
1389. gbpat49.seq - Patent sequence entries, part 49.
1390. gbpat5.seq - Patent sequence entries, part 5.
1391. gbpat50.seq - Patent sequence entries, part 50.
1392. gbpat51.seq - Patent sequence entries, part 51.
1393. gbpat52.seq - Patent sequence entries, part 52.
1394. gbpat53.seq - Patent sequence entries, part 53.
1395. gbpat54.seq - Patent sequence entries, part 54.
1396. gbpat55.seq - Patent sequence entries, part 55.
1397. gbpat56.seq - Patent sequence entries, part 56.
1398. gbpat57.seq - Patent sequence entries, part 57.
1399. gbpat58.seq - Patent sequence entries, part 58.
1400. gbpat59.seq - Patent sequence entries, part 59.
1401. gbpat6.seq - Patent sequence entries, part 6.
1402. gbpat60.seq - Patent sequence entries, part 60.
1403. gbpat61.seq - Patent sequence entries, part 61.
1404. gbpat62.seq - Patent sequence entries, part 62.
1405. gbpat63.seq - Patent sequence entries, part 63.
1406. gbpat64.seq - Patent sequence entries, part 64.
1407. gbpat65.seq - Patent sequence entries, part 65.
1408. gbpat66.seq - Patent sequence entries, part 66.
1409. gbpat67.seq - Patent sequence entries, part 67.
1410. gbpat68.seq - Patent sequence entries, part 68.
1411. gbpat69.seq - Patent sequence entries, part 69.
1412. gbpat7.seq - Patent sequence entries, part 7.
1413. gbpat70.seq - Patent sequence entries, part 70.
1414. gbpat71.seq - Patent sequence entries, part 71.
1415. gbpat72.seq - Patent sequence entries, part 72.
1416. gbpat73.seq - Patent sequence entries, part 73.
1417. gbpat74.seq - Patent sequence entries, part 74.
1418. gbpat75.seq - Patent sequence entries, part 75.
1419. gbpat76.seq - Patent sequence entries, part 76.
1420. gbpat77.seq - Patent sequence entries, part 77.
1421. gbpat78.seq - Patent sequence entries, part 78.
1422. gbpat79.seq - Patent sequence entries, part 79.
1423. gbpat8.seq - Patent sequence entries, part 8.
1424. gbpat80.seq - Patent sequence entries, part 80.
1425. gbpat81.seq - Patent sequence entries, part 81.
1426. gbpat82.seq - Patent sequence entries, part 82.
1427. gbpat83.seq - Patent sequence entries, part 83.
1428. gbpat84.seq - Patent sequence entries, part 84.
1429. gbpat85.seq - Patent sequence entries, part 85.
1430. gbpat86.seq - Patent sequence entries, part 86.
1431. gbpat87.seq - Patent sequence entries, part 87.
1432. gbpat88.seq - Patent sequence entries, part 88.
1433. gbpat89.seq - Patent sequence entries, part 89.
1434. gbpat9.seq - Patent sequence entries, part 9.
1435. gbpat90.seq - Patent sequence entries, part 90.
1436. gbpat91.seq - Patent sequence entries, part 91.
1437. gbpat92.seq - Patent sequence entries, part 92.
1438. gbpat93.seq - Patent sequence entries, part 93.
1439. gbpat94.seq - Patent sequence entries, part 94.
1440. gbpat95.seq - Patent sequence entries, part 95.
1441. gbpat96.seq - Patent sequence entries, part 96.
1442. gbpat97.seq - Patent sequence entries, part 97.
1443. gbpat98.seq - Patent sequence entries, part 98.
1444. gbpat99.seq - Patent sequence entries, part 99.
1445. gbphg1.seq - Phage sequence entries, part 1.
1446. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1447. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1448. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1449. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1450. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1451. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1452. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1453. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1454. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1455. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1456. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1457. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1458. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1459. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1460. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1461. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1462. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1463. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1464. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1465. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1466. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1467. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1468. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1469. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1470. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1471. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1472. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1473. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1474. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1475. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1476. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1477. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1478. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1479. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1480. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1481. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1482. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1483. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1484. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1485. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1486. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1487. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1488. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1489. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1490. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1491. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1492. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1493. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1494. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1495. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1496. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1497. gbpri1.seq - Primate sequence entries, part 1.
1498. gbpri10.seq - Primate sequence entries, part 10.
1499. gbpri11.seq - Primate sequence entries, part 11.
1500. gbpri12.seq - Primate sequence entries, part 12.
1501. gbpri13.seq - Primate sequence entries, part 13.
1502. gbpri14.seq - Primate sequence entries, part 14.
1503. gbpri15.seq - Primate sequence entries, part 15.
1504. gbpri16.seq - Primate sequence entries, part 16.
1505. gbpri17.seq - Primate sequence entries, part 17.
1506. gbpri18.seq - Primate sequence entries, part 18.
1507. gbpri19.seq - Primate sequence entries, part 19.
1508. gbpri2.seq - Primate sequence entries, part 2.
1509. gbpri20.seq - Primate sequence entries, part 20.
1510. gbpri21.seq - Primate sequence entries, part 21.
1511. gbpri22.seq - Primate sequence entries, part 22.
1512. gbpri23.seq - Primate sequence entries, part 23.
1513. gbpri24.seq - Primate sequence entries, part 24.
1514. gbpri25.seq - Primate sequence entries, part 25.
1515. gbpri26.seq - Primate sequence entries, part 26.
1516. gbpri27.seq - Primate sequence entries, part 27.
1517. gbpri28.seq - Primate sequence entries, part 28.
1518. gbpri29.seq - Primate sequence entries, part 29.
1519. gbpri3.seq - Primate sequence entries, part 3.
1520. gbpri30.seq - Primate sequence entries, part 30.
1521. gbpri31.seq - Primate sequence entries, part 31.
1522. gbpri32.seq - Primate sequence entries, part 32.
1523. gbpri33.seq - Primate sequence entries, part 33.
1524. gbpri34.seq - Primate sequence entries, part 34.
1525. gbpri35.seq - Primate sequence entries, part 35.
1526. gbpri36.seq - Primate sequence entries, part 36.
1527. gbpri37.seq - Primate sequence entries, part 37.
1528. gbpri38.seq - Primate sequence entries, part 38.
1529. gbpri39.seq - Primate sequence entries, part 39.
1530. gbpri4.seq - Primate sequence entries, part 4.
1531. gbpri40.seq - Primate sequence entries, part 40.
1532. gbpri41.seq - Primate sequence entries, part 41.
1533. gbpri42.seq - Primate sequence entries, part 42.
1534. gbpri43.seq - Primate sequence entries, part 43.
1535. gbpri44.seq - Primate sequence entries, part 44.
1536. gbpri5.seq - Primate sequence entries, part 5.
1537. gbpri6.seq - Primate sequence entries, part 6.
1538. gbpri7.seq - Primate sequence entries, part 7.
1539. gbpri8.seq - Primate sequence entries, part 8.
1540. gbpri9.seq - Primate sequence entries, part 9.
1541. gbrel.txt - Release notes (this document).
1542. gbrod1.seq - Rodent sequence entries, part 1.
1543. gbrod10.seq - Rodent sequence entries, part 10.
1544. gbrod11.seq - Rodent sequence entries, part 11.
1545. gbrod12.seq - Rodent sequence entries, part 12.
1546. gbrod13.seq - Rodent sequence entries, part 13.
1547. gbrod14.seq - Rodent sequence entries, part 14.
1548. gbrod15.seq - Rodent sequence entries, part 15.
1549. gbrod16.seq - Rodent sequence entries, part 16.
1550. gbrod17.seq - Rodent sequence entries, part 17.
1551. gbrod18.seq - Rodent sequence entries, part 18.
1552. gbrod19.seq - Rodent sequence entries, part 19.
1553. gbrod2.seq - Rodent sequence entries, part 2.
1554. gbrod20.seq - Rodent sequence entries, part 20.
1555. gbrod21.seq - Rodent sequence entries, part 21.
1556. gbrod22.seq - Rodent sequence entries, part 22.
1557. gbrod23.seq - Rodent sequence entries, part 23.
1558. gbrod24.seq - Rodent sequence entries, part 24.
1559. gbrod25.seq - Rodent sequence entries, part 25.
1560. gbrod26.seq - Rodent sequence entries, part 26.
1561. gbrod27.seq - Rodent sequence entries, part 27.
1562. gbrod28.seq - Rodent sequence entries, part 28.
1563. gbrod29.seq - Rodent sequence entries, part 29.
1564. gbrod3.seq - Rodent sequence entries, part 3.
1565. gbrod4.seq - Rodent sequence entries, part 4.
1566. gbrod5.seq - Rodent sequence entries, part 5.
1567. gbrod6.seq - Rodent sequence entries, part 6.
1568. gbrod7.seq - Rodent sequence entries, part 7.
1569. gbrod8.seq - Rodent sequence entries, part 8.
1570. gbrod9.seq - Rodent sequence entries, part 9.
1571. gbsdr1.txt - Short directory of the data bank, part 1.
1572. gbsdr2.txt - Short directory of the data bank, part 2.
1573. gbsdr3.txt - Short directory of the data bank, part 3.
1574. gbsec.idx - Index of the entries according to secondary accession number.
1575. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1576. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1577. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1578. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1579. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1580. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1581. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1582. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1583. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1584. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1585. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1586. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1587. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1588. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1589. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1590. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1591. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1592. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1593. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1594. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1595. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1596. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1597. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1598. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1599. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1600. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1601. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1602. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1603. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1604. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1605. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1606. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1607. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1608. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1609. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1610. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1611. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1612. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1613. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1614. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1615. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1616. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1617. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1618. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1619. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1620. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1621. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1622. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1623. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1624. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1625. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1626. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1627. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1628. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1629. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1630. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1631. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1632. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1633. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1634. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1635. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1636. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1637. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1638. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1639. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1640. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1641. gbuna1.seq - Unannotated sequence entries, part 1.
1642. gbvrl1.seq - Viral sequence entries, part 1.
1643. gbvrl10.seq - Viral sequence entries, part 10.
1644. gbvrl11.seq - Viral sequence entries, part 11.
1645. gbvrl12.seq - Viral sequence entries, part 12.
1646. gbvrl13.seq - Viral sequence entries, part 13.
1647. gbvrl14.seq - Viral sequence entries, part 14.
1648. gbvrl15.seq - Viral sequence entries, part 15.
1649. gbvrl16.seq - Viral sequence entries, part 16.
1650. gbvrl17.seq - Viral sequence entries, part 17.
1651. gbvrl18.seq - Viral sequence entries, part 18.
1652. gbvrl19.seq - Viral sequence entries, part 19.
1653. gbvrl2.seq - Viral sequence entries, part 2.
1654. gbvrl3.seq - Viral sequence entries, part 3.
1655. gbvrl4.seq - Viral sequence entries, part 4.
1656. gbvrl5.seq - Viral sequence entries, part 5.
1657. gbvrl6.seq - Viral sequence entries, part 6.
1658. gbvrl7.seq - Viral sequence entries, part 7.
1659. gbvrl8.seq - Viral sequence entries, part 8.
1660. gbvrl9.seq - Viral sequence entries, part 9.
1661. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1662. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1663. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1664. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1665. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1666. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1667. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1668. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1669. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1670. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1671. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1672. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1673. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1674. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1675. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1676. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1677. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1678. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1679. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1680. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1681. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1682. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1683. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1684. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 186.0 flatfiles require roughly 518 GB (sequence
files only) or 557 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1836988688     gbacc1.idx
2341553643     gbacc2.idx
 801914922     gbacc3.idx
 188677816     gbaut1.idx
 184345008     gbaut10.idx
 240689912     gbaut11.idx
 183796184     gbaut12.idx
 183909435     gbaut13.idx
 183672835     gbaut14.idx
 183871449     gbaut15.idx
 184000865     gbaut16.idx
 184720820     gbaut17.idx
 202128846     gbaut18.idx
 188805120     gbaut19.idx
 226836902     gbaut2.idx
 183846401     gbaut20.idx
 186616559     gbaut21.idx
 236131163     gbaut22.idx
 210420690     gbaut23.idx
 185943470     gbaut24.idx
 184377590     gbaut25.idx
 185503510     gbaut26.idx
 186639886     gbaut27.idx
 184412480     gbaut28.idx
 183902391     gbaut29.idx
 212688225     gbaut3.idx
 205811945     gbaut30.idx
 217543066     gbaut31.idx
 183939073     gbaut32.idx
 184057017     gbaut33.idx
 184263408     gbaut34.idx
 183896739     gbaut35.idx
 188972984     gbaut36.idx
 239161204     gbaut37.idx
 185573330     gbaut38.idx
 185428948     gbaut39.idx
 183932104     gbaut4.idx
 190493820     gbaut40.idx
 186072654     gbaut41.idx
 194676404     gbaut42.idx
 235169604     gbaut43.idx
 190152713     gbaut44.idx
 196768626     gbaut45.idx
 186725629     gbaut46.idx
 184196260     gbaut47.idx
 185080615     gbaut48.idx
 188211532     gbaut49.idx
 211628840     gbaut5.idx
 184157264     gbaut50.idx
 233953914     gbaut51.idx
 185428704     gbaut52.idx
 183829644     gbaut53.idx
 196440268     gbaut54.idx
 200975384     gbaut55.idx
 184233358     gbaut56.idx
 185643519     gbaut57.idx
 185142280     gbaut58.idx
 184710171     gbaut59.idx
 189765694     gbaut6.idx
 190198562     gbaut60.idx
 187022556     gbaut61.idx
 192301729     gbaut62.idx
 185333435     gbaut63.idx
 186892428     gbaut64.idx
 184618378     gbaut65.idx
 183880128     gbaut66.idx
 184437911     gbaut67.idx
 184036570     gbaut68.idx
 187405916     gbaut69.idx
 187170170     gbaut7.idx
 187258336     gbaut70.idx
 184849342     gbaut71.idx
 202676810     gbaut72.idx
 184323117     gbaut73.idx
 248707612     gbaut74.idx
 183926073     gbaut75.idx
 185737231     gbaut76.idx
 187245307     gbaut77.idx
 183902477     gbaut78.idx
 213946902     gbaut79.idx
 191917334     gbaut8.idx
 186256727     gbaut80.idx
 213866540     gbaut81.idx
 204994253     gbaut82.idx
 190173443     gbaut83.idx
 184712376     gbaut84.idx
 185053989     gbaut85.idx
 212431707     gbaut86.idx
 185718157     gbaut87.idx
 192265478     gbaut88.idx
 201250208     gbaut89.idx
 185527943     gbaut9.idx
 184407942     gbaut90.idx
 173123926     gbaut91.idx
 245958065     gbbct1.seq
 243883372     gbbct10.seq
 247600630     gbbct11.seq
 247739748     gbbct12.seq
  86621187     gbbct13.seq
 243121258     gbbct14.seq
 249783378     gbbct15.seq
 245549915     gbbct16.seq
 248628237     gbbct17.seq
 248244259     gbbct18.seq
 249285374     gbbct19.seq
 244174428     gbbct2.seq
 246200686     gbbct20.seq
 245695766     gbbct21.seq
 217808715     gbbct22.seq
 242806498     gbbct23.seq
 241843495     gbbct24.seq
 248678472     gbbct25.seq
 247877968     gbbct26.seq
 249389971     gbbct27.seq
 244188196     gbbct28.seq
 247136189     gbbct29.seq
 247138812     gbbct3.seq
 249999634     gbbct30.seq
 249762398     gbbct31.seq
 249791675     gbbct32.seq
 242939612     gbbct33.seq
 243142268     gbbct34.seq
 149271812     gbbct35.seq
 243876513     gbbct36.seq
 246112838     gbbct37.seq
 242769096     gbbct38.seq
 239637752     gbbct39.seq
 244905202     gbbct4.seq
 247213064     gbbct40.seq
 246865504     gbbct41.seq
 245887041     gbbct42.seq
 244941925     gbbct43.seq
 248039357     gbbct44.seq
 249505839     gbbct45.seq
 243631846     gbbct46.seq
 117766347     gbbct47.seq
 245585578     gbbct48.seq
 246900859     gbbct49.seq
 187866534     gbbct5.seq
 243975128     gbbct50.seq
 248203697     gbbct51.seq
 248860905     gbbct52.seq
 246442439     gbbct53.seq
 243071397     gbbct54.seq
 244494175     gbbct55.seq
 243337674     gbbct56.seq
 242455962     gbbct57.seq
 238701011     gbbct58.seq
 238162696     gbbct59.seq
 242126470     gbbct6.seq
  43717604     gbbct60.seq
   6887368     gbbct61.seq
  14093174     gbbct62.seq
  23158271     gbbct63.seq
  45090217     gbbct64.seq
  87758866     gbbct65.seq
 169951015     gbbct66.seq
 250000241     gbbct67.seq
 249999260     gbbct68.seq
 248355331     gbbct69.seq
 247361938     gbbct7.seq
 239229757     gbbct70.seq
 249773560     gbbct71.seq
 247251841     gbbct72.seq
 249722037     gbbct73.seq
 249998405     gbbct74.seq
 250000225     gbbct75.seq
 249999641     gbbct76.seq
 227545820     gbbct77.seq
 247175707     gbbct8.seq
 244861409     gbbct9.seq
  12007351     gbchg.txt
 249999381     gbcon1.seq
 249996514     gbcon10.seq
 249995660     gbcon100.seq
 249998605     gbcon101.seq
 249998936     gbcon102.seq
 250000223     gbcon103.seq
 156342446     gbcon104.seq
 249996812     gbcon105.seq
 249993767     gbcon106.seq
 249992301     gbcon107.seq
 249998322     gbcon108.seq
  71615782     gbcon109.seq
 249997306     gbcon11.seq
 249997862     gbcon110.seq
 249998650     gbcon111.seq
 208522809     gbcon112.seq
 250000256     gbcon113.seq
 250000098     gbcon114.seq
 249995503     gbcon115.seq
 249706532     gbcon116.seq
 149700445     gbcon117.seq
 249914315     gbcon118.seq
 249998866     gbcon119.seq
 248436817     gbcon12.seq
 179894056     gbcon120.seq
 249997285     gbcon121.seq
 250000110     gbcon122.seq
 249999490     gbcon123.seq
 249225574     gbcon124.seq
  21073904     gbcon125.seq
 249998180     gbcon126.seq
 249965234     gbcon127.seq
 249704347     gbcon128.seq
 249994924     gbcon129.seq
 247344550     gbcon13.seq
 249997859     gbcon130.seq
 177486331     gbcon131.seq
 249999839     gbcon132.seq
 249985338     gbcon133.seq
 249819716     gbcon134.seq
 249993762     gbcon135.seq
 249999846     gbcon136.seq
 248313325     gbcon137.seq
 250000042     gbcon138.seq
 249995170     gbcon139.seq
 249997550     gbcon14.seq
 159567680     gbcon140.seq
 249994092     gbcon141.seq
 249995878     gbcon142.seq
 249847073     gbcon143.seq
 250000188     gbcon144.seq
 249982669     gbcon145.seq
 249998911     gbcon146.seq
 249998095     gbcon147.seq
 249988435     gbcon148.seq
 249998562     gbcon149.seq
  77626717     gbcon15.seq
 249999746     gbcon150.seq
 126917907     gbcon151.seq
  18852786     gbcon152.seq
 249998119     gbcon16.seq
 249998839     gbcon17.seq
 241153400     gbcon18.seq
 250000143     gbcon19.seq
 249654446     gbcon2.seq
 248022413     gbcon20.seq
 122899681     gbcon21.seq
 249998511     gbcon22.seq
 120044016     gbcon23.seq
 249996870     gbcon24.seq
 249946702     gbcon25.seq
 249999165     gbcon26.seq
 249999892     gbcon27.seq
 186019801     gbcon28.seq
 249999799     gbcon29.seq
 249767877     gbcon3.seq
 249997310     gbcon30.seq
 249999856     gbcon31.seq
 249999952     gbcon32.seq
 247968343     gbcon33.seq
 232547195     gbcon34.seq
 249999237     gbcon35.seq
 249996869     gbcon36.seq
 249995921     gbcon37.seq
 249996351     gbcon38.seq
 249999450     gbcon39.seq
 249980011     gbcon4.seq
 249997210     gbcon40.seq
  61183731     gbcon41.seq
 249997486     gbcon42.seq
 249994070     gbcon43.seq
 249999391     gbcon44.seq
 249997743     gbcon45.seq
 249994859     gbcon46.seq
  43089049     gbcon47.seq
 249993995     gbcon48.seq
 249996310     gbcon49.seq
 249994359     gbcon5.seq
 249994442     gbcon50.seq
 249997248     gbcon51.seq
 250000078     gbcon52.seq
  36404971     gbcon53.seq
 249993185     gbcon54.seq
 249998119     gbcon55.seq
 249995170     gbcon56.seq
 249998154     gbcon57.seq
 249998078     gbcon58.seq
 152679523     gbcon59.seq
 249990922     gbcon6.seq
 249999955     gbcon60.seq
 249999066     gbcon61.seq
 249997558     gbcon62.seq
 249998625     gbcon63.seq
 183609322     gbcon64.seq
 249999870     gbcon65.seq
 249997967     gbcon66.seq
 249997138     gbcon67.seq
 249995207     gbcon68.seq
 245488804     gbcon69.seq
 249994251     gbcon7.seq
 250000182     gbcon70.seq
 249998695     gbcon71.seq
 249998372     gbcon72.seq
 249996966     gbcon73.seq
 250000007     gbcon74.seq
  96627683     gbcon75.seq
 249993448     gbcon76.seq
 249995119     gbcon77.seq
 249997383     gbcon78.seq
 249995948     gbcon79.seq
   1242649     gbcon8.seq
 249999042     gbcon80.seq
  62682749     gbcon81.seq
 249997771     gbcon82.seq
 249996653     gbcon83.seq
 249999445     gbcon84.seq
 249999590     gbcon85.seq
 249998149     gbcon86.seq
  21674116     gbcon87.seq
 249998140     gbcon88.seq
 249997503     gbcon89.seq
 249997708     gbcon9.seq
 249996940     gbcon90.seq
 249995720     gbcon91.seq
 197881888     gbcon92.seq
 249993974     gbcon93.seq
 249996060     gbcon94.seq
 249999726     gbcon95.seq
 249998645     gbcon96.seq
 249996901     gbcon97.seq
 133265984     gbcon98.seq
 249994222     gbcon99.seq
   1036411     gbdel.txt
 250000234     gbenv1.seq
 249998769     gbenv10.seq
  55644397     gbenv11.seq
 249992833     gbenv12.seq
 249998792     gbenv13.seq
 249998193     gbenv14.seq
 249997092     gbenv15.seq
 249999093     gbenv16.seq
 250000027     gbenv17.seq
 242453510     gbenv18.seq
 249999792     gbenv19.seq
 249951517     gbenv2.seq
 249998664     gbenv20.seq
 249999862     gbenv21.seq
 249999391     gbenv22.seq
 126984021     gbenv23.seq
 249998342     gbenv24.seq
 249998788     gbenv25.seq
 250000224     gbenv26.seq
 250000205     gbenv27.seq
 249998027     gbenv28.seq
  98691680     gbenv29.seq
 249998522     gbenv3.seq
 249998069     gbenv30.seq
 249999189     gbenv31.seq
 249999448     gbenv32.seq
 249999649     gbenv33.seq
 133772226     gbenv34.seq
 249996865     gbenv35.seq
 249999040     gbenv36.seq
 249996907     gbenv37.seq
 249998531     gbenv38.seq
 249999081     gbenv39.seq
 250000191     gbenv4.seq
 249999344     gbenv40.seq
 249997376     gbenv41.seq
 249998278     gbenv42.seq
  15275522     gbenv43.seq
 249997787     gbenv5.seq
 199828395     gbenv6.seq
 249998474     gbenv7.seq
 249999164     gbenv8.seq
 249998663     gbenv9.seq
 524292008     gbest1.seq
 524289074     gbest10.seq
 524288778     gbest100.seq
 524288833     gbest101.seq
 524290452     gbest102.seq
 524288973     gbest103.seq
 355880285     gbest104.seq
 524290739     gbest105.seq
 524290766     gbest106.seq
 497549721     gbest107.seq
 388466620     gbest108.seq
 387583252     gbest109.seq
 524290873     gbest11.seq
 383134801     gbest110.seq
 384255866     gbest111.seq
 384330768     gbest112.seq
 381681060     gbest113.seq
 391876539     gbest114.seq
 387828747     gbest115.seq
 386115234     gbest116.seq
 384278538     gbest117.seq
 411752507     gbest118.seq
 524288776     gbest119.seq
 524291034     gbest12.seq
 524288945     gbest120.seq
 524290906     gbest121.seq
 524289142     gbest122.seq
 524289615     gbest123.seq
 464132445     gbest124.seq
 524291745     gbest125.seq
 524291580     gbest126.seq
 524289399     gbest127.seq
 524291046     gbest128.seq
 524291345     gbest129.seq
 156625823     gbest13.seq
 524289232     gbest130.seq
 524290348     gbest131.seq
 524291728     gbest132.seq
 524289021     gbest133.seq
 524291691     gbest134.seq
 524290085     gbest135.seq
 524290315     gbest136.seq
 273120700     gbest137.seq
 524289576     gbest138.seq
 524290808     gbest139.seq
 524289059     gbest14.seq
 524288732     gbest140.seq
 524289869     gbest141.seq
 524291732     gbest142.seq
 524292557     gbest143.seq
 524291158     gbest144.seq
 524292949     gbest145.seq
 524290150     gbest146.seq
 524290120     gbest147.seq
 524292630     gbest148.seq
 524288875     gbest149.seq
 524290761     gbest15.seq
 524290754     gbest150.seq
 477323442     gbest151.seq
 524291481     gbest152.seq
 524288755     gbest153.seq
 524290806     gbest154.seq
 524291159     gbest155.seq
 524290648     gbest156.seq
 524290244     gbest157.seq
 524288933     gbest158.seq
 524288965     gbest159.seq
 524289293     gbest16.seq
 498875804     gbest160.seq
 524291138     gbest161.seq
 524291204     gbest162.seq
 524290931     gbest163.seq
 246717351     gbest164.seq
 524291394     gbest165.seq
 524292589     gbest166.seq
 524289569     gbest167.seq
 524292460     gbest168.seq
 524289782     gbest169.seq
 524290890     gbest17.seq
 524290136     gbest170.seq
 524290499     gbest171.seq
 524289348     gbest172.seq
 524290943     gbest173.seq
 524289934     gbest174.seq
 524290947     gbest175.seq
 524292201     gbest176.seq
 524289113     gbest177.seq
  99504677     gbest178.seq
 524289321     gbest179.seq
 524290478     gbest18.seq
 524289070     gbest180.seq
 524289276     gbest181.seq
 524289413     gbest182.seq
 524288916     gbest183.seq
 524289640     gbest184.seq
 524291362     gbest185.seq
 524292174     gbest186.seq
 524289861     gbest187.seq
 524291086     gbest188.seq
 524295553     gbest189.seq
 524289798     gbest19.seq
 524289916     gbest190.seq
 456269322     gbest191.seq
 524292122     gbest192.seq
 524294602     gbest193.seq
 524289274     gbest194.seq
 524290484     gbest195.seq
 524296357     gbest196.seq
 524291748     gbest197.seq
 524290059     gbest198.seq
 524289088     gbest199.seq
 524289694     gbest2.seq
 524288894     gbest20.seq
 524291323     gbest200.seq
 524291154     gbest201.seq
 524289224     gbest202.seq
 524290647     gbest203.seq
 524289566     gbest204.seq
  96681995     gbest205.seq
 524289515     gbest206.seq
 524291512     gbest207.seq
 524289488     gbest208.seq
 524289590     gbest209.seq
 524290258     gbest21.seq
 524289505     gbest210.seq
 524289825     gbest211.seq
 524292125     gbest212.seq
 524289680     gbest213.seq
 524289985     gbest214.seq
 524290341     gbest215.seq
 429113346     gbest216.seq
 524291220     gbest217.seq
 524289160     gbest218.seq
 524290688     gbest219.seq
 511736959     gbest22.seq
 524289647     gbest220.seq
 524289531     gbest221.seq
 524289998     gbest222.seq
 524289219     gbest223.seq
 524289797     gbest224.seq
 524289922     gbest225.seq
 524292471     gbest226.seq
 524289597     gbest227.seq
 524292597     gbest228.seq
 524291497     gbest229.seq
 500420432     gbest23.seq
 374265867     gbest230.seq
 524291984     gbest231.seq
 524290729     gbest232.seq
 524289568     gbest233.seq
 524290083     gbest234.seq
 524289654     gbest235.seq
 524289219     gbest236.seq
 524292092     gbest237.seq
 524289348     gbest238.seq
 524288912     gbest239.seq
 509313832     gbest24.seq
 524290398     gbest240.seq
 524291444     gbest241.seq
 524291240     gbest242.seq
 524292170     gbest243.seq
 524290007     gbest244.seq
  49717216     gbest245.seq
 524288791     gbest246.seq
 524289055     gbest247.seq
 524288976     gbest248.seq
 524289062     gbest249.seq
 320074347     gbest25.seq
 524289204     gbest250.seq
 524290815     gbest251.seq
 524290794     gbest252.seq
 524289386     gbest253.seq
 524291087     gbest254.seq
 524291625     gbest255.seq
 524290910     gbest256.seq
 238733254     gbest257.seq
 524290229     gbest258.seq
 524289476     gbest259.seq
 524289651     gbest26.seq
 524289258     gbest260.seq
 524290220     gbest261.seq
 524289730     gbest262.seq
 524291816     gbest263.seq
 524290013     gbest264.seq
 524290437     gbest265.seq
 524292138     gbest266.seq
 524291611     gbest267.seq
 288389840     gbest268.seq
 524289868     gbest269.seq
 524290384     gbest27.seq
 524289317     gbest270.seq
 524291183     gbest271.seq
 524289421     gbest272.seq
 524288893     gbest273.seq
 524290367     gbest274.seq
 524292375     gbest275.seq
 524289005     gbest276.seq
 524290987     gbest277.seq
 524288984     gbest278.seq
 524289432     gbest279.seq
 524289573     gbest28.seq
 295075726     gbest280.seq
 524292218     gbest281.seq
 524291705     gbest282.seq
 524289206     gbest283.seq
 524289937     gbest284.seq
 524290162     gbest285.seq
 524290187     gbest286.seq
 524289634     gbest287.seq
 524290540     gbest288.seq
 524289289     gbest289.seq
 524291648     gbest29.seq
 524291358     gbest290.seq
 524291217     gbest291.seq
 230436031     gbest292.seq
 524290421     gbest293.seq
 524290362     gbest294.seq
 524290162     gbest295.seq
 524291478     gbest296.seq
 524290585     gbest297.seq
 524291045     gbest298.seq
 524291256     gbest299.seq
 497701912     gbest3.seq
 524289197     gbest30.seq
 524290554     gbest300.seq
 479536031     gbest301.seq
 485177448     gbest302.seq
 486568728     gbest303.seq
 314612459     gbest304.seq
 524290941     gbest305.seq
 524289808     gbest306.seq
 524291283     gbest307.seq
 524293446     gbest308.seq
 524290053     gbest309.seq
 524289971     gbest31.seq
 524289827     gbest310.seq
 524289698     gbest311.seq
 524288824     gbest312.seq
 524292863     gbest313.seq
 524290363     gbest314.seq
 524290255     gbest315.seq
 524290308     gbest316.seq
 512634022     gbest317.seq
 524289440     gbest318.seq
 524290224     gbest319.seq
 524291802     gbest32.seq
 524290144     gbest320.seq
 524290214     gbest321.seq
 524292228     gbest322.seq
 524288981     gbest323.seq
 524289590     gbest324.seq
 524288851     gbest325.seq
 524290837     gbest326.seq
 524289506     gbest327.seq
 524290648     gbest328.seq
 524289402     gbest329.seq
 524290891     gbest33.seq
 524291426     gbest330.seq
 265779956     gbest331.seq
 524290600     gbest332.seq
 524289381     gbest333.seq
 524289853     gbest334.seq
 524293392     gbest335.seq
 524291417     gbest336.seq
 524290174     gbest337.seq
 524290738     gbest338.seq
 524292471     gbest339.seq
 519168849     gbest34.seq
 524288832     gbest340.seq
 524290663     gbest341.seq
 524291863     gbest342.seq
 524290557     gbest343.seq
 524292140     gbest344.seq
 342955890     gbest345.seq
 524291567     gbest346.seq
 524290674     gbest347.seq
 524289259     gbest348.seq
 524289297     gbest349.seq
 492713599     gbest35.seq
 524289847     gbest350.seq
 524291289     gbest351.seq
 524292525     gbest352.seq
 524289193     gbest353.seq
 524291674     gbest354.seq
 524289217     gbest355.seq
 524288924     gbest356.seq
 524291845     gbest357.seq
 524288754     gbest358.seq
 503825700     gbest359.seq
 494456277     gbest36.seq
 524289502     gbest360.seq
 524288833     gbest361.seq
 524292104     gbest362.seq
 524289321     gbest363.seq
 524291060     gbest364.seq
 524289246     gbest365.seq
 524289037     gbest366.seq
 524291454     gbest367.seq
 524290225     gbest368.seq
 524289377     gbest369.seq
 493350210     gbest37.seq
 462310508     gbest370.seq
 524290811     gbest371.seq
 524291642     gbest372.seq
 524289514     gbest373.seq
 524289698     gbest374.seq
 524290929     gbest375.seq
 524289136     gbest376.seq
 510621282     gbest377.seq
 524290677     gbest378.seq
 524290408     gbest379.seq
 487986033     gbest38.seq
 524290567     gbest380.seq
 524290213     gbest381.seq
 243237228     gbest382.seq
 524290778     gbest383.seq
 524290239     gbest384.seq
 524289060     gbest385.seq
 524291267     gbest386.seq
 524288726     gbest387.seq
 524289527     gbest388.seq
 524289637     gbest389.seq
 493314905     gbest39.seq
 524289697     gbest390.seq
 524290037     gbest391.seq
 524291445     gbest392.seq
 524288996     gbest393.seq
 351887099     gbest394.seq
 524288812     gbest395.seq
 524289154     gbest396.seq
 524289586     gbest397.seq
 524292554     gbest398.seq
 524289098     gbest399.seq
 524288944     gbest4.seq
 113124437     gbest40.seq
 524291905     gbest400.seq
 524291795     gbest401.seq
 524291180     gbest402.seq
 524289445     gbest403.seq
 524290474     gbest404.seq
 524289349     gbest405.seq
 524291301     gbest406.seq
 448368085     gbest407.seq
 524290058     gbest408.seq
 524291154     gbest409.seq
 524289314     gbest41.seq
 524292958     gbest410.seq
 524292414     gbest411.seq
 524290839     gbest412.seq
 524291860     gbest413.seq
 524289118     gbest414.seq
 524288764     gbest415.seq
 524288830     gbest416.seq
 524288966     gbest417.seq
 524289857     gbest418.seq
 524291419     gbest419.seq
 524291610     gbest42.seq
 524291902     gbest420.seq
 524290764     gbest421.seq
  31705988     gbest422.seq
 524289516     gbest423.seq
 524291737     gbest424.seq
 524289042     gbest425.seq
 524290517     gbest426.seq
 524292362     gbest427.seq
 524288825     gbest428.seq
 524288779     gbest429.seq
 524290507     gbest43.seq
 524289873     gbest430.seq
 524291757     gbest431.seq
 524289928     gbest432.seq
 524290320     gbest433.seq
 524289948     gbest434.seq
 495238432     gbest435.seq
 524291543     gbest436.seq
 524289057     gbest437.seq
 524289109     gbest438.seq
 524290724     gbest439.seq
 524289688     gbest44.seq
 524290428     gbest440.seq
 524289054     gbest441.seq
 524290571     gbest442.seq
 524292352     gbest443.seq
 524291127     gbest444.seq
 524288886     gbest445.seq
 524289208     gbest446.seq
 365664905     gbest447.seq
 524289187     gbest448.seq
 524291274     gbest449.seq
 524290948     gbest45.seq
 267580033     gbest450.seq
 524291044     gbest46.seq
 524291229     gbest47.seq
 524290748     gbest48.seq
 524291292     gbest49.seq
 524289625     gbest5.seq
 524289713     gbest50.seq
 524290962     gbest51.seq
 524290660     gbest52.seq
 524290374     gbest53.seq
 272208245     gbest54.seq
 524290953     gbest55.seq
 524289827     gbest56.seq
 524290438     gbest57.seq
 524290438     gbest58.seq
 524289001     gbest59.seq
 524288762     gbest6.seq
 524290645     gbest60.seq
 524289866     gbest61.seq
 524290309     gbest62.seq
 524288857     gbest63.seq
 524289558     gbest64.seq
 524290265     gbest65.seq
 524292797     gbest66.seq
 464722319     gbest67.seq
 524290606     gbest68.seq
 524290843     gbest69.seq
 524290789     gbest7.seq
 524289260     gbest70.seq
 524290256     gbest71.seq
 524290468     gbest72.seq
 524289907     gbest73.seq
 524292321     gbest74.seq
 524289970     gbest75.seq
 524289923     gbest76.seq
 524289851     gbest77.seq
 524290180     gbest78.seq
 524290649     gbest79.seq
 524289317     gbest8.seq
 203954566     gbest80.seq
 524289591     gbest81.seq
 524289366     gbest82.seq
 524289171     gbest83.seq
 524291302     gbest84.seq
 524289470     gbest85.seq
 524291414     gbest86.seq
 524290335     gbest87.seq
 524291416     gbest88.seq
 524290818     gbest89.seq
 524292211     gbest9.seq
 524291137     gbest90.seq
 524292099     gbest91.seq
 448416560     gbest92.seq
 524288741     gbest93.seq
 524290991     gbest94.seq
 524289485     gbest95.seq
 524289150     gbest96.seq
 524288878     gbest97.seq
 524292054     gbest98.seq
 524290750     gbest99.seq
 169885408     gbgen.idx
 524288964     gbgss1.seq
 524291442     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524290642     gbgss103.seq
 418359951     gbgss104.seq
 524290801     gbgss105.seq
 524290943     gbgss106.seq
 524290652     gbgss107.seq
 524289339     gbgss108.seq
 524289785     gbgss109.seq
 524292161     gbgss11.seq
 524291091     gbgss110.seq
 524290077     gbgss111.seq
 524289903     gbgss112.seq
 524290560     gbgss113.seq
 524290818     gbgss114.seq
 524289833     gbgss115.seq
  55545257     gbgss116.seq
 524289667     gbgss117.seq
 524288912     gbgss118.seq
 524288723     gbgss119.seq
 524289997     gbgss12.seq
 524290440     gbgss120.seq
 524290549     gbgss121.seq
 524289653     gbgss122.seq
 524291736     gbgss123.seq
 524291481     gbgss124.seq
 524289727     gbgss125.seq
 524289147     gbgss126.seq
 524290900     gbgss127.seq
 524290264     gbgss128.seq
 231414286     gbgss129.seq
 524288852     gbgss13.seq
 524288892     gbgss130.seq
 524290941     gbgss131.seq
 524288773     gbgss132.seq
 524289898     gbgss133.seq
 524289884     gbgss134.seq
 524290213     gbgss135.seq
 524289102     gbgss136.seq
 524292138     gbgss137.seq
 524290208     gbgss138.seq
 515994483     gbgss139.seq
 524288998     gbgss14.seq
 516017128     gbgss140.seq
  96692958     gbgss141.seq
 524289438     gbgss142.seq
 524289560     gbgss143.seq
 524290293     gbgss144.seq
 371611675     gbgss145.seq
 249999767     gbgss146.seq
 249999448     gbgss147.seq
 249999357     gbgss148.seq
 249998042     gbgss149.seq
 524290063     gbgss15.seq
  28618823     gbgss150.seq
 249997137     gbgss151.seq
 250000033     gbgss152.seq
 249998542     gbgss153.seq
 249998333     gbgss154.seq
 224919493     gbgss155.seq
 249998415     gbgss156.seq
 249998761     gbgss157.seq
 249998880     gbgss158.seq
 249997750     gbgss159.seq
 524290859     gbgss16.seq
 189046598     gbgss160.seq
 249999433     gbgss161.seq
 249998390     gbgss162.seq
 249999267     gbgss163.seq
 249998392     gbgss164.seq
 249998723     gbgss165.seq
  76677866     gbgss166.seq
 249997579     gbgss167.seq
   2077145     gbgss168.seq
  79542394     gbgss169.seq
 524290670     gbgss17.seq
 249999009     gbgss170.seq
 250000259     gbgss171.seq
  87380505     gbgss172.seq
 249999685     gbgss173.seq
 249998355     gbgss174.seq
 249998984     gbgss175.seq
 202719103     gbgss176.seq
 249999232     gbgss177.seq
 249999013     gbgss178.seq
 249998851     gbgss179.seq
 524290328     gbgss18.seq
 246250899     gbgss180.seq
 249999268     gbgss181.seq
 249997406     gbgss182.seq
 249999279     gbgss183.seq
 243520281     gbgss184.seq
 249999336     gbgss185.seq
 249997150     gbgss186.seq
 249998209     gbgss187.seq
 249997376     gbgss188.seq
 122294651     gbgss189.seq
 314841901     gbgss19.seq
 249998013     gbgss190.seq
 250000031     gbgss191.seq
 249999974     gbgss192.seq
 249998152     gbgss193.seq
  94058788     gbgss194.seq
 249998892     gbgss195.seq
 249999850     gbgss196.seq
 249998239     gbgss197.seq
 249999582     gbgss198.seq
 176390240     gbgss199.seq
 524289433     gbgss2.seq
 524288952     gbgss20.seq
 249999236     gbgss200.seq
 249997993     gbgss201.seq
 249998006     gbgss202.seq
 249999353     gbgss203.seq
  95926739     gbgss204.seq
 249999461     gbgss205.seq
 249999350     gbgss206.seq
 249998406     gbgss207.seq
 249998619     gbgss208.seq
 249999398     gbgss209.seq
 524289034     gbgss21.seq
 249999995     gbgss210.seq
  17245248     gbgss211.seq
 249999424     gbgss212.seq
 249999963     gbgss213.seq
 249997369     gbgss214.seq
  43648880     gbgss215.seq
  52862187     gbgss216.seq
 249997605     gbgss217.seq
 249998837     gbgss218.seq
 249998422     gbgss219.seq
 524291398     gbgss22.seq
 249998900     gbgss220.seq
  30266551     gbgss221.seq
 249997658     gbgss222.seq
 249997580     gbgss223.seq
 249998996     gbgss224.seq
 249999984     gbgss225.seq
  28042636     gbgss226.seq
 249997655     gbgss227.seq
 249998570     gbgss228.seq
 249997955     gbgss229.seq
 524290800     gbgss23.seq
 249998842     gbgss230.seq
 249999591     gbgss231.seq
 249998244     gbgss232.seq
 178918094     gbgss233.seq
 249999812     gbgss234.seq
 249998926     gbgss235.seq
 249999095     gbgss236.seq
 220154622     gbgss237.seq
 250000034     gbgss238.seq
 249997956     gbgss239.seq
 524291392     gbgss24.seq
 250000074     gbgss240.seq
 249998729     gbgss241.seq
 195288113     gbgss242.seq
 249999561     gbgss243.seq
 249998751     gbgss244.seq
 249999600     gbgss245.seq
 249999029     gbgss246.seq
 249999714     gbgss247.seq
  16550601     gbgss248.seq
 524290581     gbgss25.seq
 524290713     gbgss26.seq
 524290348     gbgss27.seq
 524288854     gbgss28.seq
 524289528     gbgss29.seq
 524291784     gbgss3.seq
 524289655     gbgss30.seq
  38849864     gbgss31.seq
 524289075     gbgss32.seq
 524290723     gbgss33.seq
 524288828     gbgss34.seq
 524289728     gbgss35.seq
 524289696     gbgss36.seq
 524289533     gbgss37.seq
 524289071     gbgss38.seq
 509087433     gbgss39.seq
 524288885     gbgss4.seq
 524290362     gbgss40.seq
 524289231     gbgss41.seq
 524291640     gbgss42.seq
  28732657     gbgss43.seq
 524288882     gbgss44.seq
 524291090     gbgss45.seq
 524290976     gbgss46.seq
 524290985     gbgss47.seq
 209346767     gbgss48.seq
 524291863     gbgss49.seq
 168343373     gbgss5.seq
 524291582     gbgss50.seq
 524290401     gbgss51.seq
 524290464     gbgss52.seq
 524290548     gbgss53.seq
 524290689     gbgss54.seq
 524289963     gbgss55.seq
 524289945     gbgss56.seq
 524290428     gbgss57.seq
 524291284     gbgss58.seq
 524290900     gbgss59.seq
 524290951     gbgss6.seq
   5856233     gbgss60.seq
 524289023     gbgss61.seq
 524290882     gbgss62.seq
 524290246     gbgss63.seq
 457238462     gbgss64.seq
 524291037     gbgss65.seq
 524291022     gbgss66.seq
 524290625     gbgss67.seq
 524289509     gbgss68.seq
 524291296     gbgss69.seq
 524291098     gbgss7.seq
 524289361     gbgss70.seq
 524291755     gbgss71.seq
 524288723     gbgss72.seq
 524289701     gbgss73.seq
 524291169     gbgss74.seq
 524290322     gbgss75.seq
 524291711     gbgss76.seq
  32081037     gbgss77.seq
 524289473     gbgss78.seq
 524291931     gbgss79.seq
 524292289     gbgss8.seq
 524289482     gbgss80.seq
 524290066     gbgss81.seq
 524289701     gbgss82.seq
 524291196     gbgss83.seq
 524290880     gbgss84.seq
 524289902     gbgss85.seq
 524291820     gbgss86.seq
 524289216     gbgss87.seq
 524290299     gbgss88.seq
 369802312     gbgss89.seq
 524290754     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249992912     gbhtc1.seq
 249998309     gbhtc10.seq
 203719899     gbhtc11.seq
 249997534     gbhtc12.seq
 249996368     gbhtc13.seq
  56090298     gbhtc14.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  83873876     gbhtc8.seq
 249999684     gbhtc9.seq
 249904748     gbhtg1.seq
 249863408     gbhtg10.seq
 249917503     gbhtg100.seq
 249844944     gbhtg101.seq
 249902534     gbhtg102.seq
 249958863     gbhtg103.seq
   5671243     gbhtg104.seq
 249923070     gbhtg105.seq
 249870507     gbhtg106.seq
 249954144     gbhtg107.seq
 249774696     gbhtg108.seq
 249964106     gbhtg109.seq
   1107147     gbhtg11.seq
 249827788     gbhtg110.seq
 249911997     gbhtg111.seq
 249893255     gbhtg112.seq
 249912206     gbhtg113.seq
 191115280     gbhtg114.seq
 249974219     gbhtg115.seq
 249840707     gbhtg116.seq
 249986568     gbhtg117.seq
 249791891     gbhtg118.seq
 249796285     gbhtg119.seq
 249658387     gbhtg12.seq
  54045006     gbhtg120.seq
 249792713     gbhtg121.seq
 249995363     gbhtg122.seq
 249795284     gbhtg123.seq
 249905084     gbhtg124.seq
 249961276     gbhtg125.seq
 135522584     gbhtg126.seq
 249793216     gbhtg127.seq
 249693112     gbhtg128.seq
 249763470     gbhtg129.seq
 249699749     gbhtg13.seq
 249945885     gbhtg130.seq
 249771412     gbhtg131.seq
 249959213     gbhtg132.seq
 249887212     gbhtg133.seq
 249952128     gbhtg134.seq
 249894635     gbhtg135.seq
  37204597     gbhtg136.seq
 249765870     gbhtg14.seq
 249760883     gbhtg15.seq
 249872612     gbhtg16.seq
 249832528     gbhtg17.seq
 249983662     gbhtg18.seq
 249677291     gbhtg19.seq
 249994630     gbhtg2.seq
 249988730     gbhtg20.seq
 237145184     gbhtg21.seq
 249760624     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761207     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249848514     gbhtg29.seq
 249950135     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249920767     gbhtg33.seq
 249929437     gbhtg34.seq
 249919058     gbhtg35.seq
 249852033     gbhtg36.seq
 249814604     gbhtg37.seq
 249767419     gbhtg38.seq
 249627604     gbhtg39.seq
 249984089     gbhtg4.seq
 249839726     gbhtg40.seq
 224363115     gbhtg41.seq
 249889211     gbhtg42.seq
 249786801     gbhtg43.seq
 249972417     gbhtg44.seq
 249775813     gbhtg45.seq
 249928134     gbhtg46.seq
 249597238     gbhtg47.seq
 249865052     gbhtg48.seq
 249793005     gbhtg49.seq
 249882044     gbhtg5.seq
 249922691     gbhtg50.seq
 235040940     gbhtg51.seq
 249732550     gbhtg52.seq
 249918496     gbhtg53.seq
 249801065     gbhtg54.seq
 249971361     gbhtg55.seq
 249962512     gbhtg56.seq
  18795863     gbhtg57.seq
 249918734     gbhtg58.seq
 249805918     gbhtg59.seq
 249898460     gbhtg6.seq
 249931678     gbhtg60.seq
 249965766     gbhtg61.seq
 226497721     gbhtg62.seq
 249954240     gbhtg63.seq
 249905771     gbhtg64.seq
 249911228     gbhtg65.seq
 249866240     gbhtg66.seq
 249930142     gbhtg67.seq
  16400292     gbhtg68.seq
 249960711     gbhtg69.seq
 249933725     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249976464     gbhtg72.seq
 225297470     gbhtg73.seq
 249811185     gbhtg74.seq
 249874975     gbhtg75.seq
 249797849     gbhtg76.seq
 249959610     gbhtg77.seq
 244236501     gbhtg78.seq
 249883367     gbhtg79.seq
 249933567     gbhtg8.seq
 249988070     gbhtg80.seq
 249839493     gbhtg81.seq
 249838775     gbhtg82.seq
 216752366     gbhtg83.seq
 249912287     gbhtg84.seq
 249753930     gbhtg85.seq
 249788636     gbhtg86.seq
 249773916     gbhtg87.seq
 221377039     gbhtg88.seq
 249971787     gbhtg89.seq
 249923766     gbhtg9.seq
 249954241     gbhtg90.seq
 249906002     gbhtg91.seq
 249891916     gbhtg92.seq
 209912004     gbhtg93.seq
 249866103     gbhtg94.seq
 249975867     gbhtg95.seq
 249904055     gbhtg96.seq
 249804025     gbhtg97.seq
 168109739     gbhtg98.seq
 249744688     gbhtg99.seq
 249997383     gbinv1.seq
 249997768     gbinv10.seq
 161562374     gbinv11.seq
 250000212     gbinv12.seq
 249996134     gbinv13.seq
 249999757     gbinv14.seq
 148387478     gbinv15.seq
 249346527     gbinv16.seq
 248695001     gbinv17.seq
 249999680     gbinv18.seq
 249998984     gbinv19.seq
 249951554     gbinv2.seq
 249996935     gbinv20.seq
  69941968     gbinv21.seq
 249992098     gbinv22.seq
 249996367     gbinv23.seq
 250000137     gbinv24.seq
 250000158     gbinv25.seq
 249999651     gbinv26.seq
 249997623     gbinv27.seq
 249997488     gbinv28.seq
 249936091     gbinv29.seq
 214077524     gbinv3.seq
  20529577     gbinv30.seq
 249996940     gbinv4.seq
 249999469     gbinv5.seq
 250000143     gbinv6.seq
 224649236     gbinv7.seq
 249997585     gbinv8.seq
 249998145     gbinv9.seq
 139883394     gbjou1.idx
 286258726     gbjou10.idx
 263630296     gbjou11.idx
 184975184     gbjou12.idx
 139639158     gbjou2.idx
 149393342     gbjou3.idx
 190273769     gbjou4.idx
 271793290     gbjou5.idx
 275568277     gbjou6.idx
 281337312     gbjou7.idx
 283605924     gbjou8.idx
 305714489     gbjou9.idx
 324410246     gbkey1.idx
 180066061     gbkey2.idx
 183223114     gbkey3.idx
 216660042     gbkey4.idx
 183462680     gbkey5.idx
 106745841     gbkey6.idx
 249971396     gbmam1.seq
 249977727     gbmam2.seq
 249951518     gbmam3.seq
 249999074     gbmam4.seq
 249999439     gbmam5.seq
 249996616     gbmam6.seq
 178734461     gbmam7.seq
  37799748     gbnew.txt
 249999688     gbpat1.seq
 250000066     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192934308     gbpat107.seq
 249999769     gbpat108.seq
 249999627     gbpat109.seq
 179522265     gbpat11.seq
 249999169     gbpat110.seq
  80117336     gbpat111.seq
 249999251     gbpat112.seq
 250000013     gbpat113.seq
 249978955     gbpat114.seq
 249999878     gbpat115.seq
 249849703     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 249999231     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 249994005     gbpat13.seq
 249997452     gbpat130.seq
  66832984     gbpat131.seq
 249992315     gbpat132.seq
 249999867     gbpat133.seq
 250000197     gbpat134.seq
 249999821     gbpat135.seq
  45151156     gbpat136.seq
 249998039     gbpat137.seq
 250000068     gbpat138.seq
 249999988     gbpat139.seq
 250000080     gbpat14.seq
  86028783     gbpat140.seq
 249999922     gbpat141.seq
 249999885     gbpat142.seq
 249998973     gbpat143.seq
  63534417     gbpat144.seq
 249997259     gbpat145.seq
 249998106     gbpat146.seq
 249999335     gbpat147.seq
 249999902     gbpat148.seq
 249999342     gbpat149.seq
 249996509     gbpat15.seq
 249997292     gbpat150.seq
 222063924     gbpat151.seq
 250000249     gbpat152.seq
 249999893     gbpat153.seq
 249999893     gbpat154.seq
 220539897     gbpat155.seq
 249999753     gbpat156.seq
 249998945     gbpat157.seq
 250000149     gbpat158.seq
  11330901     gbpat159.seq
 249999147     gbpat16.seq
 249997013     gbpat160.seq
 249997482     gbpat161.seq
 249999720     gbpat162.seq
 249997412     gbpat163.seq
  35336717     gbpat164.seq
 249998568     gbpat165.seq
 249997741     gbpat166.seq
 250000189     gbpat167.seq
 249999269     gbpat168.seq
 250000082     gbpat169.seq
  65866387     gbpat17.seq
 249998153     gbpat170.seq
 246395191     gbpat171.seq
 250000027     gbpat18.seq
 249999801     gbpat19.seq
 249999763     gbpat2.seq
 249999076     gbpat20.seq
 249994882     gbpat21.seq
 185815087     gbpat22.seq
 249999907     gbpat23.seq
 249838032     gbpat24.seq
 249999188     gbpat25.seq
 250000065     gbpat26.seq
  71180933     gbpat27.seq
 249983437     gbpat28.seq
 249999262     gbpat29.seq
 249998426     gbpat3.seq
 250000216     gbpat30.seq
 249999940     gbpat31.seq
 249999636     gbpat32.seq
 180161695     gbpat33.seq
 249997730     gbpat34.seq
 249999961     gbpat35.seq
 249998966     gbpat36.seq
 249999898     gbpat37.seq
 130526128     gbpat38.seq
 249995261     gbpat39.seq
 249999756     gbpat4.seq
 249979840     gbpat40.seq
 249999077     gbpat41.seq
 249998929     gbpat42.seq
 249999195     gbpat43.seq
 249816223     gbpat44.seq
 249999190     gbpat45.seq
 249999692     gbpat46.seq
 171260350     gbpat47.seq
 249999855     gbpat48.seq
 249998527     gbpat49.seq
  71790242     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164688826     gbpat56.seq
 249881328     gbpat57.seq
 249997007     gbpat58.seq
 249999411     gbpat59.seq
 249999527     gbpat6.seq
 249999118     gbpat60.seq
 134917207     gbpat61.seq
 249998246     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999532     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249999799     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244402927     gbpat72.seq
 248968678     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999937     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249996070     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249999823     gbpat82.seq
 249999742     gbpat83.seq
  93329421     gbpat84.seq
 249153657     gbpat85.seq
 249998925     gbpat86.seq
 249999067     gbpat87.seq
 249999347     gbpat88.seq
 249999476     gbpat89.seq
 249998073     gbpat9.seq
 249998929     gbpat90.seq
 145288703     gbpat91.seq
 249998977     gbpat92.seq
 249998980     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196964910     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 160647288     gbphg1.seq
 249998465     gbpln1.seq
 249998880     gbpln10.seq
 250000097     gbpln11.seq
 249875998     gbpln12.seq
 214506486     gbpln13.seq
 249998215     gbpln14.seq
 249985349     gbpln15.seq
 249996352     gbpln16.seq
 249410143     gbpln17.seq
 249979838     gbpln18.seq
 249606502     gbpln19.seq
 249813070     gbpln2.seq
 250000190     gbpln20.seq
  33382277     gbpln21.seq
 249994441     gbpln22.seq
  97573049     gbpln23.seq
 249998659     gbpln24.seq
 250000256     gbpln25.seq
 248862439     gbpln26.seq
 203148524     gbpln27.seq
 247978482     gbpln28.seq
 249995193     gbpln29.seq
 249837402     gbpln3.seq
 249995344     gbpln30.seq
 249999940     gbpln31.seq
 249998578     gbpln32.seq
 217272380     gbpln33.seq
 249997916     gbpln34.seq
 249997966     gbpln35.seq
 249999674     gbpln36.seq
 249997708     gbpln37.seq
 135370470     gbpln38.seq
 249893576     gbpln39.seq
 249845484     gbpln4.seq
 249999714     gbpln40.seq
 249999994     gbpln41.seq
 249435710     gbpln42.seq
 249998161     gbpln43.seq
 115997610     gbpln44.seq
 249999790     gbpln45.seq
 250000133     gbpln46.seq
 249998040     gbpln47.seq
 250000162     gbpln48.seq
 249999174     gbpln49.seq
 249876333     gbpln5.seq
 249999220     gbpln50.seq
  70066069     gbpln51.seq
 249943223     gbpln6.seq
 249996652     gbpln7.seq
 187399899     gbpln8.seq
 249998108     gbpln9.seq
 148950307     gbpri1.seq
 249830111     gbpri10.seq
 129166622     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902427     gbpri16.seq
 249876185     gbpri17.seq
 249991978     gbpri18.seq
 249902736     gbpri19.seq
 249828843     gbpri2.seq
 249871464     gbpri20.seq
 249969201     gbpri21.seq
 249999341     gbpri22.seq
   8194048     gbpri23.seq
 177481056     gbpri24.seq
 249996132     gbpri25.seq
 211364614     gbpri26.seq
 249876551     gbpri27.seq
 249832462     gbpri28.seq
 249948820     gbpri29.seq
 249927696     gbpri3.seq
 249937231     gbpri30.seq
 249957235     gbpri31.seq
 249854829     gbpri32.seq
 249968208     gbpri33.seq
 249999199     gbpri34.seq
  95851922     gbpri35.seq
 249993971     gbpri36.seq
 249998537     gbpri37.seq
 249973146     gbpri38.seq
 249996570     gbpri39.seq
 249989122     gbpri4.seq
 250000016     gbpri40.seq
 178253407     gbpri41.seq
 249998290     gbpri42.seq
 249998417     gbpri43.seq
   2411937     gbpri44.seq
 249744730     gbpri5.seq
 249982318     gbpri6.seq
 249971406     gbpri7.seq
 249775742     gbpri8.seq
 249970958     gbpri9.seq
    315136     gbrel.txt
 249965627     gbrod1.seq
 249952616     gbrod10.seq
  60961015     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249873165     gbrod18.seq
 234765149     gbrod19.seq
 249942176     gbrod2.seq
 249812485     gbrod20.seq
 249924095     gbrod21.seq
 230155519     gbrod22.seq
 249992720     gbrod23.seq
 250000022     gbrod24.seq
 249945267     gbrod25.seq
 249902066     gbrod26.seq
 249999318     gbrod27.seq
 249999948     gbrod28.seq
 157461026     gbrod29.seq
 249785229     gbrod3.seq
 249743057     gbrod4.seq
 249987585     gbrod5.seq
 249985583     gbrod6.seq
 249746791     gbrod7.seq
 249760313     gbrod8.seq
 249867062     gbrod9.seq
3800777847     gbsdr1.txt
5686561265     gbsdr2.txt
2606620131     gbsdr3.txt
 153116315     gbsec.idx
 249997185     gbsts1.seq
 249997720     gbsts10.seq
 210919464     gbsts11.seq
 249996524     gbsts12.seq
 249999349     gbsts13.seq
 249999346     gbsts14.seq
 249999572     gbsts15.seq
  24470469     gbsts16.seq
 249999107     gbsts17.seq
 249997782     gbsts18.seq
 250000230     gbsts19.seq
 249999957     gbsts2.seq
 146601374     gbsts20.seq
 249999302     gbsts3.seq
 250000060     gbsts4.seq
  39162150     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998706     gbsts9.seq
 249999399     gbsyn1.seq
 249998704     gbsyn2.seq
  49490372     gbsyn3.seq
 249999677     gbtsa1.seq
 249996692     gbtsa10.seq
 249999040     gbtsa11.seq
  89577387     gbtsa12.seq
 249997835     gbtsa13.seq
 249999221     gbtsa14.seq
 249998017     gbtsa15.seq
 250000059     gbtsa16.seq
 167332404     gbtsa17.seq
 250000170     gbtsa18.seq
 249999456     gbtsa19.seq
 249999837     gbtsa2.seq
 249999674     gbtsa20.seq
 249998853     gbtsa21.seq
 249998324     gbtsa22.seq
  86745703     gbtsa23.seq
 249998710     gbtsa24.seq
 249998743     gbtsa25.seq
 249997584     gbtsa26.seq
 249998300     gbtsa27.seq
 249999214     gbtsa28.seq
 249996662     gbtsa29.seq
 250000222     gbtsa3.seq
 119544061     gbtsa30.seq
 250000015     gbtsa31.seq
 249998533     gbtsa32.seq
 249998813     gbtsa33.seq
 249999396     gbtsa34.seq
 148167803     gbtsa35.seq
 249998927     gbtsa36.seq
 249999152     gbtsa37.seq
 249997910     gbtsa38.seq
 249997209     gbtsa39.seq
 249999115     gbtsa4.seq
 250000217     gbtsa40.seq
 249999263     gbtsa41.seq
 249999332     gbtsa42.seq
 100887885     gbtsa43.seq
  82924795     gbtsa5.seq
 249999422     gbtsa6.seq
 249998425     gbtsa7.seq
 249997712     gbtsa8.seq
 249997802     gbtsa9.seq
    483272     gbuna1.seq
 249998656     gbvrl1.seq
 249993611     gbvrl10.seq
  80362152     gbvrl11.seq
 249998658     gbvrl12.seq
 249999123     gbvrl13.seq
 249998793     gbvrl14.seq
 249999877     gbvrl15.seq
 249999558     gbvrl16.seq
 249996422     gbvrl17.seq
 249997111     gbvrl18.seq
  74343802     gbvrl19.seq
 249997808     gbvrl2.seq
 249998626     gbvrl3.seq
 249998927     gbvrl4.seq
 178996386     gbvrl5.seq
 249996371     gbvrl6.seq
 249995318     gbvrl7.seq
 249998537     gbvrl8.seq
 249997678     gbvrl9.seq
 249911358     gbvrt1.seq
 249762539     gbvrt10.seq
 249940020     gbvrt11.seq
 185678776     gbvrt12.seq
 249995062     gbvrt13.seq
 249952465     gbvrt14.seq
 249989514     gbvrt15.seq
 249999532     gbvrt16.seq
 249999452     gbvrt17.seq
 249997709     gbvrt18.seq
  96622619     gbvrt19.seq
 249998319     gbvrt2.seq
 249958369     gbvrt20.seq
 249998882     gbvrt21.seq
 250000207     gbvrt22.seq
 249963607     gbvrt23.seq
 195066897     gbvrt24.seq
 249927727     gbvrt3.seq
 249998530     gbvrt4.seq
  88363164     gbvrt5.seq
 249999800     gbvrt6.seq
 249995207     gbvrt7.seq
 249818397     gbvrt8.seq
 249951536     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         61326      87069481
BCT10        59         115338437
BCT11        106        116532735
BCT12        85         114553152
BCT13        16094      32241010
BCT14        53934      85390363
BCT15        93         110189094
BCT16        151        93915681
BCT17        61         112455059
BCT18        52         112042350
BCT19        46         114233015
BCT2         77         108456158
BCT20        58         114931588
BCT21        67         111284815
BCT22        36         96325907
BCT23        40         106881287
BCT24        58         105533856
BCT25        74         111675186
BCT26        55         110045255
BCT27        63         106845575
BCT28        55         109391288
BCT29        52         108559385
BCT3         52         112222201
BCT30        46         110496749
BCT31        95         109522868
BCT32        59         110966729
BCT33        67         108616570
BCT34        123        106326491
BCT35        35         64734494
BCT36        202        109105429
BCT37        51         109861512
BCT38        40         106911174
BCT39        54         104252121
BCT4         56         108403366
BCT40        58         107350200
BCT41        44         110960713
BCT42        80         107599606
BCT43        52         108571742
BCT44        46         107138318
BCT45        69         109010656
BCT46        69         107419673
BCT47        56         53617798
BCT48        67         107603750
BCT49        63         105184773
BCT5         38310      69864041
BCT50        49         104991871
BCT51        55         108636299
BCT52        55         108838606
BCT53        65         109544347
BCT54        56         102535788
BCT55        53         108932898
BCT56        62         110888751
BCT57        62         106876890
BCT58        234        101660890
BCT59        106        93623325
BCT6         39043      82651336
BCT60        323        16011156
BCT61        1589       2511877
BCT62        3179       5215895
BCT63        6347       7901828
BCT64        12648      15076611
BCT65        25628      27748212
BCT66        50523      53965402
BCT67        76530      77431425
BCT68        71815      77221045
BCT69        8476       96045062
BCT7         5523       96146382
BCT70        5284       100110266
BCT71        2994       107953057
BCT72        64         115956397
BCT73        7574       111834779
BCT74        43476      90826184
BCT75        79677      76973084
BCT76        77321      79383068
BCT77        43054      83565896
BCT8         13866      90149060
BCT9         6715       96271813
ENV1         94560      71228865
ENV10        83131      87251437
ENV11        20048      17357810
ENV12        84810      80888385
ENV13        120620     43451255
ENV14        88782      78178750
ENV15        96735      67817124
ENV16        96123      63443144
ENV17        90207      68396180
ENV18        62549      84459720
ENV19        69532      85606513
ENV2         88456      70421762
ENV20        94240      72047110
ENV21        128636     31373040
ENV22        123352     29531526
ENV23        63138      14125004
ENV24        123211     49880671
ENV25        97687      68129479
ENV26        117076     55598174
ENV27        137907     52342897
ENV28        105393     60919472
ENV29        33843      33385740
ENV3         93817      72070703
ENV30        71058      96548027
ENV31        95623      69639811
ENV32        107872     43891018
ENV33        89810      67190655
ENV34        56534      35361831
ENV35        111406     47254754
ENV36        104051     58875362
ENV37        83455      80654968
ENV38        70388      95663757
ENV39        83068      78365612
ENV4         79671      85043329
ENV40        109851     54766915
ENV41        112528     57858958
ENV42        97045      68933743
ENV43        6340       4350562
ENV5         88754      86409978
ENV6         84206      48439161
ENV7         131779     31253773
ENV8         86481      70556703
ENV9         93329      72923888
EST1         158932     61578479
EST10        167449     72157693
EST100       226246     140244228
EST101       227650     115512157
EST102       201352     104759214
EST103       171846     101001632
EST104       102126     80217780
EST105       165115     110910500
EST106       168492     110404328
EST107       117045     68088832
EST108       63862      23524922
EST109       64111      22728110
EST11        169551     73990710
EST110       64333      23423738
EST111       64295      27229760
EST112       64309      21906722
EST113       65711      25952841
EST114       63772      27851303
EST115       64287      26250735
EST116       64524      26961819
EST117       64245      25129930
EST118       61225      38053414
EST119       162221     77029806
EST12        166812     70069138
EST120       174877     86174524
EST121       158380     92882006
EST122       149629     95740598
EST123       153465     89562014
EST124       126102     78376586
EST125       202965     99365751
EST126       153470     79485397
EST127       157984     84332718
EST128       155616     89074097
EST129       149671     79530249
EST13        72705      34876658
EST130       174549     101427867
EST131       200117     116375887
EST132       182466     99500529
EST133       162794     84335553
EST134       158384     80343399
EST135       146271     89300169
EST136       142040     85621992
EST137       93547      49250507
EST138       188174     107230956
EST139       232244     102005310
EST14        217695     109285016
EST140       152949     89658052
EST141       168243     91528235
EST142       146977     87176235
EST143       137592     86859849
EST144       157584     95380358
EST145       146230     76528628
EST146       123465     64403702
EST147       121766     65838388
EST148       129199     54539674
EST149       127611     50728680
EST15        168607     105336506
EST150       128332     51059563
EST151       119628     45497831
EST152       171987     86431419
EST153       180108     80413973
EST154       154640     109509473
EST155       211717     129303978
EST156       215418     119841849
EST157       174371     93026469
EST158       147134     111968477
EST159       134254     83215438
EST16        178903     112375673
EST160       156293     97463904
EST161       150015     80099442
EST162       141996     81782604
EST163       168909     94489345
EST164       73127      43929275
EST165       154647     96039721
EST166       188788     106010503
EST167       142855     78239967
EST168       135318     71833347
EST169       169012     94243879
EST17        195359     112894197
EST170       179606     103224367
EST171       150944     94319521
EST172       171466     83787562
EST173       129274     86098370
EST174       182921     107888611
EST175       164700     93082046
EST176       112254     66489423
EST177       164134     93649141
EST178       34024      21458566
EST179       169057     101105966
EST18        190585     121534640
EST180       181519     127676908
EST181       148866     106517189
EST182       190688     99355890
EST183       152818     115933511
EST184       144134     86913214
EST185       145429     82980293
EST186       177762     71910538
EST187       149526     84416267
EST188       155111     97052601
EST189       162534     99713837
EST19        159270     114061826
EST190       142492     88407244
EST191       161962     94314860
EST192       133751     89892309
EST193       131214     88385686
EST194       144974     89318157
EST195       134034     89306024
EST196       123962     87046239
EST197       173234     92429218
EST198       173993     95865745
EST199       173452     96319355
EST2         161860     61550624
EST20        187057     99421374
EST200       171166     96071620
EST201       168260     94205403
EST202       172248     95869353
EST203       173457     95045379
EST204       174007     95566480
EST205       32241      17539516
EST206       191221     103857793
EST207       202340     106572270
EST208       174708     105322475
EST209       183788     103897173
EST21        217142     106473483
EST210       197127     118575608
EST211       195603     116481485
EST212       182817     121345287
EST213       174142     104988790
EST214       214292     146889287
EST215       237615     107490631
EST216       139184     108090593
EST217       150611     101325422
EST218       146717     90968134
EST219       206003     111613964
EST22        198689     65854508
EST220       171846     113707459
EST221       99894      91366320
EST222       142700     110417702
EST223       160861     94612232
EST224       145634     106233342
EST225       216451     100672334
EST226       144151     101917132
EST227       137850     96875222
EST228       140442     100765989
EST229       121104     86078223
EST23        140919     40078602
EST230       95726      61643929
EST231       141471     91741484
EST232       133065     98059995
EST233       137723     98127199
EST234       123943     84430809
EST235       132773     86783449
EST236       158089     116662159
EST237       143350     117072713
EST238       133623     113074142
EST239       154955     95490210
EST24        103789     28104160
EST240       178004     112869396
EST241       146342     92413476
EST242       179485     112603453
EST243       164510     122349747
EST244       139127     103160789
EST245       12892      10361887
EST246       164720     100631642
EST247       231344     97062636
EST248       152024     113248134
EST249       179418     65090716
EST25        121694     50973646
EST250       216999     50009383
EST251       212372     82251167
EST252       171168     131296449
EST253       165241     101374921
EST254       168820     107570382
EST255       164416     111391200
EST256       166494     117223162
EST257       86955      44523514
EST258       187527     98342383
EST259       176377     111574122
EST26        213567     97235467
EST260       165301     109204494
EST261       233165     110648014
EST262       278243     120126946
EST263       183426     111861504
EST264       187451     36835066
EST265       259302     124375583
EST266       151681     94570434
EST267       161058     104999385
EST268       96468      56224592
EST269       173960     118516619
EST27        219254     110181984
EST270       183544     98668495
EST271       172298     113450704
EST272       182190     105422658
EST273       207959     36663663
EST274       190924     56138308
EST275       185637     105844530
EST276       187402     118290177
EST277       173072     113368890
EST278       179914     102608802
EST279       156414     104382218
EST28        190354     88484191
EST280       111526     37304179
EST281       129600     81610404
EST282       132914     85973481
EST283       156201     100488841
EST284       259869     27442053
EST285       263840     24257439
EST286       146393     105988849
EST287       168770     109355829
EST288       161510     102926505
EST289       155850     91032920
EST29        157931     68869158
EST290       264482     32055739
EST291       164953     108230062
EST292       74061      43081711
EST293       184861     111105312
EST294       149154     90958928
EST295       195241     109667361
EST296       164384     114890485
EST297       161989     104421777
EST298       189169     113833213
EST299       179328     100251464
EST3         153644     54437600
EST30        171511     69599612
EST300       181383     103369646
EST301       188354     64352233
EST302       187451     69725319
EST303       187275     70867111
EST304       122724     47148663
EST305       187185     91785806
EST306       182038     133328103
EST307       149734     86313697
EST308       154223     90726305
EST309       128769     100384088
EST31        149119     63286460
EST310       157095     97917499
EST311       170093     97327103
EST312       155002     96979360
EST313       170487     98323060
EST314       157479     105228946
EST315       145590     101435616
EST316       165035     106667773
EST317       156841     115346378
EST318       182350     153688521
EST319       172870     94250967
EST32        168269     76124897
EST320       134288     85081875
EST321       144101     99204276
EST322       140733     93930760
EST323       139813     91376583
EST324       145668     101529445
EST325       151004     101274436
EST326       179216     106360768
EST327       149680     86814073
EST328       151777     86252807
EST329       155069     112518617
EST33        174101     66739185
EST330       158736     94844239
EST331       74695      49654901
EST332       138874     86895051
EST333       153401     95218013
EST334       205674     106155989
EST335       114630     63130236
EST336       103098     65541951
EST337       132620     88727872
EST338       138968     87932614
EST339       122736     75528305
EST34        122487     43016182
EST340       216915     82876497
EST341       181976     86153964
EST342       157263     95358336
EST343       178133     108909216
EST344       150991     90140367
EST345       83985      55256758
EST346       134775     90087103
EST347       146792     95463863
EST348       186794     116615562
EST349       158508     90548567
EST35        97396      29888300
EST350       174744     100158744
EST351       175974     129599488
EST352       80780      48929197
EST353       86315      48529032
EST354       146130     84298661
EST355       131105     77318164
EST356       158044     41832001
EST357       158945     31643797
EST358       157007     50204733
EST359       183194     119442683
EST36        97796      30592629
EST360       247411     114270670
EST361       250794     114843051
EST362       175681     99443055
EST363       142340     92335399
EST364       137895     86154090
EST365       156657     93377517
EST366       194929     119811931
EST367       222416     58984859
EST368       185023     113012720
EST369       222088     121751698
EST37        96710      29344301
EST370       140061     67438644
EST371       172245     96252364
EST372       156756     102795306
EST373       195018     134351805
EST374       174170     135838783
EST375       173559     117720807
EST376       164126     97459246
EST377       169242     109856593
EST378       201899     111004187
EST379       192507     100072380
EST38        98631      29838971
EST380       196930     125849029
EST381       187706     126333979
EST382       95841      62825467
EST383       207712     138438415
EST384       215741     136643207
EST385       210551     167719640
EST386       182998     114117591
EST387       192857     106504596
EST388       170238     17305329
EST389       159981     13424443
EST39        99462      31214409
EST390       157075     25488375
EST391       158757     32094576
EST392       158784     32026326
EST393       151030     74156276
EST394       112908     60951032
EST395       174540     117870682
EST396       168070     104557955
EST397       161846     108175546
EST398       142736     95576122
EST399       141812     100927822
EST4         170812     67108330
EST40        23412      5974147
EST400       148632     95833394
EST401       177682     127447479
EST402       152819     98124428
EST403       169687     71441300
EST404       167922     26449925
EST405       163202     97952568
EST406       154579     103420369
EST407       148239     96709040
EST408       137182     79317706
EST409       195040     106730268
EST41        100939     53072419
EST410       174186     126104187
EST411       132906     91258721
EST412       131762     89392018
EST413       154389     96443191
EST414       172672     96051563
EST415       181583     97867801
EST416       136459     86956323
EST417       177544     110670729
EST418       172599     99406781
EST419       110115     75738911
EST42        119743     50936518
EST420       79725      60948058
EST421       107431     70543443
EST422       10964      7039129
EST423       153970     83828884
EST424       127918     78048982
EST425       137042     90729391
EST426       141999     83405020
EST427       167362     97568858
EST428       163166     89897911
EST429       186478     113072870
EST43        164226     85713541
EST430       134269     90019136
EST431       179646     84292333
EST432       165415     83417178
EST433       147356     83561242
EST434       194903     116892725
EST435       130232     74007213
EST436       138498     93043801
EST437       168177     72913512
EST438       191058     81409324
EST439       206009     86772150
EST44        166541     67593246
EST440       208592     95590119
EST441       216069     124793463
EST442       163328     101539614
EST443       182186     114849665
EST444       137931     95609233
EST445       174775     104049203
EST446       156222     84941951
EST447       108430     61816058
EST448       162665     61491578
EST449       168158     61388361
EST45        166224     87628943
EST450       83554      31925150
EST46        170505     87070423
EST47        162152     87609672
EST48        162766     82200783
EST49        157564     91124148
EST5         168996     66194437
EST50        161276     90972236
EST51        158797     98381511
EST52        157174     69444234
EST53        150537     82915673
EST54        81556      49893233
EST55        167810     67437632
EST56        160506     76554679
EST57        169012     93203050
EST58        156509     101556430
EST59        157528     100171055
EST6         171504     66930687
EST60        163286     100737727
EST61        160622     106106186
EST62        172745     73925449
EST63        173098     100995758
EST64        151312     80226023
EST65        151189     84176520
EST66        158943     99339438
EST67        137439     78869222
EST68        143246     84949107
EST69        196196     109259343
EST7         169800     72720649
EST70        198065     103913914
EST71        211428     118588609
EST72        192227     113441035
EST73        193736     114107827
EST74        160362     86307977
EST75        133200     62208509
EST76        136978     68752120
EST77        158519     108107804
EST78        155599     85618343
EST79        144501     78803079
EST8         179404     72869764
EST80        55928      37619223
EST81        182736     94291775
EST82        211409     123400305
EST83        214004     114923333
EST84        209542     98561345
EST85        208755     91073565
EST86        148578     90296265
EST87        144373     83813351
EST88        162680     81162672
EST89        159964     80838973
EST9         168515     69281418
EST90        152170     103082687
EST91        152468     99396291
EST92        133266     75530318
EST93        152417     115330544
EST94        141962     104565648
EST95        145436     105498584
EST96        139338     88127114
EST97        153142     86314564
EST98        174623     107227687
EST99        243862     149434211
GSS1         200064     87618344
GSS10        132040     60283372
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167238     128921102
GSS104       149783     82569304
GSS105       191527     120854119
GSS106       167754     112128998
GSS107       197330     115526115
GSS108       204979     134771775
GSS109       209811     138227419
GSS11        137026     73963307
GSS110       207578     140849257
GSS111       206236     142442604
GSS112       205252     143736524
GSS113       205174     143940262
GSS114       202120     146640781
GSS115       182321     139886386
GSS116       18402      10868805
GSS117       132848     84052151
GSS118       169611     80019194
GSS119       184545     79632195
GSS12        147892     75892162
GSS120       170318     148382271
GSS121       178761     122101974
GSS122       184777     149531015
GSS123       192469     124834726
GSS124       187625     137647444
GSS125       192651     126497530
GSS126       189221     96872152
GSS127       165909     151781588
GSS128       164442     116093124
GSS129       72663      49006416
GSS13        145394     68606548
GSS130       171039     155483517
GSS131       172723     154180802
GSS132       172116     155501394
GSS133       173773     154311856
GSS134       174061     152721060
GSS135       184042     145572037
GSS136       180024     146309329
GSS137       163722     112645723
GSS138       214844     84093959
GSS139       265737     40936659
GSS14        169809     84775490
GSS140       265733     40959700
GSS141       49822      7636037
GSS142       257639     58116823
GSS143       247420     64679570
GSS144       195059     78979857
GSS145       135919     35833184
GSS146       87119      64001369
GSS147       83555      62807125
GSS148       103680     48622736
GSS149       68577      58472590
GSS15        161100     97663213
GSS150       7664       7016149
GSS151       68591      57924394
GSS152       69224      56650935
GSS153       69460      56187403
GSS154       71202      55998401
GSS155       68561      51865315
GSS156       75915      58209304
GSS157       87237      74898207
GSS158       81830      44609896
GSS159       92677      45029689
GSS16        172836     87033749
GSS160       63209      47603494
GSS161       77435      61351403
GSS162       69655      58699293
GSS163       67711      62706526
GSS164       62009      53369632
GSS165       95592      42925428
GSS166       21061      4909542
GSS167       112938     70877522
GSS168       822        559311
GSS169       23226      28867035
GSS17        183523     113501533
GSS170       109043     70652585
GSS171       84533      34668223
GSS172       35815      22222733
GSS173       103304     62490220
GSS174       102329     63761256
GSS175       104268     67656826
GSS176       82099      41276456
GSS177       83102      54651503
GSS178       95673      61335435
GSS179       107323     78547443
GSS18        192358     114305774
GSS180       106375     76684757
GSS181       106058     79947480
GSS182       103996     80016519
GSS183       76374      51039123
GSS184       104572     63292187
GSS185       109868     66415305
GSS186       106205     59313311
GSS187       68379      37446344
GSS188       69561      38732329
GSS189       37157      17778905
GSS19        114075     52103409
GSS190       85481      46023427
GSS191       97119      55907586
GSS192       94982      49597190
GSS193       96286      55922591
GSS194       42132      23615490
GSS195       114638     43642267
GSS196       117085     39368203
GSS197       108676     55514545
GSS198       101471     78372335
GSS199       69893      44870648
GSS2         182294     92190539
GSS20        181789     101771260
GSS200       95891      36542252
GSS201       95417      37268709
GSS202       96671      35161518
GSS203       94285      39167432
GSS204       37736      17626556
GSS205       103939     66277823
GSS206       94551      61190929
GSS207       95128      60357048
GSS208       94773      60868501
GSS209       75675      70017159
GSS21        166208     114173594
GSS210       75117      74330280
GSS211       4473       7127270
GSS212       83736      28233267
GSS213       84219      27346468
GSS214       84926      25909272
GSS215       14851      4422302
GSS216       16547      7508221
GSS217       92648      59635081
GSS218       84624      52490775
GSS219       94061      50735685
GSS22        169506     97609042
GSS220       88579      48354065
GSS221       10731      5841916
GSS222       90648      56882510
GSS223       89662      61882079
GSS224       88553      63641206
GSS225       89283      62505584
GSS226       9890       7129098
GSS227       87995      63795538
GSS228       90217      62488977
GSS229       94639      59914104
GSS23        187251     126687349
GSS230       74309      63030713
GSS231       84243      78883806
GSS232       83030      80583817
GSS233       70509      52677201
GSS234       117650     64297121
GSS235       108874     55446727
GSS236       107533     52125503
GSS237       96658      43251344
GSS238       109801     49060015
GSS239       98194      46325477
GSS24        194057     130219707
GSS240       73059      72225597
GSS241       76682      71142435
GSS242       72980      46435649
GSS243       94787      57200301
GSS244       93517      59081345
GSS245       93900      58510429
GSS246       94714      57307691
GSS247       94279      58016121
GSS248       6701       3333254
GSS25        177481     105207105
GSS26        185918     107808246
GSS27        170600     151419573
GSS28        190494     146229226
GSS29        151147     106441309
GSS3         174947     87827711
GSS30        192446     132128206
GSS31        13634      8776287
GSS32        196044     127318947
GSS33        216659     116231837
GSS34        218573     113602417
GSS35        219720     112025390
GSS36        213958     121897898
GSS37        198560     156434224
GSS38        194991     146802885
GSS39        197241     73368303
GSS4         167154     85100900
GSS40        185065     97681837
GSS41        189783     125959643
GSS42        170343     158769399
GSS43        9054       5887224
GSS44        183999     100320381
GSS45        173032     121667203
GSS46        185089     124655109
GSS47        190835     122398633
GSS48        70733      62564650
GSS49        171799     101963548
GSS5         53443      31616565
GSS50        167647     103037030
GSS51        167798     102616122
GSS52        184194     121477291
GSS53        184774     116632196
GSS54        181686     122485290
GSS55        187531     113994336
GSS56        189392     134519036
GSS57        178947     104938173
GSS58        195715     120562907
GSS59        179925     133347062
GSS6         161617     84471320
GSS60        1898       1718384
GSS61        172844     138948397
GSS62        161635     111553347
GSS63        161673     111572480
GSS64        158827     107592995
GSS65        156768     129062324
GSS66        170185     142553826
GSS67        179844     117096102
GSS68        204911     127968663
GSS69        193332     110756601
GSS7         165323     79361698
GSS70        244049     126052608
GSS71        160171     106288253
GSS72        159383     119832589
GSS73        162663     124539385
GSS74        162629     124600629
GSS75        175123     108965694
GSS76        190294     140110654
GSS77        12990      7552045
GSS78        199135     126616367
GSS79        170370     111603100
GSS8         165782     88979927
GSS80        200718     131518447
GSS81        214948     86011305
GSS82        187080     100057507
GSS83        131104     91989085
GSS84        146939     117974637
GSS85        139562     116979023
GSS86        142823     114217730
GSS87        143960     119802766
GSS88        141946     115786817
GSS89        104815     87300351
GSS9         137999     67157686
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        63431      67180460
HTC11        62746      57492888
HTC12        66993      60073171
HTC13        68556      69499762
HTC14        20703      14108795
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         62355      78487812
HTG1         1318       188771164
HTG10        1298       186333849
HTG100       990        189440077
HTG101       996        189331054
HTG102       985        189419172
HTG103       1161       190563478
HTG104       30         4314892
HTG105       1087       189850160
HTG106       1044       189719158
HTG107       1389       191502319
HTG108       1296       190824903
HTG109       1617       191198960
HTG11        6          837687
HTG110       1367       191900638
HTG111       1298       192103378
HTG112       1292       190466082
HTG113       1091       190324774
HTG114       874        139597723
HTG115       1513       182381556
HTG116       992        192165745
HTG117       930        180610165
HTG118       1076       193680790
HTG119       1103       193010481
HTG12        1451       183826000
HTG120       223        41874974
HTG121       1028       189410054
HTG122       1055       192800345
HTG123       1163       191976448
HTG124       1083       192972209
HTG125       1084       193078263
HTG126       593        104617287
HTG127       1121       192542900
HTG128       1080       192285706
HTG129       1078       192289925
HTG13        875        191579912
HTG130       1164       192055711
HTG131       1170       192107893
HTG132       1080       192192754
HTG133       1052       192417640
HTG134       1144       191420090
HTG135       1471       187713161
HTG136       207        26918285
HTG14        753        192058598
HTG15        745        191952430
HTG16        786        192030578
HTG17        798        191859978
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2470       186037380
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189964220
HTG3         2513       185208586
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191697068
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2550       188439001
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010126
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190645783
HTG47        1176       190820823
HTG48        1128       191224702
HTG49        1046       191244150
HTG5         1283       185453274
HTG50        1030       189619303
HTG51        1042       178756613
HTG52        968        190052338
HTG53        1105       190148899
HTG54        1046       190181725
HTG55        1014       189831932
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189386550
HTG59        1031       189892226
HTG6         1273       185124562
HTG60        1076       187298961
HTG61        1126       188302580
HTG62        993        171883775
HTG63        1086       189624557
HTG64        1065       189501278
HTG65        1168       188823064
HTG66        1179       187455992
HTG67        1282       184472933
HTG68        93         12034677
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187688204
HTG73        1020       170303770
HTG74        1118       188293510
HTG75        1103       190775743
HTG76        1135       190787344
HTG77        1182       190871034
HTG78        1096       185997580
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190062169
HTG81        1213       189874691
HTG82        1120       189645029
HTG83        959        164682536
HTG84        1228       188383308
HTG85        1251       187687552
HTG86        1141       189904095
HTG87        1144       189635018
HTG88        980        168283811
HTG89        1182       189963238
HTG9         1200       186916809
HTG90        1104       190233697
HTG91        1146       190150275
HTG92        1107       190418689
HTG93        968        160184166
HTG94        1056       190751264
HTG95        1161       191033671
HTG96        1031       189156227
HTG97        1071       189524206
HTG98        685        127675409
HTG99        1018       189641315
INV1         94144      48349738
INV10        83540      65303806
INV11        53919      42809424
INV12        84924      66270033
INV13        81125      67009184
INV14        78255      68214402
INV15        45398      41386316
INV16        34506      110908020
INV17        276        155680507
INV18        59042      93007979
INV19        74543      61586682
INV2         15300      164990220
INV20        73718      53757555
INV21        19668      12823368
INV22        55632      88070367
INV23        73037      47987586
INV24        73023      47887464
INV25        75265      52023459
INV26        72714      49199344
INV27        73215      49767584
INV28        70012      50105882
INV29        50059      83749336
INV3         1309       149154684
INV30        1153       8864014
INV4         16916      128360348
INV5         78530      72603515
INV6         54177      94853494
INV7         47329      82093600
INV8         80588      71782131
INV9         59348      85944714
MAM1         15193      162546587
MAM2         21280      155842912
MAM3         57523      84760862
MAM4         10256      180825870
MAM5         79556      74680090
MAM6         52858      118443848
MAM7         55127      44162793
PAT1         222547     70116852
PAT10        124492     102559129
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224731     34113482
PAT109       250080     15844362
PAT11        98580      64113533
PAT110       180680     63680037
PAT111       51647      26043244
PAT112       114191     110462189
PAT113       137704     83281015
PAT114       164154     99345808
PAT115       158877     103325984
PAT116       137417     114988187
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142065     62828791
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105888     59875034
PAT130       44618      171217879
PAT131       9167       47581637
PAT132       33645      178334734
PAT133       153558     109675196
PAT134       178705     90913377
PAT135       136049     115324159
PAT136       35501      10009256
PAT137       203662     47737230
PAT138       277828     9627968
PAT139       220409     46465135
PAT14        103650     50160806
PAT140       106719     2881142
PAT141       270386     21672571
PAT142       186752     61240505
PAT143       109802     106056534
PAT144       47514      9550017
PAT145       87300      88252619
PAT146       78467      95592643
PAT147       145221     77687807
PAT148       167503     71383908
PAT149       121471     92947696
PAT15        121150     53321659
PAT150       102962     85404157
PAT151       165548     45989168
PAT152       270022     5130418
PAT153       269978     5129582
PAT154       269978     5129582
PAT155       237888     4519872
PAT156       269396     5118524
PAT157       235715     25782943
PAT158       204521     46982512
PAT159       11011      386637
PAT16        113145     61277722
PAT160       165317     74871979
PAT161       91688      126658582
PAT162       172595     71660689
PAT163       137855     72262761
PAT164       9530       13980165
PAT165       93111      87244841
PAT166       91739      79911553
PAT167       83227      91467368
PAT168       118875     56039980
PAT169       97963      134992366
PAT17        39141      16227175
PAT170       162150     74817711
PAT171       211573     45132307
PAT18        146771     52594264
PAT19        153705     78039102
PAT2         194541     84646278
PAT20        104995     118172564
PAT21        133550     95503155
PAT22        84598      79322013
PAT23        123566     103406367
PAT24        119412     105655419
PAT25        145492     86671235
PAT26        175170     64298181
PAT27        71360      1784000
PAT28        102171     77387698
PAT29        93958      87647590
PAT3         171983     95893688
PAT30        119943     61672014
PAT31        96649      78966375
PAT32        128385     55033926
PAT33        92204      51115231
PAT34        111299     78151838
PAT35        138103     29119101
PAT36        158499     24085905
PAT37        114684     49015396
PAT38        44863      54579873
PAT39        95734      83197609
PAT4         153734     106066478
PAT40        100230     70978875
PAT41        136206     39303264
PAT42        143780     35446924
PAT43        123731     64746991
PAT44        104355     81197550
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57195      23949265
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92813      89405535
PAT59        106520     74781286
PAT6         170642     91909261
PAT60        122361     64031080
PAT61        67421      30296794
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154786     88238970
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131210     96924023
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        93691      93465245
PAT84        34070      33980300
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164902     19209976
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129398     101135301
PAT90        175304     3330776
PAT91        101388     1926372
PAT92        169171     12412246
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140780     2674820
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6285       65412253
PLN1         59926      93463173
PLN10        37437      49341612
PLN11        40285      65707763
PLN12        22493      123983569
PLN13        21103      99490646
PLN14        17578      144865462
PLN15        17634      146278605
PLN16        17564      146392665
PLN17        24586      128622194
PLN18        6000       149205408
PLN19        1266       170315035
PLN2         35728      120161203
PLN20        14156      155895387
PLN21        7103       8352153
PLN22        67256      69764648
PLN23        29372      31563580
PLN24        76970      76380284
PLN25        65429      81414725
PLN26        44720      113937333
PLN27        34         75811684
PLN28        7          95178561
PLN29        3221       146999678
PLN3         1371       178659253
PLN30        24414      133234946
PLN31        60207      88077020
PLN32        76447      77202326
PLN33        87397      45935818
PLN34        80397      71718429
PLN35        77987      75766440
PLN36        80051      70462089
PLN37        82109      75758894
PLN38        56650      30132100
PLN39        101363     57273545
PLN4         1841       185795876
PLN40        80419      70242455
PLN41        45890      98809051
PLN42        29237      128557189
PLN43        35277      120369599
PLN44        39594      30838008
PLN45        81866      72101718
PLN46        63372      83724076
PLN47        82022      66220880
PLN48        96756      57370804
PLN49        75189      76065653
PLN5         1840       194252368
PLN50        67698      83505588
PLN51        12397      26712969
PLN6         1718       194388080
PLN7         41317      116818464
PLN8         57551      57229514
PLN9         73073      75872678
PRI1         23016      59646733
PRI10        1273       179328175
PRI11        772        93611734
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193666240
PRI18        1099       194310776
PRI19        1166       193657185
PRI2         18207      149518337
PRI20        1747       191731171
PRI21        2653       189798198
PRI22        19156      160472134
PRI23        1526       3656824
PRI24        31573      84616058
PRI25        61950      78204676
PRI26        31351      70630978
PRI27        8521       161714261
PRI28        2251       180515319
PRI29        1618       181509288
PRI3         1433       175223269
PRI30        2007       181705860
PRI31        1958       180727178
PRI32        13182      156344101
PRI33        1328       183749995
PRI34        41721      106651233
PRI35        22913      33113175
PRI36        32189      63608729
PRI37        20137      117669283
PRI38        18568      147184451
PRI39        66602      86841579
PRI4         1284       185574563
PRI40        49475      89694324
PRI41        39350      72157634
PRI42        49771      92743021
PRI43        60562      97712745
PRI44        93         1547959
PRI5         1322       184207047
PRI6         1182       180012329
PRI7         1246       181112619
PRI8         1212       178337989
PRI9         1366       174642897
ROD1         32272      140831988
ROD10        987        181481529
ROD11        232        44057446
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190474838
ROD19        16713      146157502
ROD2         915        175393737
ROD20        20349      148361268
ROD21        1132       182075942
ROD22        1079       168068566
ROD23        13609      162595725
ROD24        38836      69261008
ROD25        21801      104569268
ROD26        1508       187778262
ROD27        135062     36437421
ROD28        84327      70409782
ROD29        43481      50200099
ROD3         905        173297900
ROD4         900        173792415
ROD5         923        174315076
ROD6         966        178209811
ROD7         968        179457909
ROD8         979        181267813
ROD9         994        181774273
STS1         85281      36762778
STS10        57907      44420267
STS11        48910      37503235
STS12        57924      43637361
STS13        64284      42850769
STS14        93606      34184225
STS15        104286     26517062
STS16        10116      2741066
STS17        103611     27476228
STS18        86930      34448685
STS19        99734      33367534
STS2         84354      49850361
STS20        54327      20642138
STS3         66846      26362713
STS4         76990      36946037
STS5         8457       4958885
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55716      37767321
SYN1         43101      76641817
SYN2         49307      68417061
SYN3         8164       18002166
TSA1         120505     38243959
TSA10        111305     38201579
TSA11        97415      30582150
TSA12        41714      15071160
TSA13        86486      70566494
TSA14        121991     38853496
TSA15        134870     35826510
TSA16        60982      79709095
TSA17        39421      53478178
TSA18        74910      95012391
TSA19        107699     49259264
TSA2         113528     41670793
TSA20        105562     50321458
TSA21        102874     54070302
TSA22        106086     46899520
TSA23        28507      19316896
TSA24        66573      59369298
TSA25        90220      62304560
TSA26        90402      75486281
TSA27        81331      74963187
TSA28        113013     34953409
TSA29        105599     51725635
TSA3         110398     41018342
TSA30        42865      35419439
TSA31        117006     42754122
TSA32        100254     55661219
TSA33        102697     54264987
TSA34        82809      85483158
TSA35        66108      27572755
TSA36        91228      72116539
TSA37        96017      56829726
TSA38        65386      106723497
TSA39        97261      72764134
TSA4         110952     45737441
TSA40        80699      75090547
TSA41        93445      82698736
TSA42        89317      71819141
TSA43        35296      23053697
TSA5         43145      10916057
TSA6         112460     59451131
TSA7         95611      66256273
TSA8         105745     68771636
TSA9         105926     64847592
UNA1         238        125011
VRL1         68456      68853819
VRL10        61385      72828120
VRL11        16049      23922693
VRL12        62819      71192980
VRL13        57847      72711571
VRL14        62759      65561568
VRL15        56962      73962654
VRL16        57698      72710846
VRL17        57150      71438600
VRL18        62138      70683914
VRL19        20576      20475260
VRL2         73586      64192857
VRL3         69358      61266502
VRL4         68345      69885400
VRL5         46501      48688636
VRL6         48252      77528882
VRL7         51386      72607834
VRL8         62400      72543180
VRL9         67883      66705120
VRT1         38667      128692952
VRT10        1256       189144082
VRT11        8274       177844568
VRT12        3994       136790703
VRT13        13095      170781188
VRT14        5350       182605112
VRT15        3936       186021840
VRT16        37670      134476492
VRT17        79828      68468972
VRT18        78414      66457916
VRT19        30221      24502651
VRT2         5181       187940109
VRT20        69852      80013325
VRT21        49052      117338288
VRT22        76227      63022804
VRT23        77350      58812938
VRT24        62726      46896308
VRT3         68572      82827797
VRT4         10471      167102341
VRT5         29179      23128761
VRT6         73012      66735777
VRT7         31732      63525748
VRT8         30652      111958169
VRT9         1202       189984871

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 186.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

19389131 15895544290   Homo sapiens
9297024   9123107910   Mus musculus
2187422   6506354371   Rattus norvegicus
2199230   5382894391   Bos taurus
3928465   5056774959   Zea mays
3226627   4818097747   Sus scrofa
1706623   3128271282   Danio rerio
228266    1352950153   Strongylocentrotus purpuratus
1347030   1253079650   Oryza sativa Japonica Group
1770217   1195170506   Nicotiana tabacum
1424329   1147240953   Xenopus (Silurana) tropicalis
2321408   1138974435   Arabidopsis thaliana
1225776   1062326437   Drosophila melanogaster
216415    1007768226   Pan troglodytes
749765     987556313   Vitis vinifera
1454888    948225965   Canis lupus familiaris
813456     898129282   Gallus gallus
1890259    895223341   Glycine max
82782      829872167   Macaca mulatta
738831     805901910   Solanum lycopersicum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 186.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 186.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Gert Roosen, Susan Schafer,
	Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
	Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade,	Constantin Vasilyev

User Support
	Peter Cooper, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center