Release Notes For GenBank Release 187

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2011

               NCBI-GenBank Flat File Release 187.0

                    Distribution Release Notes

 146413798 loci, 135117731375 bases, from 146413798 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 187.0
1.2 Cutoff Date
1.3 Important Changes in Release 187.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 187.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 187.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 187.0, incorporates data available to the collaborating
databases as of December 15, 2011 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 187.0

1.3.1 Organizational changes

The total number of sequence data files increased by 38 with this release:

  - the BCT division is now composed of  80 files (+3)
  - the CON division is now composed of 162 files (+10)
  - the ENV division is now composed of  46 files (+3)
  - the EST division is now composed of 451 files (+1)
  - the GSS division is now composed of 251 files (+3)
  - the INV division is now composed of  32 files (+2)
  - the PAT division is now composed of 173 files (+2)
  - the PLN division is now composed of  52 files (+1)
  - the SYN division is now composed of   7 files (+4)
  - the TSA division is now composed of  51 files (+8)
  - the VRT division is now composed of  25 files (+1)

The total number of 'index' files increased by 2 with this release:

  - the AUT (author name)  index is now composed of 92 files (+1)
  - the JOU (journal name) index is now composed of 13 files (+1)

1.3.2 Project DBLINKs transitioning to BioProject

  The Genome Project Database resource at the NCBI was redesigned in
recent months, culminating in the implementation of a new BioProject
resource:

        http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

An article that describes the goals of BioProject is available:

        http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54015/

BioProject is a collaborative effort of the International Nucleotide
Sequence Database Collaboration (INSDC), and project data are exchanged 
with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject
website is also available at DDBJ:

        http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml

BioProjects are uniquely identified by BioProject Accession Numbers,
which utilize this format:

        "PRJ"
        "E" or "N" or "D"
        one letter
        one or more digits

Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 .

With BioProject now in operation, we are preparing to implement links
from sequence records to the new resource. Previously, links to the
Genome Project Database were provided by numeric 'Project' DBLINKs .
Here's an example for a bacterial complete-genome record:

LOCUS       CP002497             1110245 bp    DNA     linear   PLN 14-NOV-2011
DEFINITION  Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
            sequence.
ACCESSION   CP002497
VERSION     CP002497.1  GI:356887709
DBLINK      Project: 60715

When this link is switched to a BioProject accession, the DBLINK
line will change slightly:

LOCUS       CP002497             1110245 bp    DNA     linear   PLN 14-NOV-2011
DEFINITION  Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
            sequence.
ACCESSION   CP002497
VERSION     CP002497.1  GI:356887709
DBLINK      BioProject: PRJNA60715

In the coming weeks, many millions of sequence records will gradually
be modified, to make use of the new BioProject DBLINK. They will not be
distributed via daily GenBank and RefSeq incremetal update products.
However, these new BioProject links *will* start to be seen in GenBank
and RefSeq release products as of December 2011. In addition, the new
BioProject links will become visible via NCBI's Entrez:Nucleotide
resource, as soon as the modification process begins. 

1.3.3 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 187.0. Consider gbgss149.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        December 15 2011

                NCBI-GenBank Flat File Release 187.0

                           GSS Sequences (Part 1)

   87118 loci,    64000130 bases, from    87118 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "149" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

  There are no changes scheduled for implementation in the April 2012
GenBank Release.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1724 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbbct1.seq - Bacterial sequence entries, part 1.
97. gbbct10.seq - Bacterial sequence entries, part 10.
98. gbbct11.seq - Bacterial sequence entries, part 11.
99. gbbct12.seq - Bacterial sequence entries, part 12.
100. gbbct13.seq - Bacterial sequence entries, part 13.
101. gbbct14.seq - Bacterial sequence entries, part 14.
102. gbbct15.seq - Bacterial sequence entries, part 15.
103. gbbct16.seq - Bacterial sequence entries, part 16.
104. gbbct17.seq - Bacterial sequence entries, part 17.
105. gbbct18.seq - Bacterial sequence entries, part 18.
106. gbbct19.seq - Bacterial sequence entries, part 19.
107. gbbct2.seq - Bacterial sequence entries, part 2.
108. gbbct20.seq - Bacterial sequence entries, part 20.
109. gbbct21.seq - Bacterial sequence entries, part 21.
110. gbbct22.seq - Bacterial sequence entries, part 22.
111. gbbct23.seq - Bacterial sequence entries, part 23.
112. gbbct24.seq - Bacterial sequence entries, part 24.
113. gbbct25.seq - Bacterial sequence entries, part 25.
114. gbbct26.seq - Bacterial sequence entries, part 26.
115. gbbct27.seq - Bacterial sequence entries, part 27.
116. gbbct28.seq - Bacterial sequence entries, part 28.
117. gbbct29.seq - Bacterial sequence entries, part 29.
118. gbbct3.seq - Bacterial sequence entries, part 3.
119. gbbct30.seq - Bacterial sequence entries, part 30.
120. gbbct31.seq - Bacterial sequence entries, part 31.
121. gbbct32.seq - Bacterial sequence entries, part 32.
122. gbbct33.seq - Bacterial sequence entries, part 33.
123. gbbct34.seq - Bacterial sequence entries, part 34.
124. gbbct35.seq - Bacterial sequence entries, part 35.
125. gbbct36.seq - Bacterial sequence entries, part 36.
126. gbbct37.seq - Bacterial sequence entries, part 37.
127. gbbct38.seq - Bacterial sequence entries, part 38.
128. gbbct39.seq - Bacterial sequence entries, part 39.
129. gbbct4.seq - Bacterial sequence entries, part 4.
130. gbbct40.seq - Bacterial sequence entries, part 40.
131. gbbct41.seq - Bacterial sequence entries, part 41.
132. gbbct42.seq - Bacterial sequence entries, part 42.
133. gbbct43.seq - Bacterial sequence entries, part 43.
134. gbbct44.seq - Bacterial sequence entries, part 44.
135. gbbct45.seq - Bacterial sequence entries, part 45.
136. gbbct46.seq - Bacterial sequence entries, part 46.
137. gbbct47.seq - Bacterial sequence entries, part 47.
138. gbbct48.seq - Bacterial sequence entries, part 48.
139. gbbct49.seq - Bacterial sequence entries, part 49.
140. gbbct5.seq - Bacterial sequence entries, part 5.
141. gbbct50.seq - Bacterial sequence entries, part 50.
142. gbbct51.seq - Bacterial sequence entries, part 51.
143. gbbct52.seq - Bacterial sequence entries, part 52.
144. gbbct53.seq - Bacterial sequence entries, part 53.
145. gbbct54.seq - Bacterial sequence entries, part 54.
146. gbbct55.seq - Bacterial sequence entries, part 55.
147. gbbct56.seq - Bacterial sequence entries, part 56.
148. gbbct57.seq - Bacterial sequence entries, part 57.
149. gbbct58.seq - Bacterial sequence entries, part 58.
150. gbbct59.seq - Bacterial sequence entries, part 59.
151. gbbct6.seq - Bacterial sequence entries, part 6.
152. gbbct60.seq - Bacterial sequence entries, part 60.
153. gbbct61.seq - Bacterial sequence entries, part 61.
154. gbbct62.seq - Bacterial sequence entries, part 62.
155. gbbct63.seq - Bacterial sequence entries, part 63.
156. gbbct64.seq - Bacterial sequence entries, part 64.
157. gbbct65.seq - Bacterial sequence entries, part 65.
158. gbbct66.seq - Bacterial sequence entries, part 66.
159. gbbct67.seq - Bacterial sequence entries, part 67.
160. gbbct68.seq - Bacterial sequence entries, part 68.
161. gbbct69.seq - Bacterial sequence entries, part 69.
162. gbbct7.seq - Bacterial sequence entries, part 7.
163. gbbct70.seq - Bacterial sequence entries, part 70.
164. gbbct71.seq - Bacterial sequence entries, part 71.
165. gbbct72.seq - Bacterial sequence entries, part 72.
166. gbbct73.seq - Bacterial sequence entries, part 73.
167. gbbct74.seq - Bacterial sequence entries, part 74.
168. gbbct75.seq - Bacterial sequence entries, part 75.
169. gbbct76.seq - Bacterial sequence entries, part 76.
170. gbbct77.seq - Bacterial sequence entries, part 77.
171. gbbct78.seq - Bacterial sequence entries, part 78.
172. gbbct79.seq - Bacterial sequence entries, part 79.
173. gbbct8.seq - Bacterial sequence entries, part 8.
174. gbbct80.seq - Bacterial sequence entries, part 80.
175. gbbct9.seq - Bacterial sequence entries, part 9.
176. gbchg.txt - Accession numbers of entries updated since the previous release.
177. gbcon1.seq - Constructed sequence entries, part 1.
178. gbcon10.seq - Constructed sequence entries, part 10.
179. gbcon100.seq - Constructed sequence entries, part 100.
180. gbcon101.seq - Constructed sequence entries, part 101.
181. gbcon102.seq - Constructed sequence entries, part 102.
182. gbcon103.seq - Constructed sequence entries, part 103.
183. gbcon104.seq - Constructed sequence entries, part 104.
184. gbcon105.seq - Constructed sequence entries, part 105.
185. gbcon106.seq - Constructed sequence entries, part 106.
186. gbcon107.seq - Constructed sequence entries, part 107.
187. gbcon108.seq - Constructed sequence entries, part 108.
188. gbcon109.seq - Constructed sequence entries, part 109.
189. gbcon11.seq - Constructed sequence entries, part 11.
190. gbcon110.seq - Constructed sequence entries, part 110.
191. gbcon111.seq - Constructed sequence entries, part 111.
192. gbcon112.seq - Constructed sequence entries, part 112.
193. gbcon113.seq - Constructed sequence entries, part 113.
194. gbcon114.seq - Constructed sequence entries, part 114.
195. gbcon115.seq - Constructed sequence entries, part 115.
196. gbcon116.seq - Constructed sequence entries, part 116.
197. gbcon117.seq - Constructed sequence entries, part 117.
198. gbcon118.seq - Constructed sequence entries, part 118.
199. gbcon119.seq - Constructed sequence entries, part 119.
200. gbcon12.seq - Constructed sequence entries, part 12.
201. gbcon120.seq - Constructed sequence entries, part 120.
202. gbcon121.seq - Constructed sequence entries, part 121.
203. gbcon122.seq - Constructed sequence entries, part 122.
204. gbcon123.seq - Constructed sequence entries, part 123.
205. gbcon124.seq - Constructed sequence entries, part 124.
206. gbcon125.seq - Constructed sequence entries, part 125.
207. gbcon126.seq - Constructed sequence entries, part 126.
208. gbcon127.seq - Constructed sequence entries, part 127.
209. gbcon128.seq - Constructed sequence entries, part 128.
210. gbcon129.seq - Constructed sequence entries, part 129.
211. gbcon13.seq - Constructed sequence entries, part 13.
212. gbcon130.seq - Constructed sequence entries, part 130.
213. gbcon131.seq - Constructed sequence entries, part 131.
214. gbcon132.seq - Constructed sequence entries, part 132.
215. gbcon133.seq - Constructed sequence entries, part 133.
216. gbcon134.seq - Constructed sequence entries, part 134.
217. gbcon135.seq - Constructed sequence entries, part 135.
218. gbcon136.seq - Constructed sequence entries, part 136.
219. gbcon137.seq - Constructed sequence entries, part 137.
220. gbcon138.seq - Constructed sequence entries, part 138.
221. gbcon139.seq - Constructed sequence entries, part 139.
222. gbcon14.seq - Constructed sequence entries, part 14.
223. gbcon140.seq - Constructed sequence entries, part 140.
224. gbcon141.seq - Constructed sequence entries, part 141.
225. gbcon142.seq - Constructed sequence entries, part 142.
226. gbcon143.seq - Constructed sequence entries, part 143.
227. gbcon144.seq - Constructed sequence entries, part 144.
228. gbcon145.seq - Constructed sequence entries, part 145.
229. gbcon146.seq - Constructed sequence entries, part 146.
230. gbcon147.seq - Constructed sequence entries, part 147.
231. gbcon148.seq - Constructed sequence entries, part 148.
232. gbcon149.seq - Constructed sequence entries, part 149.
233. gbcon15.seq - Constructed sequence entries, part 15.
234. gbcon150.seq - Constructed sequence entries, part 150.
235. gbcon151.seq - Constructed sequence entries, part 151.
236. gbcon152.seq - Constructed sequence entries, part 152.
237. gbcon153.seq - Constructed sequence entries, part 153.
238. gbcon154.seq - Constructed sequence entries, part 154.
239. gbcon155.seq - Constructed sequence entries, part 155.
240. gbcon156.seq - Constructed sequence entries, part 156.
241. gbcon157.seq - Constructed sequence entries, part 157.
242. gbcon158.seq - Constructed sequence entries, part 158.
243. gbcon159.seq - Constructed sequence entries, part 159.
244. gbcon16.seq - Constructed sequence entries, part 16.
245. gbcon160.seq - Constructed sequence entries, part 160.
246. gbcon161.seq - Constructed sequence entries, part 161.
247. gbcon162.seq - Constructed sequence entries, part 162.
248. gbcon17.seq - Constructed sequence entries, part 17.
249. gbcon18.seq - Constructed sequence entries, part 18.
250. gbcon19.seq - Constructed sequence entries, part 19.
251. gbcon2.seq - Constructed sequence entries, part 2.
252. gbcon20.seq - Constructed sequence entries, part 20.
253. gbcon21.seq - Constructed sequence entries, part 21.
254. gbcon22.seq - Constructed sequence entries, part 22.
255. gbcon23.seq - Constructed sequence entries, part 23.
256. gbcon24.seq - Constructed sequence entries, part 24.
257. gbcon25.seq - Constructed sequence entries, part 25.
258. gbcon26.seq - Constructed sequence entries, part 26.
259. gbcon27.seq - Constructed sequence entries, part 27.
260. gbcon28.seq - Constructed sequence entries, part 28.
261. gbcon29.seq - Constructed sequence entries, part 29.
262. gbcon3.seq - Constructed sequence entries, part 3.
263. gbcon30.seq - Constructed sequence entries, part 30.
264. gbcon31.seq - Constructed sequence entries, part 31.
265. gbcon32.seq - Constructed sequence entries, part 32.
266. gbcon33.seq - Constructed sequence entries, part 33.
267. gbcon34.seq - Constructed sequence entries, part 34.
268. gbcon35.seq - Constructed sequence entries, part 35.
269. gbcon36.seq - Constructed sequence entries, part 36.
270. gbcon37.seq - Constructed sequence entries, part 37.
271. gbcon38.seq - Constructed sequence entries, part 38.
272. gbcon39.seq - Constructed sequence entries, part 39.
273. gbcon4.seq - Constructed sequence entries, part 4.
274. gbcon40.seq - Constructed sequence entries, part 40.
275. gbcon41.seq - Constructed sequence entries, part 41.
276. gbcon42.seq - Constructed sequence entries, part 42.
277. gbcon43.seq - Constructed sequence entries, part 43.
278. gbcon44.seq - Constructed sequence entries, part 44.
279. gbcon45.seq - Constructed sequence entries, part 45.
280. gbcon46.seq - Constructed sequence entries, part 46.
281. gbcon47.seq - Constructed sequence entries, part 47.
282. gbcon48.seq - Constructed sequence entries, part 48.
283. gbcon49.seq - Constructed sequence entries, part 49.
284. gbcon5.seq - Constructed sequence entries, part 5.
285. gbcon50.seq - Constructed sequence entries, part 50.
286. gbcon51.seq - Constructed sequence entries, part 51.
287. gbcon52.seq - Constructed sequence entries, part 52.
288. gbcon53.seq - Constructed sequence entries, part 53.
289. gbcon54.seq - Constructed sequence entries, part 54.
290. gbcon55.seq - Constructed sequence entries, part 55.
291. gbcon56.seq - Constructed sequence entries, part 56.
292. gbcon57.seq - Constructed sequence entries, part 57.
293. gbcon58.seq - Constructed sequence entries, part 58.
294. gbcon59.seq - Constructed sequence entries, part 59.
295. gbcon6.seq - Constructed sequence entries, part 6.
296. gbcon60.seq - Constructed sequence entries, part 60.
297. gbcon61.seq - Constructed sequence entries, part 61.
298. gbcon62.seq - Constructed sequence entries, part 62.
299. gbcon63.seq - Constructed sequence entries, part 63.
300. gbcon64.seq - Constructed sequence entries, part 64.
301. gbcon65.seq - Constructed sequence entries, part 65.
302. gbcon66.seq - Constructed sequence entries, part 66.
303. gbcon67.seq - Constructed sequence entries, part 67.
304. gbcon68.seq - Constructed sequence entries, part 68.
305. gbcon69.seq - Constructed sequence entries, part 69.
306. gbcon7.seq - Constructed sequence entries, part 7.
307. gbcon70.seq - Constructed sequence entries, part 70.
308. gbcon71.seq - Constructed sequence entries, part 71.
309. gbcon72.seq - Constructed sequence entries, part 72.
310. gbcon73.seq - Constructed sequence entries, part 73.
311. gbcon74.seq - Constructed sequence entries, part 74.
312. gbcon75.seq - Constructed sequence entries, part 75.
313. gbcon76.seq - Constructed sequence entries, part 76.
314. gbcon77.seq - Constructed sequence entries, part 77.
315. gbcon78.seq - Constructed sequence entries, part 78.
316. gbcon79.seq - Constructed sequence entries, part 79.
317. gbcon8.seq - Constructed sequence entries, part 8.
318. gbcon80.seq - Constructed sequence entries, part 80.
319. gbcon81.seq - Constructed sequence entries, part 81.
320. gbcon82.seq - Constructed sequence entries, part 82.
321. gbcon83.seq - Constructed sequence entries, part 83.
322. gbcon84.seq - Constructed sequence entries, part 84.
323. gbcon85.seq - Constructed sequence entries, part 85.
324. gbcon86.seq - Constructed sequence entries, part 86.
325. gbcon87.seq - Constructed sequence entries, part 87.
326. gbcon88.seq - Constructed sequence entries, part 88.
327. gbcon89.seq - Constructed sequence entries, part 89.
328. gbcon9.seq - Constructed sequence entries, part 9.
329. gbcon90.seq - Constructed sequence entries, part 90.
330. gbcon91.seq - Constructed sequence entries, part 91.
331. gbcon92.seq - Constructed sequence entries, part 92.
332. gbcon93.seq - Constructed sequence entries, part 93.
333. gbcon94.seq - Constructed sequence entries, part 94.
334. gbcon95.seq - Constructed sequence entries, part 95.
335. gbcon96.seq - Constructed sequence entries, part 96.
336. gbcon97.seq - Constructed sequence entries, part 97.
337. gbcon98.seq - Constructed sequence entries, part 98.
338. gbcon99.seq - Constructed sequence entries, part 99.
339. gbdel.txt - Accession numbers of entries deleted since the previous release.
340. gbenv1.seq - Environmental sampling sequence entries, part 1.
341. gbenv10.seq - Environmental sampling sequence entries, part 10.
342. gbenv11.seq - Environmental sampling sequence entries, part 11.
343. gbenv12.seq - Environmental sampling sequence entries, part 12.
344. gbenv13.seq - Environmental sampling sequence entries, part 13.
345. gbenv14.seq - Environmental sampling sequence entries, part 14.
346. gbenv15.seq - Environmental sampling sequence entries, part 15.
347. gbenv16.seq - Environmental sampling sequence entries, part 16.
348. gbenv17.seq - Environmental sampling sequence entries, part 17.
349. gbenv18.seq - Environmental sampling sequence entries, part 18.
350. gbenv19.seq - Environmental sampling sequence entries, part 19.
351. gbenv2.seq - Environmental sampling sequence entries, part 2.
352. gbenv20.seq - Environmental sampling sequence entries, part 20.
353. gbenv21.seq - Environmental sampling sequence entries, part 21.
354. gbenv22.seq - Environmental sampling sequence entries, part 22.
355. gbenv23.seq - Environmental sampling sequence entries, part 23.
356. gbenv24.seq - Environmental sampling sequence entries, part 24.
357. gbenv25.seq - Environmental sampling sequence entries, part 25.
358. gbenv26.seq - Environmental sampling sequence entries, part 26.
359. gbenv27.seq - Environmental sampling sequence entries, part 27.
360. gbenv28.seq - Environmental sampling sequence entries, part 28.
361. gbenv29.seq - Environmental sampling sequence entries, part 29.
362. gbenv3.seq - Environmental sampling sequence entries, part 3.
363. gbenv30.seq - Environmental sampling sequence entries, part 30.
364. gbenv31.seq - Environmental sampling sequence entries, part 31.
365. gbenv32.seq - Environmental sampling sequence entries, part 32.
366. gbenv33.seq - Environmental sampling sequence entries, part 33.
367. gbenv34.seq - Environmental sampling sequence entries, part 34.
368. gbenv35.seq - Environmental sampling sequence entries, part 35.
369. gbenv36.seq - Environmental sampling sequence entries, part 36.
370. gbenv37.seq - Environmental sampling sequence entries, part 37.
371. gbenv38.seq - Environmental sampling sequence entries, part 38.
372. gbenv39.seq - Environmental sampling sequence entries, part 39.
373. gbenv4.seq - Environmental sampling sequence entries, part 4.
374. gbenv40.seq - Environmental sampling sequence entries, part 40.
375. gbenv41.seq - Environmental sampling sequence entries, part 41.
376. gbenv42.seq - Environmental sampling sequence entries, part 42.
377. gbenv43.seq - Environmental sampling sequence entries, part 43.
378. gbenv44.seq - Environmental sampling sequence entries, part 44.
379. gbenv45.seq - Environmental sampling sequence entries, part 45.
380. gbenv46.seq - Environmental sampling sequence entries, part 46.
381. gbenv5.seq - Environmental sampling sequence entries, part 5.
382. gbenv6.seq - Environmental sampling sequence entries, part 6.
383. gbenv7.seq - Environmental sampling sequence entries, part 7.
384. gbenv8.seq - Environmental sampling sequence entries, part 8.
385. gbenv9.seq - Environmental sampling sequence entries, part 9.
386. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
387. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
388. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
389. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
390. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
391. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
392. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
393. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
394. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
395. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
396. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
397. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
398. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
399. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
400. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
401. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
402. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
403. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
404. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
405. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
406. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
407. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
408. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
409. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
410. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
411. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
412. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
413. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
414. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
415. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
416. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
417. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
418. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
419. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
420. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
421. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
422. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
423. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
424. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
425. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
426. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
427. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
428. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
429. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
430. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
431. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
432. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
433. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
434. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
435. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
436. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
437. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
438. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
439. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
440. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
441. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
442. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
443. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
444. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
445. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
446. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
447. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
448. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
449. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
450. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
451. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
452. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
453. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
454. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
455. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
456. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
457. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
458. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
459. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
460. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
461. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
462. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
463. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
464. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
465. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
466. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
467. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
468. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
469. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
470. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
471. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
472. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
473. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
474. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
475. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
476. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
477. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
478. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
479. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
480. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
481. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
482. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
483. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
484. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
485. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
486. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
487. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
488. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
489. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
490. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
491. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
492. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
493. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
494. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
495. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
496. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
497. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
498. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
499. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
500. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
501. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
502. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
503. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
504. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
505. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
506. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
507. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
508. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
509. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
510. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
511. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
512. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
513. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
514. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
515. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
516. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
517. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
518. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
519. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
520. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
521. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
522. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
523. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
524. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
525. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
526. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
527. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
528. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
529. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
530. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
531. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
532. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
533. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
534. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
535. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
536. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
537. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
538. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
539. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
540. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
541. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
542. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
543. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
544. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
545. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
546. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
547. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
548. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
549. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
550. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
551. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
552. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
553. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
554. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
555. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
556. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
557. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
558. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
559. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
560. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
561. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
562. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
563. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
564. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
565. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
566. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
567. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
568. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
569. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
570. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
571. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
572. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
573. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
574. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
575. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
576. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
577. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
578. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
579. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
580. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
581. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
582. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
583. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
584. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
585. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
586. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
587. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
588. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
589. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
590. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
591. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
592. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
593. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
594. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
595. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
596. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
597. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
598. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
599. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
600. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
601. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
602. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
603. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
604. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
605. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
606. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
607. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
608. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
609. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
610. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
611. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
612. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
613. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
614. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
615. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
616. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
617. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
618. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
619. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
620. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
621. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
622. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
623. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
624. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
625. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
626. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
627. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
628. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
629. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
630. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
631. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
632. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
633. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
634. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
635. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
636. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
637. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
638. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
639. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
640. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
641. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
642. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
643. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
644. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
645. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
646. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
647. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
648. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
649. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
650. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
651. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
652. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
653. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
654. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
655. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
656. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
657. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
658. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
659. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
660. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
661. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
662. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
663. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
664. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
665. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
666. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
667. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
668. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
669. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
670. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
671. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
672. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
673. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
674. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
675. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
676. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
677. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
678. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
679. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
680. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
681. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
682. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
683. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
684. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
685. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
686. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
687. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
688. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
689. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
690. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
691. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
692. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
693. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
694. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
695. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
696. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
697. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
698. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
699. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
700. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
701. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
702. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
703. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
704. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
705. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
706. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
707. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
708. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
709. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
710. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
711. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
712. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
713. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
714. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
715. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
716. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
717. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
718. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
719. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
720. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
721. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
722. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
723. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
724. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
725. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
726. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
727. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
728. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
729. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
730. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
731. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
732. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
733. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
734. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
735. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
736. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
737. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
738. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
739. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
740. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
741. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
742. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
743. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
744. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
745. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
746. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
747. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
748. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
749. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
750. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
751. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
752. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
753. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
754. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
755. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
756. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
757. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
758. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
759. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
760. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
761. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
762. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
763. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
764. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
765. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
766. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
767. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
768. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
769. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
770. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
771. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
772. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
773. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
774. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
775. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
776. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
777. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
778. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
779. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
780. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
781. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
782. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
783. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
784. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
785. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
786. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
787. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
788. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
789. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
790. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
791. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
792. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
793. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
794. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
795. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
796. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
797. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
798. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
799. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
800. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
801. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
802. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
803. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
804. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
805. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
806. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
807. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
808. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
809. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
810. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
811. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
812. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
813. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
814. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
815. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
816. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
817. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
818. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
819. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
820. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
821. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
822. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
823. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
824. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
825. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
826. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
827. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
828. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
829. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
830. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
831. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
832. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
833. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
834. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
835. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
836. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
837. gbgen.idx - Index of the entries according to gene symbols.
838. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
839. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
840. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
841. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
842. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
843. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
844. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
845. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
846. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
847. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
848. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
849. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
850. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
851. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
852. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
853. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
854. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
855. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
856. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
857. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
858. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
859. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
860. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
861. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
862. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
863. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
864. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
865. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
866. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
867. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
868. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
869. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
870. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
871. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
872. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
873. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
874. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
875. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
876. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
877. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
878. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
879. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
880. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
881. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
882. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
883. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
884. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
885. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
886. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
887. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
888. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
889. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
890. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
891. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
892. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
893. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
894. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
895. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
896. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
897. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
898. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
899. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
900. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
901. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
902. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
903. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
904. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
905. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
906. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
907. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
908. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
909. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
910. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
911. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
912. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
913. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
914. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
915. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
916. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
917. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
918. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
919. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
920. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
921. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
922. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
923. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
924. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
925. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
926. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
927. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
928. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
929. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
930. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
931. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
932. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
933. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
934. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
935. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
936. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
937. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
938. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
939. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
940. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
941. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
942. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
943. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
944. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
945. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
946. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
947. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
948. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
949. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
950. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
951. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
952. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
953. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
954. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
955. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
956. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
957. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
958. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
959. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
960. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
961. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
962. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
963. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
964. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
965. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
966. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
967. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
968. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
969. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
970. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
971. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
972. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
973. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
974. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
975. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
976. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
977. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
978. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
979. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
980. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
981. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
982. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
983. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
984. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
985. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
986. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
987. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
988. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
989. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
990. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
991. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
992. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
993. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
994. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
995. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
996. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
997. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
998. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
999. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1000. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1001. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1002. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1003. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1004. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1005. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1006. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1007. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1008. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1009. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1010. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1011. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1012. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1013. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1014. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1015. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1016. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1017. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1018. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1019. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1020. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1021. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1022. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1023. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1024. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1025. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1026. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1027. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1028. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1029. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1030. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1031. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1032. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1033. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1034. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1035. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1036. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1037. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1038. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1039. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1040. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1041. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1042. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1043. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1044. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1045. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1046. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1047. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1048. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1049. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1050. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1051. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1052. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1053. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1054. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1055. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1056. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1057. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1058. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1059. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1060. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1061. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1062. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1063. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1064. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1065. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1066. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1067. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1068. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1069. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1070. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1071. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1072. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1073. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1074. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1075. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1076. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1077. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1078. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1079. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1080. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1081. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1082. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1083. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1084. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1085. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1086. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1087. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1088. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1089. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1090. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1091. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1092. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1093. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1094. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1095. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1096. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1097. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1098. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1099. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1100. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1101. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1102. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1103. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1104. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1105. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1106. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1107. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1108. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1109. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1110. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1111. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1112. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1113. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1114. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1115. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1116. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1117. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1118. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1119. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1120. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1121. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1122. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1123. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1124. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1125. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1126. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1127. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1128. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1129. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1130. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1131. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1132. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1133. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1134. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1135. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1136. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1137. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1138. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1139. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1140. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1141. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1142. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1143. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1144. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1145. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1146. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1147. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1148. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1149. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1150. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1151. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1152. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1153. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1154. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1155. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1156. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1157. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1158. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1159. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1160. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1161. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1162. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1163. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1164. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1165. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1166. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1167. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1168. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1169. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1170. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1171. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1172. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1173. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1174. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1175. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1176. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1177. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1178. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1179. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1180. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1181. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1182. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1183. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1184. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1185. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1186. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1187. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1188. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1189. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1190. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1191. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1192. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1193. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1194. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1195. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1196. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1197. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1198. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1199. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1200. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1201. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1202. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1203. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1204. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1205. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1206. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1207. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1208. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1209. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1210. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1211. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1212. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1213. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1214. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1215. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1216. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1217. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1218. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1219. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1220. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1221. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1222. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1223. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1224. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1225. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1226. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1227. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1228. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1229. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1230. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1231. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1232. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1233. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1234. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1235. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1236. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1237. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1238. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1239. gbinv1.seq - Invertebrate sequence entries, part 1.
1240. gbinv10.seq - Invertebrate sequence entries, part 10.
1241. gbinv11.seq - Invertebrate sequence entries, part 11.
1242. gbinv12.seq - Invertebrate sequence entries, part 12.
1243. gbinv13.seq - Invertebrate sequence entries, part 13.
1244. gbinv14.seq - Invertebrate sequence entries, part 14.
1245. gbinv15.seq - Invertebrate sequence entries, part 15.
1246. gbinv16.seq - Invertebrate sequence entries, part 16.
1247. gbinv17.seq - Invertebrate sequence entries, part 17.
1248. gbinv18.seq - Invertebrate sequence entries, part 18.
1249. gbinv19.seq - Invertebrate sequence entries, part 19.
1250. gbinv2.seq - Invertebrate sequence entries, part 2.
1251. gbinv20.seq - Invertebrate sequence entries, part 20.
1252. gbinv21.seq - Invertebrate sequence entries, part 21.
1253. gbinv22.seq - Invertebrate sequence entries, part 22.
1254. gbinv23.seq - Invertebrate sequence entries, part 23.
1255. gbinv24.seq - Invertebrate sequence entries, part 24.
1256. gbinv25.seq - Invertebrate sequence entries, part 25.
1257. gbinv26.seq - Invertebrate sequence entries, part 26.
1258. gbinv27.seq - Invertebrate sequence entries, part 27.
1259. gbinv28.seq - Invertebrate sequence entries, part 28.
1260. gbinv29.seq - Invertebrate sequence entries, part 29.
1261. gbinv3.seq - Invertebrate sequence entries, part 3.
1262. gbinv30.seq - Invertebrate sequence entries, part 30.
1263. gbinv31.seq - Invertebrate sequence entries, part 31.
1264. gbinv32.seq - Invertebrate sequence entries, part 32.
1265. gbinv4.seq - Invertebrate sequence entries, part 4.
1266. gbinv5.seq - Invertebrate sequence entries, part 5.
1267. gbinv6.seq - Invertebrate sequence entries, part 6.
1268. gbinv7.seq - Invertebrate sequence entries, part 7.
1269. gbinv8.seq - Invertebrate sequence entries, part 8.
1270. gbinv9.seq - Invertebrate sequence entries, part 9.
1271. gbjou1.idx - Index of the entries according to journal citation, part 1.
1272. gbjou10.idx - Index of the entries according to journal citation, part 10.
1273. gbjou11.idx - Index of the entries according to journal citation, part 11.
1274. gbjou12.idx - Index of the entries according to journal citation, part 12.
1275. gbjou13.idx - Index of the entries according to journal citation, part 13.
1276. gbjou2.idx - Index of the entries according to journal citation, part 2.
1277. gbjou3.idx - Index of the entries according to journal citation, part 3.
1278. gbjou4.idx - Index of the entries according to journal citation, part 4.
1279. gbjou5.idx - Index of the entries according to journal citation, part 5.
1280. gbjou6.idx - Index of the entries according to journal citation, part 6.
1281. gbjou7.idx - Index of the entries according to journal citation, part 7.
1282. gbjou8.idx - Index of the entries according to journal citation, part 8.
1283. gbjou9.idx - Index of the entries according to journal citation, part 9.
1284. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1285. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1286. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1287. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1288. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1289. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1290. gbmam1.seq - Other mammalian sequence entries, part 1.
1291. gbmam2.seq - Other mammalian sequence entries, part 2.
1292. gbmam3.seq - Other mammalian sequence entries, part 3.
1293. gbmam4.seq - Other mammalian sequence entries, part 4.
1294. gbmam5.seq - Other mammalian sequence entries, part 5.
1295. gbmam6.seq - Other mammalian sequence entries, part 6.
1296. gbmam7.seq - Other mammalian sequence entries, part 7.
1297. gbnew.txt - Accession numbers of entries new since the previous release.
1298. gbpat1.seq - Patent sequence entries, part 1.
1299. gbpat10.seq - Patent sequence entries, part 10.
1300. gbpat100.seq - Patent sequence entries, part 100.
1301. gbpat101.seq - Patent sequence entries, part 101.
1302. gbpat102.seq - Patent sequence entries, part 102.
1303. gbpat103.seq - Patent sequence entries, part 103.
1304. gbpat104.seq - Patent sequence entries, part 104.
1305. gbpat105.seq - Patent sequence entries, part 105.
1306. gbpat106.seq - Patent sequence entries, part 106.
1307. gbpat107.seq - Patent sequence entries, part 107.
1308. gbpat108.seq - Patent sequence entries, part 108.
1309. gbpat109.seq - Patent sequence entries, part 109.
1310. gbpat11.seq - Patent sequence entries, part 11.
1311. gbpat110.seq - Patent sequence entries, part 110.
1312. gbpat111.seq - Patent sequence entries, part 111.
1313. gbpat112.seq - Patent sequence entries, part 112.
1314. gbpat113.seq - Patent sequence entries, part 113.
1315. gbpat114.seq - Patent sequence entries, part 114.
1316. gbpat115.seq - Patent sequence entries, part 115.
1317. gbpat116.seq - Patent sequence entries, part 116.
1318. gbpat117.seq - Patent sequence entries, part 117.
1319. gbpat118.seq - Patent sequence entries, part 118.
1320. gbpat119.seq - Patent sequence entries, part 119.
1321. gbpat12.seq - Patent sequence entries, part 12.
1322. gbpat120.seq - Patent sequence entries, part 120.
1323. gbpat121.seq - Patent sequence entries, part 121.
1324. gbpat122.seq - Patent sequence entries, part 122.
1325. gbpat123.seq - Patent sequence entries, part 123.
1326. gbpat124.seq - Patent sequence entries, part 124.
1327. gbpat125.seq - Patent sequence entries, part 125.
1328. gbpat126.seq - Patent sequence entries, part 126.
1329. gbpat127.seq - Patent sequence entries, part 127.
1330. gbpat128.seq - Patent sequence entries, part 128.
1331. gbpat129.seq - Patent sequence entries, part 129.
1332. gbpat13.seq - Patent sequence entries, part 13.
1333. gbpat130.seq - Patent sequence entries, part 130.
1334. gbpat131.seq - Patent sequence entries, part 131.
1335. gbpat132.seq - Patent sequence entries, part 132.
1336. gbpat133.seq - Patent sequence entries, part 133.
1337. gbpat134.seq - Patent sequence entries, part 134.
1338. gbpat135.seq - Patent sequence entries, part 135.
1339. gbpat136.seq - Patent sequence entries, part 136.
1340. gbpat137.seq - Patent sequence entries, part 137.
1341. gbpat138.seq - Patent sequence entries, part 138.
1342. gbpat139.seq - Patent sequence entries, part 139.
1343. gbpat14.seq - Patent sequence entries, part 14.
1344. gbpat140.seq - Patent sequence entries, part 140.
1345. gbpat141.seq - Patent sequence entries, part 141.
1346. gbpat142.seq - Patent sequence entries, part 142.
1347. gbpat143.seq - Patent sequence entries, part 143.
1348. gbpat144.seq - Patent sequence entries, part 144.
1349. gbpat145.seq - Patent sequence entries, part 145.
1350. gbpat146.seq - Patent sequence entries, part 146.
1351. gbpat147.seq - Patent sequence entries, part 147.
1352. gbpat148.seq - Patent sequence entries, part 148.
1353. gbpat149.seq - Patent sequence entries, part 149.
1354. gbpat15.seq - Patent sequence entries, part 15.
1355. gbpat150.seq - Patent sequence entries, part 150.
1356. gbpat151.seq - Patent sequence entries, part 151.
1357. gbpat152.seq - Patent sequence entries, part 152.
1358. gbpat153.seq - Patent sequence entries, part 153.
1359. gbpat154.seq - Patent sequence entries, part 154.
1360. gbpat155.seq - Patent sequence entries, part 155.
1361. gbpat156.seq - Patent sequence entries, part 156.
1362. gbpat157.seq - Patent sequence entries, part 157.
1363. gbpat158.seq - Patent sequence entries, part 158.
1364. gbpat159.seq - Patent sequence entries, part 159.
1365. gbpat16.seq - Patent sequence entries, part 16.
1366. gbpat160.seq - Patent sequence entries, part 160.
1367. gbpat161.seq - Patent sequence entries, part 161.
1368. gbpat162.seq - Patent sequence entries, part 162.
1369. gbpat163.seq - Patent sequence entries, part 163.
1370. gbpat164.seq - Patent sequence entries, part 164.
1371. gbpat165.seq - Patent sequence entries, part 165.
1372. gbpat166.seq - Patent sequence entries, part 166.
1373. gbpat167.seq - Patent sequence entries, part 167.
1374. gbpat168.seq - Patent sequence entries, part 168.
1375. gbpat169.seq - Patent sequence entries, part 169.
1376. gbpat17.seq - Patent sequence entries, part 17.
1377. gbpat170.seq - Patent sequence entries, part 170.
1378. gbpat171.seq - Patent sequence entries, part 171.
1379. gbpat172.seq - Patent sequence entries, part 172.
1380. gbpat173.seq - Patent sequence entries, part 173.
1381. gbpat18.seq - Patent sequence entries, part 18.
1382. gbpat19.seq - Patent sequence entries, part 19.
1383. gbpat2.seq - Patent sequence entries, part 2.
1384. gbpat20.seq - Patent sequence entries, part 20.
1385. gbpat21.seq - Patent sequence entries, part 21.
1386. gbpat22.seq - Patent sequence entries, part 22.
1387. gbpat23.seq - Patent sequence entries, part 23.
1388. gbpat24.seq - Patent sequence entries, part 24.
1389. gbpat25.seq - Patent sequence entries, part 25.
1390. gbpat26.seq - Patent sequence entries, part 26.
1391. gbpat27.seq - Patent sequence entries, part 27.
1392. gbpat28.seq - Patent sequence entries, part 28.
1393. gbpat29.seq - Patent sequence entries, part 29.
1394. gbpat3.seq - Patent sequence entries, part 3.
1395. gbpat30.seq - Patent sequence entries, part 30.
1396. gbpat31.seq - Patent sequence entries, part 31.
1397. gbpat32.seq - Patent sequence entries, part 32.
1398. gbpat33.seq - Patent sequence entries, part 33.
1399. gbpat34.seq - Patent sequence entries, part 34.
1400. gbpat35.seq - Patent sequence entries, part 35.
1401. gbpat36.seq - Patent sequence entries, part 36.
1402. gbpat37.seq - Patent sequence entries, part 37.
1403. gbpat38.seq - Patent sequence entries, part 38.
1404. gbpat39.seq - Patent sequence entries, part 39.
1405. gbpat4.seq - Patent sequence entries, part 4.
1406. gbpat40.seq - Patent sequence entries, part 40.
1407. gbpat41.seq - Patent sequence entries, part 41.
1408. gbpat42.seq - Patent sequence entries, part 42.
1409. gbpat43.seq - Patent sequence entries, part 43.
1410. gbpat44.seq - Patent sequence entries, part 44.
1411. gbpat45.seq - Patent sequence entries, part 45.
1412. gbpat46.seq - Patent sequence entries, part 46.
1413. gbpat47.seq - Patent sequence entries, part 47.
1414. gbpat48.seq - Patent sequence entries, part 48.
1415. gbpat49.seq - Patent sequence entries, part 49.
1416. gbpat5.seq - Patent sequence entries, part 5.
1417. gbpat50.seq - Patent sequence entries, part 50.
1418. gbpat51.seq - Patent sequence entries, part 51.
1419. gbpat52.seq - Patent sequence entries, part 52.
1420. gbpat53.seq - Patent sequence entries, part 53.
1421. gbpat54.seq - Patent sequence entries, part 54.
1422. gbpat55.seq - Patent sequence entries, part 55.
1423. gbpat56.seq - Patent sequence entries, part 56.
1424. gbpat57.seq - Patent sequence entries, part 57.
1425. gbpat58.seq - Patent sequence entries, part 58.
1426. gbpat59.seq - Patent sequence entries, part 59.
1427. gbpat6.seq - Patent sequence entries, part 6.
1428. gbpat60.seq - Patent sequence entries, part 60.
1429. gbpat61.seq - Patent sequence entries, part 61.
1430. gbpat62.seq - Patent sequence entries, part 62.
1431. gbpat63.seq - Patent sequence entries, part 63.
1432. gbpat64.seq - Patent sequence entries, part 64.
1433. gbpat65.seq - Patent sequence entries, part 65.
1434. gbpat66.seq - Patent sequence entries, part 66.
1435. gbpat67.seq - Patent sequence entries, part 67.
1436. gbpat68.seq - Patent sequence entries, part 68.
1437. gbpat69.seq - Patent sequence entries, part 69.
1438. gbpat7.seq - Patent sequence entries, part 7.
1439. gbpat70.seq - Patent sequence entries, part 70.
1440. gbpat71.seq - Patent sequence entries, part 71.
1441. gbpat72.seq - Patent sequence entries, part 72.
1442. gbpat73.seq - Patent sequence entries, part 73.
1443. gbpat74.seq - Patent sequence entries, part 74.
1444. gbpat75.seq - Patent sequence entries, part 75.
1445. gbpat76.seq - Patent sequence entries, part 76.
1446. gbpat77.seq - Patent sequence entries, part 77.
1447. gbpat78.seq - Patent sequence entries, part 78.
1448. gbpat79.seq - Patent sequence entries, part 79.
1449. gbpat8.seq - Patent sequence entries, part 8.
1450. gbpat80.seq - Patent sequence entries, part 80.
1451. gbpat81.seq - Patent sequence entries, part 81.
1452. gbpat82.seq - Patent sequence entries, part 82.
1453. gbpat83.seq - Patent sequence entries, part 83.
1454. gbpat84.seq - Patent sequence entries, part 84.
1455. gbpat85.seq - Patent sequence entries, part 85.
1456. gbpat86.seq - Patent sequence entries, part 86.
1457. gbpat87.seq - Patent sequence entries, part 87.
1458. gbpat88.seq - Patent sequence entries, part 88.
1459. gbpat89.seq - Patent sequence entries, part 89.
1460. gbpat9.seq - Patent sequence entries, part 9.
1461. gbpat90.seq - Patent sequence entries, part 90.
1462. gbpat91.seq - Patent sequence entries, part 91.
1463. gbpat92.seq - Patent sequence entries, part 92.
1464. gbpat93.seq - Patent sequence entries, part 93.
1465. gbpat94.seq - Patent sequence entries, part 94.
1466. gbpat95.seq - Patent sequence entries, part 95.
1467. gbpat96.seq - Patent sequence entries, part 96.
1468. gbpat97.seq - Patent sequence entries, part 97.
1469. gbpat98.seq - Patent sequence entries, part 98.
1470. gbpat99.seq - Patent sequence entries, part 99.
1471. gbphg1.seq - Phage sequence entries, part 1.
1472. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1473. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1474. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1475. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1476. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1477. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1478. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1479. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1480. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1481. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1482. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1483. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1484. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1485. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1486. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1487. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1488. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1489. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1490. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1491. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1492. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1493. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1494. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1495. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1496. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1497. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1498. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1499. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1500. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1501. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1502. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1503. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1504. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1505. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1506. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1507. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1508. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1509. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1510. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1511. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1512. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1513. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1514. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1515. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1516. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1517. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1518. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1519. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1520. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1521. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1522. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1523. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1524. gbpri1.seq - Primate sequence entries, part 1.
1525. gbpri10.seq - Primate sequence entries, part 10.
1526. gbpri11.seq - Primate sequence entries, part 11.
1527. gbpri12.seq - Primate sequence entries, part 12.
1528. gbpri13.seq - Primate sequence entries, part 13.
1529. gbpri14.seq - Primate sequence entries, part 14.
1530. gbpri15.seq - Primate sequence entries, part 15.
1531. gbpri16.seq - Primate sequence entries, part 16.
1532. gbpri17.seq - Primate sequence entries, part 17.
1533. gbpri18.seq - Primate sequence entries, part 18.
1534. gbpri19.seq - Primate sequence entries, part 19.
1535. gbpri2.seq - Primate sequence entries, part 2.
1536. gbpri20.seq - Primate sequence entries, part 20.
1537. gbpri21.seq - Primate sequence entries, part 21.
1538. gbpri22.seq - Primate sequence entries, part 22.
1539. gbpri23.seq - Primate sequence entries, part 23.
1540. gbpri24.seq - Primate sequence entries, part 24.
1541. gbpri25.seq - Primate sequence entries, part 25.
1542. gbpri26.seq - Primate sequence entries, part 26.
1543. gbpri27.seq - Primate sequence entries, part 27.
1544. gbpri28.seq - Primate sequence entries, part 28.
1545. gbpri29.seq - Primate sequence entries, part 29.
1546. gbpri3.seq - Primate sequence entries, part 3.
1547. gbpri30.seq - Primate sequence entries, part 30.
1548. gbpri31.seq - Primate sequence entries, part 31.
1549. gbpri32.seq - Primate sequence entries, part 32.
1550. gbpri33.seq - Primate sequence entries, part 33.
1551. gbpri34.seq - Primate sequence entries, part 34.
1552. gbpri35.seq - Primate sequence entries, part 35.
1553. gbpri36.seq - Primate sequence entries, part 36.
1554. gbpri37.seq - Primate sequence entries, part 37.
1555. gbpri38.seq - Primate sequence entries, part 38.
1556. gbpri39.seq - Primate sequence entries, part 39.
1557. gbpri4.seq - Primate sequence entries, part 4.
1558. gbpri40.seq - Primate sequence entries, part 40.
1559. gbpri41.seq - Primate sequence entries, part 41.
1560. gbpri42.seq - Primate sequence entries, part 42.
1561. gbpri43.seq - Primate sequence entries, part 43.
1562. gbpri44.seq - Primate sequence entries, part 44.
1563. gbpri5.seq - Primate sequence entries, part 5.
1564. gbpri6.seq - Primate sequence entries, part 6.
1565. gbpri7.seq - Primate sequence entries, part 7.
1566. gbpri8.seq - Primate sequence entries, part 8.
1567. gbpri9.seq - Primate sequence entries, part 9.
1568. gbrel.txt - Release notes (this document).
1569. gbrod1.seq - Rodent sequence entries, part 1.
1570. gbrod10.seq - Rodent sequence entries, part 10.
1571. gbrod11.seq - Rodent sequence entries, part 11.
1572. gbrod12.seq - Rodent sequence entries, part 12.
1573. gbrod13.seq - Rodent sequence entries, part 13.
1574. gbrod14.seq - Rodent sequence entries, part 14.
1575. gbrod15.seq - Rodent sequence entries, part 15.
1576. gbrod16.seq - Rodent sequence entries, part 16.
1577. gbrod17.seq - Rodent sequence entries, part 17.
1578. gbrod18.seq - Rodent sequence entries, part 18.
1579. gbrod19.seq - Rodent sequence entries, part 19.
1580. gbrod2.seq - Rodent sequence entries, part 2.
1581. gbrod20.seq - Rodent sequence entries, part 20.
1582. gbrod21.seq - Rodent sequence entries, part 21.
1583. gbrod22.seq - Rodent sequence entries, part 22.
1584. gbrod23.seq - Rodent sequence entries, part 23.
1585. gbrod24.seq - Rodent sequence entries, part 24.
1586. gbrod25.seq - Rodent sequence entries, part 25.
1587. gbrod26.seq - Rodent sequence entries, part 26.
1588. gbrod27.seq - Rodent sequence entries, part 27.
1589. gbrod28.seq - Rodent sequence entries, part 28.
1590. gbrod29.seq - Rodent sequence entries, part 29.
1591. gbrod3.seq - Rodent sequence entries, part 3.
1592. gbrod4.seq - Rodent sequence entries, part 4.
1593. gbrod5.seq - Rodent sequence entries, part 5.
1594. gbrod6.seq - Rodent sequence entries, part 6.
1595. gbrod7.seq - Rodent sequence entries, part 7.
1596. gbrod8.seq - Rodent sequence entries, part 8.
1597. gbrod9.seq - Rodent sequence entries, part 9.
1598. gbsdr1.txt - Short directory of the data bank, part 1.
1599. gbsdr2.txt - Short directory of the data bank, part 2.
1600. gbsdr3.txt - Short directory of the data bank, part 3.
1601. gbsec.idx - Index of the entries according to secondary accession number.
1602. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1603. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1604. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1605. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1606. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1607. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1608. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1609. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1610. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1611. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1612. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1613. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1614. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1615. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1616. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1617. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1618. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1619. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1620. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1621. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1622. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1623. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1624. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1625. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1626. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1627. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1628. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1629. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1630. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1631. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1632. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1633. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1634. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1635. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1636. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1637. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1638. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1639. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1640. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1641. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1642. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1643. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1644. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1645. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1646. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1647. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1648. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1649. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1650. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1651. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1652. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1653. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1654. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1655. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1656. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1657. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1658. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1659. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1660. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1661. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1662. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1663. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1664. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1665. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1666. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1667. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1668. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1669. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1670. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1671. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1672. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1673. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1674. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1675. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1676. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1677. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1678. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1679. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1680. gbuna1.seq - Unannotated sequence entries, part 1.
1681. gbvrl1.seq - Viral sequence entries, part 1.
1682. gbvrl10.seq - Viral sequence entries, part 10.
1683. gbvrl11.seq - Viral sequence entries, part 11.
1684. gbvrl12.seq - Viral sequence entries, part 12.
1685. gbvrl13.seq - Viral sequence entries, part 13.
1686. gbvrl14.seq - Viral sequence entries, part 14.
1687. gbvrl15.seq - Viral sequence entries, part 15.
1688. gbvrl16.seq - Viral sequence entries, part 16.
1689. gbvrl17.seq - Viral sequence entries, part 17.
1690. gbvrl18.seq - Viral sequence entries, part 18.
1691. gbvrl19.seq - Viral sequence entries, part 19.
1692. gbvrl2.seq - Viral sequence entries, part 2.
1693. gbvrl3.seq - Viral sequence entries, part 3.
1694. gbvrl4.seq - Viral sequence entries, part 4.
1695. gbvrl5.seq - Viral sequence entries, part 5.
1696. gbvrl6.seq - Viral sequence entries, part 6.
1697. gbvrl7.seq - Viral sequence entries, part 7.
1698. gbvrl8.seq - Viral sequence entries, part 8.
1699. gbvrl9.seq - Viral sequence entries, part 9.
1700. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1701. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1702. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1703. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1704. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1705. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1706. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1707. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1708. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1709. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1710. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1711. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1712. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1713. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1714. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1715. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1716. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1717. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1718. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1719. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1720. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1721. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1722. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1723. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1724. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 187.0 flatfiles require roughly 528 GB (sequence
files only) or 568 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1885314357     gbacc1.idx
2348466384     gbacc2.idx
 818340573     gbacc3.idx
 189647747     gbaut1.idx
 185640298     gbaut10.idx
 251523367     gbaut11.idx
 183827472     gbaut12.idx
 184951564     gbaut13.idx
 184409753     gbaut14.idx
 183804670     gbaut15.idx
 192246434     gbaut16.idx
 185667840     gbaut17.idx
 216036305     gbaut18.idx
 188974587     gbaut19.idx
 229765820     gbaut2.idx
 186462869     gbaut20.idx
 183882167     gbaut21.idx
 241893742     gbaut22.idx
 212636146     gbaut23.idx
 184087751     gbaut24.idx
 183945891     gbaut25.idx
 184103562     gbaut26.idx
 184289699     gbaut27.idx
 205039115     gbaut28.idx
 183856274     gbaut29.idx
 213373844     gbaut3.idx
 208893616     gbaut30.idx
 218148499     gbaut31.idx
 188941175     gbaut32.idx
 186248146     gbaut33.idx
 183920026     gbaut34.idx
 184351906     gbaut35.idx
 187317090     gbaut36.idx
 185609179     gbaut37.idx
 184352250     gbaut38.idx
 214170960     gbaut39.idx
 185979001     gbaut4.idx
 192308684     gbaut40.idx
 239937873     gbaut41.idx
 188783739     gbaut42.idx
 255807628     gbaut43.idx
 188551618     gbaut44.idx
 188102011     gbaut45.idx
 191917498     gbaut46.idx
 185507579     gbaut47.idx
 187526684     gbaut48.idx
 221280975     gbaut49.idx
 222363855     gbaut5.idx
 186766676     gbaut50.idx
 237437427     gbaut51.idx
 190225211     gbaut52.idx
 184708340     gbaut53.idx
 198024663     gbaut54.idx
 201061893     gbaut55.idx
 185752370     gbaut56.idx
 187996553     gbaut57.idx
 184480753     gbaut58.idx
 184337087     gbaut59.idx
 190583089     gbaut6.idx
 202159695     gbaut60.idx
 190131169     gbaut61.idx
 193537970     gbaut62.idx
 186138293     gbaut63.idx
 184196134     gbaut64.idx
 184468958     gbaut65.idx
 189998229     gbaut66.idx
 187421074     gbaut67.idx
 184207269     gbaut68.idx
 189412636     gbaut69.idx
 188580082     gbaut7.idx
 184454523     gbaut70.idx
 184266285     gbaut71.idx
 211226963     gbaut72.idx
 186782286     gbaut73.idx
 252781414     gbaut74.idx
 186232811     gbaut75.idx
 183867824     gbaut76.idx
 193632794     gbaut77.idx
 183937577     gbaut78.idx
 222509144     gbaut79.idx
 192499267     gbaut8.idx
 184517685     gbaut80.idx
 227993581     gbaut81.idx
 186256692     gbaut82.idx
 183917550     gbaut83.idx
 219566450     gbaut84.idx
 185768946     gbaut85.idx
 234322792     gbaut86.idx
 189349379     gbaut87.idx
 184997018     gbaut88.idx
 221496171     gbaut89.idx
 185556373     gbaut9.idx
 185210771     gbaut90.idx
 188986307     gbaut91.idx
   4836236     gbaut92.idx
 249998257     gbbct1.seq
 244870852     gbbct10.seq
 244670109     gbbct11.seq
 233186943     gbbct12.seq
 181029776     gbbct13.seq
 243154484     gbbct14.seq
 249783374     gbbct15.seq
 245549495     gbbct16.seq
 248627303     gbbct17.seq
 248243605     gbbct18.seq
 249284493     gbbct19.seq
 241573761     gbbct2.seq
 246200092     gbbct20.seq
 245694910     gbbct21.seq
 217808117     gbbct22.seq
 242805577     gbbct23.seq
 241842491     gbbct24.seq
 248678252     gbbct25.seq
 247877026     gbbct26.seq
 249389374     gbbct27.seq
 244187726     gbbct28.seq
 247338634     gbbct29.seq
 245705438     gbbct3.seq
 249998777     gbbct30.seq
 249762927     gbbct31.seq
 249793005     gbbct32.seq
 242888185     gbbct33.seq
 241626506     gbbct34.seq
 160069561     gbbct35.seq
 243876217     gbbct36.seq
 246112415     gbbct37.seq
 242768541     gbbct38.seq
 239637661     gbbct39.seq
 249922202     gbbct4.seq
 247212204     gbbct40.seq
 246864528     gbbct41.seq
 245872905     gbbct42.seq
 244941420     gbbct43.seq
 248038663     gbbct44.seq
 248283284     gbbct45.seq
 242735276     gbbct46.seq
 151250627     gbbct47.seq
 245585570     gbbct48.seq
 246901681     gbbct49.seq
 195288570     gbbct5.seq
 246601717     gbbct50.seq
 248689953     gbbct51.seq
 244125814     gbbct52.seq
 247213624     gbbct53.seq
 242491398     gbbct54.seq
 248435631     gbbct55.seq
 245180929     gbbct56.seq
 246497885     gbbct57.seq
 237283737     gbbct58.seq
 243462109     gbbct59.seq
 242135162     gbbct6.seq
 245461104     gbbct60.seq
 155036575     gbbct61.seq
   6887454     gbbct62.seq
  14095594     gbbct63.seq
  23196864     gbbct64.seq
  45093380     gbbct65.seq
  87762917     gbbct66.seq
 169987454     gbbct67.seq
 249998411     gbbct68.seq
 249998155     gbbct69.seq
 247366927     gbbct7.seq
 249300404     gbbct70.seq
 239273292     gbbct71.seq
 248568950     gbbct72.seq
 244248095     gbbct73.seq
 246595163     gbbct74.seq
 249922987     gbbct75.seq
  33696381     gbbct76.seq
 249999457     gbbct77.seq
 249999907     gbbct78.seq
 249997250     gbbct79.seq
 247177589     gbbct8.seq
  58332290     gbbct80.seq
 244872818     gbbct9.seq
  23989770     gbchg.txt
 249999408     gbcon1.seq
 249997306     gbcon10.seq
 249998605     gbcon100.seq
 249998936     gbcon101.seq
 250000223     gbcon102.seq
 156342446     gbcon103.seq
 249996812     gbcon104.seq
 249993767     gbcon105.seq
 249992301     gbcon106.seq
 249998322     gbcon107.seq
  71615782     gbcon108.seq
 249997862     gbcon109.seq
 248094953     gbcon11.seq
 249998650     gbcon110.seq
 208522809     gbcon111.seq
 250000256     gbcon112.seq
 250000098     gbcon113.seq
 249995503     gbcon114.seq
 249706532     gbcon115.seq
 149768887     gbcon116.seq
 249914315     gbcon117.seq
 249999874     gbcon118.seq
 179997601     gbcon119.seq
 249733770     gbcon12.seq
 249997285     gbcon120.seq
 250000110     gbcon121.seq
 249999490     gbcon122.seq
 249844519     gbcon123.seq
  71431703     gbcon124.seq
 249821967     gbcon125.seq
 249803005     gbcon126.seq
 249760241     gbcon127.seq
 249998122     gbcon128.seq
 249995228     gbcon129.seq
 248741698     gbcon13.seq
 249998722     gbcon130.seq
  41196963     gbcon131.seq
 249978699     gbcon132.seq
 249998490     gbcon133.seq
 249993348     gbcon134.seq
 249999880     gbcon135.seq
 249912502     gbcon136.seq
 249948624     gbcon137.seq
 249955490     gbcon138.seq
 233498172     gbcon139.seq
 242279394     gbcon14.seq
 246632492     gbcon140.seq
 247088480     gbcon141.seq
 249512645     gbcon142.seq
 249979552     gbcon143.seq
 108787117     gbcon144.seq
 249999086     gbcon145.seq
 249861094     gbcon146.seq
 249995663     gbcon147.seq
 249972969     gbcon148.seq
 249998239     gbcon149.seq
 249992857     gbcon15.seq
 249990486     gbcon150.seq
 249995058     gbcon151.seq
 249997325     gbcon152.seq
  89770593     gbcon153.seq
 249965787     gbcon154.seq
 249998091     gbcon155.seq
 249999198     gbcon156.seq
 249988455     gbcon157.seq
 249997989     gbcon158.seq
 249902725     gbcon159.seq
 250000201     gbcon16.seq
 249998453     gbcon160.seq
 176467042     gbcon161.seq
  18856067     gbcon162.seq
 194312210     gbcon17.seq
 250000143     gbcon18.seq
 247343830     gbcon19.seq
 249951066     gbcon2.seq
 122899681     gbcon20.seq
 249998352     gbcon21.seq
 120044016     gbcon22.seq
 249996870     gbcon23.seq
 249725403     gbcon24.seq
 249997830     gbcon25.seq
 249998324     gbcon26.seq
 186471703     gbcon27.seq
 249999799     gbcon28.seq
 249997310     gbcon29.seq
 248161967     gbcon3.seq
 249999856     gbcon30.seq
 249999952     gbcon31.seq
 247968421     gbcon32.seq
 232566446     gbcon33.seq
 249999237     gbcon34.seq
 249996869     gbcon35.seq
 249995921     gbcon36.seq
 249996351     gbcon37.seq
 249999450     gbcon38.seq
 249997210     gbcon39.seq
 248979371     gbcon4.seq
  61183731     gbcon40.seq
 249997486     gbcon41.seq
 249994070     gbcon42.seq
 249999391     gbcon43.seq
 249997743     gbcon44.seq
 249994859     gbcon45.seq
  43089049     gbcon46.seq
 249993995     gbcon47.seq
 249996310     gbcon48.seq
 249994442     gbcon49.seq
 249999847     gbcon5.seq
 249997248     gbcon50.seq
 250000078     gbcon51.seq
  36404971     gbcon52.seq
 249993185     gbcon53.seq
 249998119     gbcon54.seq
 249995170     gbcon55.seq
 249998154     gbcon56.seq
 249998078     gbcon57.seq
 152679523     gbcon58.seq
 249999955     gbcon59.seq
 249993464     gbcon6.seq
 249999066     gbcon60.seq
 249997558     gbcon61.seq
 249998625     gbcon62.seq
 183609322     gbcon63.seq
 249999870     gbcon64.seq
 249997967     gbcon65.seq
 249997138     gbcon66.seq
 249995207     gbcon67.seq
 245488804     gbcon68.seq
 250000182     gbcon69.seq
 231273459     gbcon7.seq
 249998695     gbcon70.seq
 249998372     gbcon71.seq
 249996966     gbcon72.seq
 250000007     gbcon73.seq
  96627683     gbcon74.seq
 249993448     gbcon75.seq
 249995119     gbcon76.seq
 249997383     gbcon77.seq
 249995948     gbcon78.seq
 249999042     gbcon79.seq
 249997708     gbcon8.seq
  62682749     gbcon80.seq
 249997771     gbcon81.seq
 249996653     gbcon82.seq
 249999445     gbcon83.seq
 249999590     gbcon84.seq
 249998149     gbcon85.seq
  21674116     gbcon86.seq
 249998140     gbcon87.seq
 249997503     gbcon88.seq
 249996940     gbcon89.seq
 249996514     gbcon9.seq
 249995720     gbcon90.seq
 197881888     gbcon91.seq
 249993974     gbcon92.seq
 249996060     gbcon93.seq
 249999726     gbcon94.seq
 249998645     gbcon95.seq
 249996901     gbcon96.seq
 133265984     gbcon97.seq
 249994222     gbcon98.seq
 249995659     gbcon99.seq
    490277     gbdel.txt
 249999505     gbenv1.seq
 249999234     gbenv10.seq
  55949411     gbenv11.seq
 249996628     gbenv12.seq
 249999695     gbenv13.seq
 249999231     gbenv14.seq
 249998919     gbenv15.seq
 249997516     gbenv16.seq
 249999827     gbenv17.seq
 249997983     gbenv18.seq
   2959488     gbenv19.seq
 249997290     gbenv2.seq
 249999805     gbenv20.seq
 249999753     gbenv21.seq
 250000074     gbenv22.seq
 249999944     gbenv23.seq
 128034581     gbenv24.seq
 249999646     gbenv25.seq
 249998286     gbenv26.seq
 249998656     gbenv27.seq
 249999332     gbenv28.seq
 249999168     gbenv29.seq
 249997602     gbenv3.seq
 104629850     gbenv30.seq
 249998069     gbenv31.seq
 249997176     gbenv32.seq
 249998334     gbenv33.seq
 249996672     gbenv34.seq
 134285230     gbenv35.seq
 249999798     gbenv36.seq
 249998209     gbenv37.seq
 249998110     gbenv38.seq
 249997289     gbenv39.seq
 249999245     gbenv4.seq
 120995166     gbenv40.seq
 249999972     gbenv41.seq
 249999727     gbenv42.seq
 249998516     gbenv43.seq
 249997332     gbenv44.seq
 250000053     gbenv45.seq
    730326     gbenv46.seq
 249998493     gbenv5.seq
 204121471     gbenv6.seq
 249998535     gbenv7.seq
 249998988     gbenv8.seq
 249998993     gbenv9.seq
 524292008     gbest1.seq
 524289074     gbest10.seq
 524289941     gbest100.seq
 524291337     gbest101.seq
 524289859     gbest102.seq
 524290377     gbest103.seq
 356067172     gbest104.seq
 524290444     gbest105.seq
 524289882     gbest106.seq
 498295264     gbest107.seq
 388468596     gbest108.seq
 387567407     gbest109.seq
 524290873     gbest11.seq
 383140776     gbest110.seq
 384246085     gbest111.seq
 384330199     gbest112.seq
 381683980     gbest113.seq
 391864302     gbest114.seq
 387826689     gbest115.seq
 386125537     gbest116.seq
 384279666     gbest117.seq
 411713195     gbest118.seq
 524290061     gbest119.seq
 524291034     gbest12.seq
 524289592     gbest120.seq
 524290024     gbest121.seq
 524288922     gbest122.seq
 524290082     gbest123.seq
 463054937     gbest124.seq
 524291624     gbest125.seq
 524292219     gbest126.seq
 524289117     gbest127.seq
 524290681     gbest128.seq
 524289762     gbest129.seq
 156627343     gbest13.seq
 524292389     gbest130.seq
 524288898     gbest131.seq
 524289254     gbest132.seq
 524291522     gbest133.seq
 524288794     gbest134.seq
 524290255     gbest135.seq
 524289041     gbest136.seq
 274581986     gbest137.seq
 524290088     gbest138.seq
 524291115     gbest139.seq
 524289253     gbest14.seq
 524289955     gbest140.seq
 524290676     gbest141.seq
 524289958     gbest142.seq
 524291533     gbest143.seq
 524290922     gbest144.seq
 524292349     gbest145.seq
 524292861     gbest146.seq
 524291433     gbest147.seq
 524289744     gbest148.seq
 524290145     gbest149.seq
 524289698     gbest15.seq
 524291097     gbest150.seq
 477294858     gbest151.seq
 524291695     gbest152.seq
 524289611     gbest153.seq
 524291256     gbest154.seq
 524289499     gbest155.seq
 524290144     gbest156.seq
 524289849     gbest157.seq
 524292518     gbest158.seq
 524291675     gbest159.seq
 524289586     gbest16.seq
 499690374     gbest160.seq
 524291603     gbest161.seq
 524288766     gbest162.seq
 524289117     gbest163.seq
 245963826     gbest164.seq
 524292103     gbest165.seq
 524292621     gbest166.seq
 524289353     gbest167.seq
 524292232     gbest168.seq
 524289609     gbest169.seq
 524290180     gbest17.seq
 524294671     gbest170.seq
 524290722     gbest171.seq
 524290087     gbest172.seq
 524289184     gbest173.seq
 524290877     gbest174.seq
 524291150     gbest175.seq
 524289134     gbest176.seq
 524291010     gbest177.seq
 101090672     gbest178.seq
 524291028     gbest179.seq
 524290798     gbest18.seq
 524291534     gbest180.seq
 524289802     gbest181.seq
 524289618     gbest182.seq
 524291344     gbest183.seq
 524290675     gbest184.seq
 524292509     gbest185.seq
 524289936     gbest186.seq
 524290013     gbest187.seq
 524290420     gbest188.seq
 524289856     gbest189.seq
 524290082     gbest19.seq
 524290662     gbest190.seq
 456797124     gbest191.seq
 524290487     gbest192.seq
 524292834     gbest193.seq
 524290284     gbest194.seq
 524291563     gbest195.seq
 524293488     gbest196.seq
 524291444     gbest197.seq
 524291365     gbest198.seq
 524291354     gbest199.seq
 524289694     gbest2.seq
 524290005     gbest20.seq
 524288759     gbest200.seq
 524291753     gbest201.seq
 524289692     gbest202.seq
 524289087     gbest203.seq
 524289424     gbest204.seq
  97021668     gbest205.seq
 524290842     gbest206.seq
 524291427     gbest207.seq
 524289426     gbest208.seq
 524291070     gbest209.seq
 524289853     gbest21.seq
 524291423     gbest210.seq
 524289678     gbest211.seq
 524290929     gbest212.seq
 524289112     gbest213.seq
 524289214     gbest214.seq
 524291403     gbest215.seq
 429494611     gbest216.seq
 524290473     gbest217.seq
 524293339     gbest218.seq
 524289897     gbest219.seq
 511864268     gbest22.seq
 524291187     gbest220.seq
 524289475     gbest221.seq
 524290819     gbest222.seq
 524290615     gbest223.seq
 524289003     gbest224.seq
 524289093     gbest225.seq
 524288735     gbest226.seq
 524290442     gbest227.seq
 524289326     gbest228.seq
 524291624     gbest229.seq
 500398505     gbest23.seq
 374660805     gbest230.seq
 524290691     gbest231.seq
 524292109     gbest232.seq
 524292590     gbest233.seq
 524291253     gbest234.seq
 524289017     gbest235.seq
 524289882     gbest236.seq
 524290265     gbest237.seq
 524292038     gbest238.seq
 524290201     gbest239.seq
 509309105     gbest24.seq
 524289523     gbest240.seq
 524289744     gbest241.seq
 524290687     gbest242.seq
 524289519     gbest243.seq
 524290932     gbest244.seq
  50535914     gbest245.seq
 524292939     gbest246.seq
 524289295     gbest247.seq
 524293048     gbest248.seq
 524290879     gbest249.seq
 319190837     gbest25.seq
 524291116     gbest250.seq
 524291189     gbest251.seq
 524288750     gbest252.seq
 524290912     gbest253.seq
 524290564     gbest254.seq
 524291150     gbest255.seq
 524291730     gbest256.seq
 239359530     gbest257.seq
 524289595     gbest258.seq
 524289082     gbest259.seq
 524290900     gbest26.seq
 524288973     gbest260.seq
 524290025     gbest261.seq
 524288733     gbest262.seq
 524289158     gbest263.seq
 524290336     gbest264.seq
 524290548     gbest265.seq
 524289274     gbest266.seq
 524291618     gbest267.seq
 287356802     gbest268.seq
 524289035     gbest269.seq
 524289014     gbest27.seq
 524289329     gbest270.seq
 524289147     gbest271.seq
 524290891     gbest272.seq
 524289147     gbest273.seq
 524290008     gbest274.seq
 524289946     gbest275.seq
 524288802     gbest276.seq
 524289456     gbest277.seq
 524289549     gbest278.seq
 524290995     gbest279.seq
 524289431     gbest28.seq
 295102228     gbest280.seq
 524292118     gbest281.seq
 524290436     gbest282.seq
 524289271     gbest283.seq
 524289600     gbest284.seq
 524289583     gbest285.seq
 524289567     gbest286.seq
 524290162     gbest287.seq
 524290559     gbest288.seq
 524290249     gbest289.seq
 524291872     gbest29.seq
 524292289     gbest290.seq
 524290741     gbest291.seq
 230566281     gbest292.seq
 524290179     gbest293.seq
 524290782     gbest294.seq
 524289305     gbest295.seq
 524290091     gbest296.seq
 524289112     gbest297.seq
 524291671     gbest298.seq
 524288830     gbest299.seq
 497701912     gbest3.seq
 524292549     gbest30.seq
 524289671     gbest300.seq
 479526564     gbest301.seq
 485146985     gbest302.seq
 486608996     gbest303.seq
 314744731     gbest304.seq
 524290628     gbest305.seq
 524289741     gbest306.seq
 524292696     gbest307.seq
 524292374     gbest308.seq
 524290518     gbest309.seq
 524288756     gbest31.seq
 524289916     gbest310.seq
 524289442     gbest311.seq
 524288906     gbest312.seq
 524291344     gbest313.seq
 524289175     gbest314.seq
 524289161     gbest315.seq
 524289240     gbest316.seq
 512942060     gbest317.seq
 524290413     gbest318.seq
 524291177     gbest319.seq
 524289945     gbest32.seq
 524290316     gbest320.seq
 524288958     gbest321.seq
 524289150     gbest322.seq
 524291748     gbest323.seq
 524292355     gbest324.seq
 524291825     gbest325.seq
 524290651     gbest326.seq
 524291809     gbest327.seq
 524288804     gbest328.seq
 524290732     gbest329.seq
 524290428     gbest33.seq
 524290347     gbest330.seq
 264869903     gbest331.seq
 524289235     gbest332.seq
 524289103     gbest333.seq
 524289402     gbest334.seq
 524290279     gbest335.seq
 524292490     gbest336.seq
 524291369     gbest337.seq
 524291958     gbest338.seq
 524289531     gbest339.seq
 519456801     gbest34.seq
 524289274     gbest340.seq
 524288812     gbest341.seq
 524290275     gbest342.seq
 524290311     gbest343.seq
 524289384     gbest344.seq
 342817293     gbest345.seq
 524292279     gbest346.seq
 524289013     gbest347.seq
 524290634     gbest348.seq
 524291018     gbest349.seq
 492728679     gbest35.seq
 524289723     gbest350.seq
 524291207     gbest351.seq
 524292426     gbest352.seq
 524289998     gbest353.seq
 524289656     gbest354.seq
 524292632     gbest355.seq
 524288735     gbest356.seq
 524290284     gbest357.seq
 524290671     gbest358.seq
 504309765     gbest359.seq
 494454216     gbest36.seq
 524289178     gbest360.seq
 524289492     gbest361.seq
 524290217     gbest362.seq
 524290520     gbest363.seq
 524291853     gbest364.seq
 524291199     gbest365.seq
 524289560     gbest366.seq
 524289528     gbest367.seq
 524289431     gbest368.seq
 524289294     gbest369.seq
 493339530     gbest37.seq
 461370203     gbest370.seq
 524288795     gbest371.seq
 524290205     gbest372.seq
 524289492     gbest373.seq
 524288911     gbest374.seq
 524291811     gbest375.seq
 524289458     gbest376.seq
 506124913     gbest377.seq
 524289348     gbest378.seq
 524289212     gbest379.seq
 487999109     gbest38.seq
 524289492     gbest380.seq
 524290197     gbest381.seq
 278283086     gbest382.seq
 524289306     gbest383.seq
 524291164     gbest384.seq
 524290909     gbest385.seq
 524289644     gbest386.seq
 524289721     gbest387.seq
 524291701     gbest388.seq
 524291075     gbest389.seq
 493269666     gbest39.seq
 524289397     gbest390.seq
 524290364     gbest391.seq
 524289695     gbest392.seq
 524289232     gbest393.seq
 356844306     gbest394.seq
 524288851     gbest395.seq
 524290861     gbest396.seq
 524288821     gbest397.seq
 524291643     gbest398.seq
 524290466     gbest399.seq
 524288944     gbest4.seq
 111902842     gbest40.seq
 524290793     gbest400.seq
 524290579     gbest401.seq
 524291034     gbest402.seq
 524291077     gbest403.seq
 524290126     gbest404.seq
 524289469     gbest405.seq
 524290854     gbest406.seq
 433248342     gbest407.seq
 524290123     gbest408.seq
 524289683     gbest409.seq
 524292786     gbest41.seq
 524289600     gbest410.seq
 524289699     gbest411.seq
 524291338     gbest412.seq
 524289395     gbest413.seq
 524289242     gbest414.seq
 524289080     gbest415.seq
 524292511     gbest416.seq
 524289202     gbest417.seq
 524289966     gbest418.seq
 524293090     gbest419.seq
 524289049     gbest42.seq
 524290049     gbest420.seq
 524290533     gbest421.seq
  32063648     gbest422.seq
 524292183     gbest423.seq
 524288845     gbest424.seq
 524289762     gbest425.seq
 524290959     gbest426.seq
 524289051     gbest427.seq
 524288913     gbest428.seq
 524291358     gbest429.seq
 524290510     gbest43.seq
 524289052     gbest430.seq
 524291278     gbest431.seq
 524291228     gbest432.seq
 524291773     gbest433.seq
 524288728     gbest434.seq
 449759673     gbest435.seq
 524292241     gbest436.seq
 524291901     gbest437.seq
 524290114     gbest438.seq
 524290470     gbest439.seq
 524289998     gbest44.seq
 524290276     gbest440.seq
 524291128     gbest441.seq
 524288756     gbest442.seq
 524291040     gbest443.seq
 524290882     gbest444.seq
 524290762     gbest445.seq
 524290989     gbest446.seq
 351781490     gbest447.seq
 524290945     gbest448.seq
 524291028     gbest449.seq
 524291194     gbest45.seq
 524288964     gbest450.seq
 452152779     gbest451.seq
 524290826     gbest46.seq
 524291225     gbest47.seq
 524289098     gbest48.seq
 524290212     gbest49.seq
 524289625     gbest5.seq
 524291211     gbest50.seq
 524290427     gbest51.seq
 524289076     gbest52.seq
 524290444     gbest53.seq
 272796696     gbest54.seq
 524290709     gbest55.seq
 524288752     gbest56.seq
 524290193     gbest57.seq
 524290427     gbest58.seq
 524290141     gbest59.seq
 524288762     gbest6.seq
 524292004     gbest60.seq
 524291197     gbest61.seq
 524290276     gbest62.seq
 524290080     gbest63.seq
 524290124     gbest64.seq
 524289673     gbest65.seq
 524288847     gbest66.seq
 464657769     gbest67.seq
 524290678     gbest68.seq
 524288774     gbest69.seq
 524291131     gbest7.seq
 524290941     gbest70.seq
 524289318     gbest71.seq
 524289634     gbest72.seq
 524289100     gbest73.seq
 524292074     gbest74.seq
 524292948     gbest75.seq
 524289093     gbest76.seq
 524289770     gbest77.seq
 524290895     gbest78.seq
 524289743     gbest79.seq
 524289317     gbest8.seq
 203796750     gbest80.seq
 524290390     gbest81.seq
 524289764     gbest82.seq
 524289928     gbest83.seq
 524289428     gbest84.seq
 524289004     gbest85.seq
 524292142     gbest86.seq
 524291795     gbest87.seq
 524290656     gbest88.seq
 524291123     gbest89.seq
 524292211     gbest9.seq
 524289995     gbest90.seq
 524291340     gbest91.seq
 448864914     gbest92.seq
 524291246     gbest93.seq
 524291357     gbest94.seq
 524291406     gbest95.seq
 524292756     gbest96.seq
 524290446     gbest97.seq
 524291978     gbest98.seq
 524288877     gbest99.seq
 177359014     gbgen.idx
 524290312     gbgss1.seq
 524291523     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524290642     gbgss103.seq
 418359951     gbgss104.seq
 524290801     gbgss105.seq
 524290943     gbgss106.seq
 524290652     gbgss107.seq
 524289339     gbgss108.seq
 524289785     gbgss109.seq
 524292188     gbgss11.seq
 524291091     gbgss110.seq
 524290077     gbgss111.seq
 524289903     gbgss112.seq
 524290560     gbgss113.seq
 524290818     gbgss114.seq
 524289833     gbgss115.seq
  55545305     gbgss116.seq
 524289697     gbgss117.seq
 524288912     gbgss118.seq
 524289314     gbgss119.seq
 524289997     gbgss12.seq
 524288887     gbgss120.seq
 524289936     gbgss121.seq
 524289166     gbgss122.seq
 524288921     gbgss123.seq
 524289103     gbgss124.seq
 524289552     gbgss125.seq
 524289600     gbgss126.seq
 524290475     gbgss127.seq
 524289083     gbgss128.seq
 229915473     gbgss129.seq
 524288852     gbgss13.seq
 524289187     gbgss130.seq
 524288934     gbgss131.seq
 524289981     gbgss132.seq
 524290857     gbgss133.seq
 524289683     gbgss134.seq
 524291558     gbgss135.seq
 524292251     gbgss136.seq
 524291729     gbgss137.seq
 524290034     gbgss138.seq
 515988605     gbgss139.seq
 524288998     gbgss14.seq
 516017830     gbgss140.seq
 103887015     gbgss141.seq
 524289324     gbgss142.seq
 524289797     gbgss143.seq
 524291421     gbgss144.seq
 524290358     gbgss145.seq
 524288787     gbgss146.seq
 524289733     gbgss147.seq
 221712385     gbgss148.seq
 249997973     gbgss149.seq
 524291185     gbgss15.seq
 249999361     gbgss150.seq
 249999987     gbgss151.seq
 249999769     gbgss152.seq
  28622349     gbgss153.seq
 249997137     gbgss154.seq
 250000033     gbgss155.seq
 249998542     gbgss156.seq
 249998333     gbgss157.seq
 224919493     gbgss158.seq
 249998415     gbgss159.seq
 524290859     gbgss16.seq
 249998761     gbgss160.seq
 249998880     gbgss161.seq
 249997763     gbgss162.seq
 189046598     gbgss163.seq
 249999433     gbgss164.seq
 249998390     gbgss165.seq
 249999267     gbgss166.seq
 249997904     gbgss167.seq
 249997062     gbgss168.seq
  76835987     gbgss169.seq
 524290670     gbgss17.seq
 249998100     gbgss170.seq
   2079852     gbgss171.seq
  79542394     gbgss172.seq
 249999009     gbgss173.seq
 250000259     gbgss174.seq
  87380505     gbgss175.seq
 249999685     gbgss176.seq
 249998355     gbgss177.seq
 249998984     gbgss178.seq
 202719103     gbgss179.seq
 524290328     gbgss18.seq
 249999232     gbgss180.seq
 249999013     gbgss181.seq
 249998851     gbgss182.seq
 246250899     gbgss183.seq
 249999268     gbgss184.seq
 249997406     gbgss185.seq
 249999279     gbgss186.seq
 243520281     gbgss187.seq
 249999336     gbgss188.seq
 249997150     gbgss189.seq
 314841901     gbgss19.seq
 249998209     gbgss190.seq
 249998771     gbgss191.seq
 122182588     gbgss192.seq
 249998013     gbgss193.seq
 250000031     gbgss194.seq
 249999974     gbgss195.seq
 249998152     gbgss196.seq
  94058788     gbgss197.seq
 249998892     gbgss198.seq
 249999850     gbgss199.seq
 524289034     gbgss2.seq
 524288952     gbgss20.seq
 249998239     gbgss200.seq
 249999582     gbgss201.seq
 179090630     gbgss202.seq
 249999236     gbgss203.seq
 249997993     gbgss204.seq
 249998006     gbgss205.seq
 249999353     gbgss206.seq
  95926739     gbgss207.seq
 249999461     gbgss208.seq
 249999350     gbgss209.seq
 524289034     gbgss21.seq
 249998406     gbgss210.seq
 249998619     gbgss211.seq
 249999398     gbgss212.seq
 249999995     gbgss213.seq
  17245248     gbgss214.seq
 249999424     gbgss215.seq
 249999963     gbgss216.seq
 249997369     gbgss217.seq
  43648880     gbgss218.seq
  52862187     gbgss219.seq
 524291398     gbgss22.seq
 249997605     gbgss220.seq
 249998120     gbgss221.seq
 250000111     gbgss222.seq
 249999449     gbgss223.seq
  30198048     gbgss224.seq
 249997670     gbgss225.seq
 249997588     gbgss226.seq
 249999018     gbgss227.seq
 250000000     gbgss228.seq
  28042636     gbgss229.seq
 524290800     gbgss23.seq
 249997661     gbgss230.seq
 249998578     gbgss231.seq
 249998526     gbgss232.seq
 249998842     gbgss233.seq
 249999591     gbgss234.seq
 249998244     gbgss235.seq
 178918094     gbgss236.seq
 249999812     gbgss237.seq
 249998926     gbgss238.seq
 249999095     gbgss239.seq
 524291392     gbgss24.seq
 220154622     gbgss240.seq
 250000034     gbgss241.seq
 249997956     gbgss242.seq
 250000074     gbgss243.seq
 249998729     gbgss244.seq
 195288113     gbgss245.seq
 249999561     gbgss246.seq
 249998751     gbgss247.seq
 249999600     gbgss248.seq
 249999029     gbgss249.seq
 524290581     gbgss25.seq
 249999714     gbgss250.seq
  16550601     gbgss251.seq
 524290713     gbgss26.seq
 524289900     gbgss27.seq
 524288854     gbgss28.seq
 524289528     gbgss29.seq
 524289102     gbgss3.seq
 524289655     gbgss30.seq
  38849864     gbgss31.seq
 524289075     gbgss32.seq
 524290723     gbgss33.seq
 524288828     gbgss34.seq
 524289728     gbgss35.seq
 524289696     gbgss36.seq
 524289533     gbgss37.seq
 524289071     gbgss38.seq
 509087433     gbgss39.seq
 524290615     gbgss4.seq
 524290362     gbgss40.seq
 524289231     gbgss41.seq
 524291640     gbgss42.seq
  28732657     gbgss43.seq
 524288882     gbgss44.seq
 524291090     gbgss45.seq
 524290976     gbgss46.seq
 524290985     gbgss47.seq
 209346767     gbgss48.seq
 524291863     gbgss49.seq
 168350020     gbgss5.seq
 524291582     gbgss50.seq
 524290401     gbgss51.seq
 524290464     gbgss52.seq
 524290548     gbgss53.seq
 524290689     gbgss54.seq
 524289963     gbgss55.seq
 524289945     gbgss56.seq
 524290428     gbgss57.seq
 524291284     gbgss58.seq
 524290900     gbgss59.seq
 524290951     gbgss6.seq
   5856233     gbgss60.seq
 524289023     gbgss61.seq
 524290882     gbgss62.seq
 524290246     gbgss63.seq
 457238462     gbgss64.seq
 524290719     gbgss65.seq
 524291022     gbgss66.seq
 524290625     gbgss67.seq
 524289509     gbgss68.seq
 524291296     gbgss69.seq
 524291125     gbgss7.seq
 524290162     gbgss70.seq
 524290171     gbgss71.seq
 524290218     gbgss72.seq
 524289197     gbgss73.seq
 524291503     gbgss74.seq
 524289627     gbgss75.seq
 524291206     gbgss76.seq
  32487361     gbgss77.seq
 524289473     gbgss78.seq
 524291931     gbgss79.seq
 524291964     gbgss8.seq
 524289482     gbgss80.seq
 524290727     gbgss81.seq
 524289703     gbgss82.seq
 524289751     gbgss83.seq
 524289336     gbgss84.seq
 524290248     gbgss85.seq
 524289011     gbgss86.seq
 524292247     gbgss87.seq
 524290044     gbgss88.seq
 376569727     gbgss89.seq
 524290754     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249992912     gbhtc1.seq
 249998309     gbhtc10.seq
 203719899     gbhtc11.seq
 249997534     gbhtc12.seq
 249996680     gbhtc13.seq
  59200540     gbhtc14.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  83873876     gbhtc8.seq
 249999684     gbhtc9.seq
 249904748     gbhtg1.seq
 249863408     gbhtg10.seq
 249917503     gbhtg100.seq
 249844944     gbhtg101.seq
 249902534     gbhtg102.seq
 249987058     gbhtg103.seq
   5671243     gbhtg104.seq
 249895747     gbhtg105.seq
 249878056     gbhtg106.seq
 249900312     gbhtg107.seq
 249786423     gbhtg108.seq
 249827267     gbhtg109.seq
   1107147     gbhtg11.seq
 249767975     gbhtg110.seq
 249985519     gbhtg111.seq
 249735288     gbhtg112.seq
 246382142     gbhtg113.seq
 184661487     gbhtg114.seq
 249974219     gbhtg115.seq
 249840707     gbhtg116.seq
 249918615     gbhtg117.seq
 249806582     gbhtg118.seq
 249809192     gbhtg119.seq
 249658387     gbhtg12.seq
  53790815     gbhtg120.seq
 249981598     gbhtg121.seq
 249775521     gbhtg122.seq
 249957990     gbhtg123.seq
 249851165     gbhtg124.seq
 249786532     gbhtg125.seq
 135017451     gbhtg126.seq
 249793216     gbhtg127.seq
 249694802     gbhtg128.seq
 249842811     gbhtg129.seq
 249699749     gbhtg13.seq
 249805555     gbhtg130.seq
 249804237     gbhtg131.seq
 249990551     gbhtg132.seq
 249825549     gbhtg133.seq
 249808878     gbhtg134.seq
 249887748     gbhtg135.seq
  75526063     gbhtg136.seq
 249765870     gbhtg14.seq
 249760883     gbhtg15.seq
 249872612     gbhtg16.seq
 249832528     gbhtg17.seq
 249983662     gbhtg18.seq
 249677291     gbhtg19.seq
 249994630     gbhtg2.seq
 249988730     gbhtg20.seq
 237145184     gbhtg21.seq
 249760624     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761207     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249848514     gbhtg29.seq
 249950135     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249920767     gbhtg33.seq
 249929437     gbhtg34.seq
 249919058     gbhtg35.seq
 249852033     gbhtg36.seq
 249814604     gbhtg37.seq
 249767419     gbhtg38.seq
 249627604     gbhtg39.seq
 249984089     gbhtg4.seq
 249839726     gbhtg40.seq
 224363115     gbhtg41.seq
 249889211     gbhtg42.seq
 249786793     gbhtg43.seq
 249972417     gbhtg44.seq
 249775813     gbhtg45.seq
 249913172     gbhtg46.seq
 249597238     gbhtg47.seq
 249865052     gbhtg48.seq
 249793005     gbhtg49.seq
 249882044     gbhtg5.seq
 249922691     gbhtg50.seq
 235040940     gbhtg51.seq
 249732550     gbhtg52.seq
 249918496     gbhtg53.seq
 249773098     gbhtg54.seq
 249971361     gbhtg55.seq
 249962512     gbhtg56.seq
  18795863     gbhtg57.seq
 249936487     gbhtg58.seq
 249908655     gbhtg59.seq
 249898460     gbhtg6.seq
 249826456     gbhtg60.seq
 249862655     gbhtg61.seq
 225820664     gbhtg62.seq
 249840063     gbhtg63.seq
 249787680     gbhtg64.seq
 249883568     gbhtg65.seq
 249980692     gbhtg66.seq
 249833261     gbhtg67.seq
  16614633     gbhtg68.seq
 249960711     gbhtg69.seq
 249933725     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249976816     gbhtg72.seq
 225297470     gbhtg73.seq
 249811185     gbhtg74.seq
 249874975     gbhtg75.seq
 249800054     gbhtg76.seq
 249959610     gbhtg77.seq
 244236501     gbhtg78.seq
 249883367     gbhtg79.seq
 249933567     gbhtg8.seq
 249989452     gbhtg80.seq
 249839493     gbhtg81.seq
 249838775     gbhtg82.seq
 216752366     gbhtg83.seq
 249967233     gbhtg84.seq
 249803266     gbhtg85.seq
 249758161     gbhtg86.seq
 249850280     gbhtg87.seq
 220831167     gbhtg88.seq
 249970134     gbhtg89.seq
 249923766     gbhtg9.seq
 249954241     gbhtg90.seq
 249845350     gbhtg91.seq
 249992122     gbhtg92.seq
 209091181     gbhtg93.seq
 249866071     gbhtg94.seq
 249975867     gbhtg95.seq
 249904055     gbhtg96.seq
 249804025     gbhtg97.seq
 168109739     gbhtg98.seq
 249744688     gbhtg99.seq
 250000210     gbinv1.seq
 249999064     gbinv10.seq
 163214707     gbinv11.seq
 249998593     gbinv12.seq
 249999247     gbinv13.seq
 249999375     gbinv14.seq
 146622403     gbinv15.seq
 248907789     gbinv16.seq
 248493845     gbinv17.seq
 249991043     gbinv18.seq
 249998281     gbinv19.seq
 249981584     gbinv2.seq
 249998305     gbinv20.seq
  76495806     gbinv21.seq
 244702685     gbinv22.seq
 175453836     gbinv23.seq
 249998067     gbinv24.seq
 249997362     gbinv25.seq
 249998223     gbinv26.seq
 210234332     gbinv27.seq
 249998389     gbinv28.seq
 249998474     gbinv29.seq
 216371754     gbinv3.seq
 249999287     gbinv30.seq
 249989087     gbinv31.seq
 104516992     gbinv32.seq
 249995301     gbinv4.seq
 249998797     gbinv5.seq
 249998383     gbinv6.seq
 224196115     gbinv7.seq
 249999008     gbinv8.seq
 249999323     gbinv9.seq
 139995141     gbjou1.idx
 292082659     gbjou10.idx
 259945829     gbjou11.idx
 211862728     gbjou12.idx
   8015630     gbjou13.idx
 140465418     gbjou2.idx
 158710202     gbjou3.idx
 189508008     gbjou4.idx
 271860560     gbjou5.idx
 275973554     gbjou6.idx
 281097012     gbjou7.idx
 282979171     gbjou8.idx
 305517191     gbjou9.idx
 328451860     gbkey1.idx
 180060483     gbkey2.idx
 185465758     gbkey3.idx
 240768528     gbkey4.idx
 183434753     gbkey5.idx
 112128439     gbkey6.idx
 249814599     gbmam1.seq
 249999313     gbmam2.seq
 249818846     gbmam3.seq
 249999129     gbmam4.seq
 249998473     gbmam5.seq
 249996485     gbmam6.seq
 205618671     gbmam7.seq
  34062753     gbnew.txt
 249999770     gbpat1.seq
 249999477     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192934358     gbpat107.seq
 249999374     gbpat108.seq
 249999625     gbpat109.seq
 179586962     gbpat11.seq
 249996079     gbpat110.seq
  80123880     gbpat111.seq
 249999775     gbpat112.seq
 249998903     gbpat113.seq
 249990767     gbpat114.seq
 249999878     gbpat115.seq
 249849703     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 250000151     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 249995168     gbpat13.seq
 249997452     gbpat130.seq
  66832984     gbpat131.seq
 249992315     gbpat132.seq
 249999867     gbpat133.seq
 250000197     gbpat134.seq
 249999821     gbpat135.seq
 249998337     gbpat136.seq
 180628585     gbpat137.seq
 249998039     gbpat138.seq
 250000068     gbpat139.seq
 249998803     gbpat14.seq
 250000015     gbpat140.seq
  86028783     gbpat141.seq
 249999922     gbpat142.seq
 249997624     gbpat143.seq
 249999906     gbpat144.seq
  63539765     gbpat145.seq
 249995994     gbpat146.seq
 249999922     gbpat147.seq
 250000217     gbpat148.seq
 249999438     gbpat149.seq
 250000208     gbpat15.seq
 249999327     gbpat150.seq
 249997656     gbpat151.seq
 222137516     gbpat152.seq
 250000249     gbpat153.seq
 249999893     gbpat154.seq
 249999893     gbpat155.seq
 220539897     gbpat156.seq
 249999753     gbpat157.seq
 249998715     gbpat158.seq
 249999474     gbpat159.seq
 249999915     gbpat16.seq
  12381933     gbpat160.seq
 249997013     gbpat161.seq
 249998113     gbpat162.seq
 249999692     gbpat163.seq
 250000126     gbpat164.seq
  35343603     gbpat165.seq
 249998580     gbpat166.seq
 249998972     gbpat167.seq
 249999265     gbpat168.seq
 249999777     gbpat169.seq
  65896429     gbpat17.seq
 249998978     gbpat170.seq
 249999754     gbpat171.seq
 249999829     gbpat172.seq
 245475035     gbpat173.seq
 250000027     gbpat18.seq
 249999801     gbpat19.seq
 249999577     gbpat2.seq
 249999076     gbpat20.seq
 249996878     gbpat21.seq
 185824949     gbpat22.seq
 249999010     gbpat23.seq
 249856602     gbpat24.seq
 249999342     gbpat25.seq
 249999337     gbpat26.seq
  71191909     gbpat27.seq
 249986007     gbpat28.seq
 249998672     gbpat29.seq
 249999257     gbpat3.seq
 249997815     gbpat30.seq
 249999828     gbpat31.seq
 250000149     gbpat32.seq
 180194087     gbpat33.seq
 249997849     gbpat34.seq
 249999790     gbpat35.seq
 249998836     gbpat36.seq
 250000122     gbpat37.seq
 130534023     gbpat38.seq
 249996259     gbpat39.seq
 249998049     gbpat4.seq
 249991603     gbpat40.seq
 249999077     gbpat41.seq
 250000259     gbpat42.seq
 249995261     gbpat43.seq
 249844966     gbpat44.seq
 249999190     gbpat45.seq
 250000078     gbpat46.seq
 171468074     gbpat47.seq
 249999830     gbpat48.seq
 249998527     gbpat49.seq
  71794649     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164989631     gbpat56.seq
 249883089     gbpat57.seq
 249999314     gbpat58.seq
 249999611     gbpat59.seq
 249999527     gbpat6.seq
 249999026     gbpat60.seq
 134923873     gbpat61.seq
 249998978     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999577     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249999627     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244403395     gbpat72.seq
 248969066     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999901     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249991456     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 250000008     gbpat82.seq
 250000127     gbpat83.seq
  93331147     gbpat84.seq
 249155538     gbpat85.seq
 249999421     gbpat86.seq
 249999867     gbpat87.seq
 249999359     gbpat88.seq
 249999368     gbpat89.seq
 249999342     gbpat9.seq
 250000155     gbpat90.seq
 145293161     gbpat91.seq
 249999076     gbpat92.seq
 249998980     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196964910     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 171577011     gbphg1.seq
 249997909     gbpln1.seq
 250000036     gbpln10.seq
 249995940     gbpln11.seq
 249894997     gbpln12.seq
 214538339     gbpln13.seq
 249998215     gbpln14.seq
 249985349     gbpln15.seq
 249996352     gbpln16.seq
 249429028     gbpln17.seq
 249983070     gbpln18.seq
 249606536     gbpln19.seq
 249853654     gbpln2.seq
 249999605     gbpln20.seq
  33446710     gbpln21.seq
 249999308     gbpln22.seq
  97584419     gbpln23.seq
 249999270     gbpln24.seq
 249998346     gbpln25.seq
 249390857     gbpln26.seq
 221100868     gbpln27.seq
 247981553     gbpln28.seq
 249923572     gbpln29.seq
 249925094     gbpln3.seq
 249856103     gbpln30.seq
 249998570     gbpln31.seq
 249999030     gbpln32.seq
 217495983     gbpln33.seq
 249999653     gbpln34.seq
 249998807     gbpln35.seq
 249999225     gbpln36.seq
 249998322     gbpln37.seq
 135929383     gbpln38.seq
 249972413     gbpln39.seq
 249899590     gbpln4.seq
 249999846     gbpln40.seq
 248401991     gbpln41.seq
 249998841     gbpln42.seq
 249994533     gbpln43.seq
 221073128     gbpln44.seq
 249999800     gbpln45.seq
 246763278     gbpln46.seq
 249998557     gbpln47.seq
 249998324     gbpln48.seq
 249996347     gbpln49.seq
 249875917     gbpln5.seq
 249997469     gbpln50.seq
 249995929     gbpln51.seq
 152739715     gbpln52.seq
 249935469     gbpln6.seq
 249999166     gbpln7.seq
 223220687     gbpln8.seq
 249998292     gbpln9.seq
 148949677     gbpri1.seq
 249783195     gbpri10.seq
 129741660     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902427     gbpri16.seq
 249876185     gbpri17.seq
 249991978     gbpri18.seq
 249902736     gbpri19.seq
 249938401     gbpri2.seq
 249956081     gbpri20.seq
 249962924     gbpri21.seq
 249999165     gbpri22.seq
  19313989     gbpri23.seq
 177481062     gbpri24.seq
 249996771     gbpri25.seq
 211364614     gbpri26.seq
 249987118     gbpri27.seq
 249852372     gbpri28.seq
 249948820     gbpri29.seq
 249938535     gbpri3.seq
 249937231     gbpri30.seq
 249957235     gbpri31.seq
 249855729     gbpri32.seq
 249968208     gbpri33.seq
 249998158     gbpri34.seq
  95882107     gbpri35.seq
 249993971     gbpri36.seq
 249998537     gbpri37.seq
 249973130     gbpri38.seq
 249996382     gbpri39.seq
 249901006     gbpri4.seq
 250000137     gbpri40.seq
 180400983     gbpri41.seq
 250000164     gbpri42.seq
 249988140     gbpri43.seq
  39133617     gbpri44.seq
 249831515     gbpri5.seq
 249788332     gbpri6.seq
 249806906     gbpri7.seq
 249867498     gbpri8.seq
 249957345     gbpri9.seq
    312984     gbrel.txt
 249987622     gbrod1.seq
 249952616     gbrod10.seq
  60961015     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249824677     gbrod18.seq
 241737195     gbrod19.seq
 249835135     gbrod2.seq
 249767699     gbrod20.seq
 249924095     gbrod21.seq
 230194968     gbrod22.seq
 249998267     gbrod23.seq
 249999871     gbrod24.seq
 249938826     gbrod25.seq
 249698931     gbrod26.seq
 250000151     gbrod27.seq
 249998490     gbrod28.seq
 170553895     gbrod29.seq
 249815915     gbrod3.seq
 249956027     gbrod4.seq
 249987585     gbrod5.seq
 249985583     gbrod6.seq
 249746791     gbrod7.seq
 249760313     gbrod8.seq
 249867062     gbrod9.seq
3916738292     gbsdr1.txt
5703319493     gbsdr2.txt
2646536733     gbsdr3.txt
 157801052     gbsec.idx
 249997389     gbsts1.seq
 249997720     gbsts10.seq
 210919464     gbsts11.seq
 249996524     gbsts12.seq
 249999349     gbsts13.seq
 249999266     gbsts14.seq
 249999572     gbsts15.seq
  24470469     gbsts16.seq
 249999107     gbsts17.seq
 249997790     gbsts18.seq
 249999071     gbsts19.seq
 249998220     gbsts2.seq
 147052162     gbsts20.seq
 249999008     gbsts3.seq
 249998277     gbsts4.seq
  39162150     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998706     gbsts9.seq
 249998674     gbsyn1.seq
 249606507     gbsyn2.seq
 249961000     gbsyn3.seq
 249985866     gbsyn4.seq
 249950700     gbsyn5.seq
 249994925     gbsyn6.seq
 128375178     gbsyn7.seq
 249999675     gbtsa1.seq
 249996722     gbtsa10.seq
 249998933     gbtsa11.seq
 103907265     gbtsa12.seq
 249997835     gbtsa13.seq
 249999221     gbtsa14.seq
 249998017     gbtsa15.seq
 250000059     gbtsa16.seq
 167332404     gbtsa17.seq
 249998217     gbtsa18.seq
 249998887     gbtsa19.seq
 249999837     gbtsa2.seq
 249998368     gbtsa20.seq
 249997867     gbtsa21.seq
 249999537     gbtsa22.seq
 250000048     gbtsa23.seq
  29793689     gbtsa24.seq
 249998710     gbtsa25.seq
 249997475     gbtsa26.seq
 249998934     gbtsa27.seq
 249999882     gbtsa28.seq
 249998307     gbtsa29.seq
 250000222     gbtsa3.seq
 249999868     gbtsa30.seq
 119964559     gbtsa31.seq
 250000015     gbtsa32.seq
 249998533     gbtsa33.seq
 249998116     gbtsa34.seq
 249999499     gbtsa35.seq
 249998894     gbtsa36.seq
  17368850     gbtsa37.seq
 249998927     gbtsa38.seq
 249999797     gbtsa39.seq
 249999115     gbtsa4.seq
 249999340     gbtsa40.seq
 249997527     gbtsa41.seq
 249999345     gbtsa42.seq
 109806121     gbtsa43.seq
 249995009     gbtsa44.seq
 249996881     gbtsa45.seq
 249999075     gbtsa46.seq
 249998563     gbtsa47.seq
 250000122     gbtsa48.seq
 249998908     gbtsa49.seq
  83114656     gbtsa5.seq
 249999104     gbtsa50.seq
  51087549     gbtsa51.seq
 249999422     gbtsa6.seq
 249998425     gbtsa7.seq
 249997712     gbtsa8.seq
 249999770     gbtsa9.seq
    483312     gbuna1.seq
 249997873     gbvrl1.seq
 249996895     gbvrl10.seq
 105574277     gbvrl11.seq
 250000197     gbvrl12.seq
 250000047     gbvrl13.seq
 249999602     gbvrl14.seq
 249999307     gbvrl15.seq
 249321791     gbvrl16.seq
 249997137     gbvrl17.seq
 249997751     gbvrl18.seq
 206430051     gbvrl19.seq
 249992676     gbvrl2.seq
 249995305     gbvrl3.seq
 249997548     gbvrl4.seq
 182660396     gbvrl5.seq
 249996646     gbvrl6.seq
 249998347     gbvrl7.seq
 249991590     gbvrl8.seq
 249998834     gbvrl9.seq
 249918245     gbvrt1.seq
 249762539     gbvrt10.seq
 249940020     gbvrt11.seq
 185678776     gbvrt12.seq
 249995062     gbvrt13.seq
 249964366     gbvrt14.seq
 249831294     gbvrt15.seq
 249999676     gbvrt16.seq
 249998857     gbvrt17.seq
 250000052     gbvrt18.seq
  97748436     gbvrt19.seq
 249998652     gbvrt2.seq
 249893734     gbvrt20.seq
 250000089     gbvrt21.seq
 249999275     gbvrt22.seq
 250000195     gbvrt23.seq
 249998072     gbvrt24.seq
  32858249     gbvrt25.seq
 249978768     gbvrt3.seq
 249994860     gbvrt4.seq
  90943917     gbvrt5.seq
 249995156     gbvrt6.seq
 249994002     gbvrt7.seq
 249811786     gbvrt8.seq
 249951536     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64619      87327389
BCT10        64         115520696
BCT11        93         115223175
BCT12        92         107627430
BCT13        16109      76375795
BCT14        53933      85390732
BCT15        93         110189094
BCT16        151        93915681
BCT17        61         112455059
BCT18        52         112042350
BCT19        46         114233015
BCT2         388        108330800
BCT20        58         114931588
BCT21        67         111284815
BCT22        36         96325907
BCT23        40         106881287
BCT24        58         105533856
BCT25        74         111675186
BCT26        55         110045255
BCT27        63         106845575
BCT28        55         109391288
BCT29        53         108650404
BCT3         51         111931329
BCT30        46         110496749
BCT31        95         109522868
BCT32        59         110966729
BCT33        67         108616570
BCT34        124        106350090
BCT35        36         69419425
BCT36        202        109105429
BCT37        51         109861512
BCT38        40         106911174
BCT39        54         104252121
BCT4         57         110372672
BCT40        58         107350200
BCT41        44         110960713
BCT42        80         107599606
BCT43        52         108571742
BCT44        46         107138318
BCT45        63         108219635
BCT46        73         107730422
BCT47        61         68565025
BCT48        67         107603750
BCT49        63         105184773
BCT5         38311      73304524
BCT50        50         106266960
BCT51        57         108862370
BCT52        55         106463399
BCT53        65         111133232
BCT54        59         102966532
BCT55        53         109217037
BCT56        57         111684194
BCT57        63         108996551
BCT58        60         109345964
BCT59        68         106172262
BCT6         39043      82651736
BCT60        220        98447010
BCT61        390        58676219
BCT62        1589       2511877
BCT63        3179       5215895
BCT64        6347       7901828
BCT65        12648      15076611
BCT66        25628      27748212
BCT67        50523      53965859
BCT68        76420      77512573
BCT69        71630      77262084
BCT7         5523       96146388
BCT70        8858       96283826
BCT71        5304       100122217
BCT72        2997       106775929
BCT73        68         115951486
BCT74        6336       109551182
BCT75        30606      97643228
BCT76        11226      8266002
BCT77        74026      79704731
BCT78        76752      78871851
BCT79        56544      87806094
BCT8         13866      90149060
BCT80        11090      20709562
BCT9         6715       96271807
ENV1         94396      71530918
ENV10        83176      87258007
ENV11        20145      17415525
ENV12        84810      80888385
ENV13        120560     43439426
ENV14        88796      78160979
ENV15        96643      67757348
ENV16        96103      63441595
ENV17        90452      68435862
ENV18        64859      87002629
ENV19        766        1026325
ENV2         91062      69244491
ENV20        69532      85606513
ENV21        93878      72072769
ENV22        128738     31411615
ENV23        123342     29527954
ENV24        63653      14252683
ENV25        123141     49877914
ENV26        97281      68277637
ENV27        117149     55513740
ENV28        137677     52403153
ENV29        105856     60488810
ENV3         91926      72141807
ENV30        36061      35145478
ENV31        71058      96548027
ENV32        95516      69583521
ENV33        107777     43884780
ENV34        89889      67102437
ENV35        56665      35541750
ENV36        111412     47256188
ENV37        103962     58917645
ENV38        108816     63013322
ENV39        72626      93515776
ENV4         80881      85477472
ENV40        34084      46268924
ENV41        79713      81984809
ENV42        109906     53839265
ENV43        113964     56656311
ENV44        95158      66870881
ENV45        101596     46276467
ENV46        301        211804
ENV5         89111      85925763
ENV6         85572      50214327
ENV7         131779     31253773
ENV8         86385      70481479
ENV9         93283      72934827
EST1         158932     61578479
EST10        167449     72157693
EST100       226264     140239030
EST101       227876     115659958
EST102       201207     104812696
EST103       172048     100993598
EST104       102141     80099408
EST105       165086     110960002
EST106       168528     110445423
EST107       117336     68340860
EST108       63863      23527312
EST109       64115      22727247
EST11        169551     73990710
EST110       64332      23421594
EST111       64296      27232269
EST112       64304      21892571
EST113       65713      25960282
EST114       63774      27850880
EST115       64286      26247748
EST116       64525      26965223
EST117       64244      25128362
EST118       61232      38021283
EST119       162068     76978898
EST12        166812     70069138
EST120       174823     86140156
EST121       158477     92898019
EST122       149626     95761470
EST123       153477     89559420
EST124       125895     78316874
EST125       202876     99251380
EST126       153535     79573162
EST127       157661     84198371
EST128       155783     89048296
EST129       149626     79582445
EST13        72705      34876658
EST130       174498     101221879
EST131       199755     116492004
EST132       182924     99395258
EST133       162692     84591078
EST134       158421     80023195
EST135       145997     89295313
EST136       142146     85882253
EST137       93960      49352258
EST138       188208     107207834
EST139       232320     102104376
EST14        217988     109456242
EST140       153006     89673673
EST141       168259     91528147
EST142       146979     87095506
EST143       137540     86872541
EST144       157511     95441425
EST145       146282     76542576
EST146       123493     64366210
EST147       121742     65859590
EST148       129203     54566656
EST149       127602     50731917
EST15        168489     105323905
EST150       128339     51062112
EST151       119510     45393000
EST152       171932     86436994
EST153       180065     80258706
EST154       154571     109521263
EST155       211737     129261883
EST156       215403     119898276
EST157       174370     93061333
EST158       147408     112021960
EST159       134124     83157659
EST16        179030     112340883
EST160       156525     97667283
EST161       150052     80146888
EST162       141889     81673231
EST163       169010     94499284
EST164       72883      43840217
EST165       154566     95973326
EST166       188984     106150288
EST167       142570     78072923
EST168       135424     71890069
EST169       168420     93997944
EST17        195242     112993027
EST170       180129     103517714
EST171       150835     94209885
EST172       171475     83616440
EST173       129354     86247752
EST174       182229     107546020
EST175       165194     93333050
EST176       112545     66624592
EST177       163589     93256132
EST178       34629      21962390
EST179       169046     101010968
EST18        190718     121438479
EST180       181553     127496330
EST181       148667     106501243
EST182       190804     99674572
EST183       152886     115940268
EST184       144193     86864102
EST185       145316     82971082
EST186       177764     71832083
EST187       149424     84312691
EST188       155253     97131850
EST189       162785     99942769
EST19        159308     114088825
EST190       141941     88206001
EST191       162266     94469043
EST192       133847     89815602
EST193       131320     88449325
EST194       144697     89213599
EST195       134192     89314169
EST196       124147     87244129
EST197       172860     92208130
EST198       173996     95857982
EST199       173451     96327628
EST2         161860     61550624
EST20        187007     99412696
EST200       171159     96079264
EST201       168284     94223546
EST202       172234     95843600
EST203       173453     95045773
EST204       173997     95579785
EST205       32356      17599756
EST206       191192     103860812
EST207       202395     106546783
EST208       174614     105291990
EST209       183709     103813415
EST21        217124     106452918
EST210       197199     118617362
EST211       195653     116446218
EST212       182857     121372720
EST213       173963     104901932
EST214       214267     146906621
EST215       237786     107491349
EST216       139202     108165098
EST217       150828     101459894
EST218       146713     91000518
EST219       205555     111408664
EST22        198770     65908970
EST220       171945     113775039
EST221       100185     91317408
EST222       142439     110343573
EST223       160803     94661715
EST224       145877     106332710
EST225       216127     100562202
EST226       144412     101968476
EST227       137794     96801288
EST228       140542     100912570
EST229       121075     86007085
EST23        140942     40081726
EST230       95695      61724965
EST231       141393     91619041
EST232       133048     97997496
EST233       137799     98181253
EST234       123958     84447235
EST235       132222     86600160
EST236       158280     116644654
EST237       143671     116995349
EST238       133488     113383325
EST239       154628     95286229
EST24        103789     28102424
EST240       178327     113048072
EST241       146211     92209735
EST242       179473     112186411
EST243       164720     122949344
EST244       139003     103048825
EST245       13131      10472727
EST246       164769     100715186
EST247       231024     96831275
EST248       152333     113395857
EST249       179043     65377464
EST25        121302     50818612
EST250       216978     49806618
EST251       212610     81919314
EST252       171046     131501472
EST253       165350     101327338
EST254       168720     107661767
EST255       164593     111354626
EST256       166281     117351978
EST257       87224      44496316
EST258       187591     98402776
EST259       176363     111518975
EST26        213567     97133327
EST260       165212     109295991
EST261       233047     110552516
EST262       278130     120160552
EST263       184069     112101583
EST264       187448     36827978
EST265       259245     124372995
EST266       151670     94525410
EST267       161064     104987823
EST268       96160      56018597
EST269       173742     118483168
EST27        219261     110222276
EST270       183789     98700893
EST271       172057     113342036
EST272       182216     105531859
EST273       207953     36905660
EST274       191199     55938776
EST275       185605     105747028
EST276       187420     118404378
EST277       173153     113469739
EST278       179819     102531780
EST279       156381     104417915
EST28        190448     88579855
EST280       111506     37195441
EST281       129801     81757918
EST282       132785     85924949
EST283       156013     100637050
EST284       259867     27444795
EST285       263841     24255453
EST286       146647     105820732
EST287       168721     109252025
EST288       161515     103060934
EST289       155504     91159662
EST29        157995     68875086
EST290       264850     31949915
EST291       164956     108052496
EST292       73943      43160506
EST293       185007     111270455
EST294       149043     90703586
EST295       195134     109696615
EST296       164589     114984956
EST297       161883     104490591
EST298       189230     113750292
EST299       179275     100240141
EST3         153644     54437600
EST30        171542     69631452
EST300       181271     103445328
EST301       188367     64361365
EST302       187449     69698119
EST303       187278     70914975
EST304       122787     47113483
EST305       187228     91670741
EST306       181996     133366149
EST307       149886     86380523
EST308       154273     90662203
EST309       128684     100409459
EST31        148896     63217399
EST310       156980     97939654
EST311       170066     97314905
EST312       154900     96757068
EST313       170654     98554535
EST314       157284     105098731
EST315       145691     101403563
EST316       164996     106723135
EST317       156933     115226420
EST318       182340     153708339
EST319       172842     94542230
EST32        168362     76138490
EST320       134412     84965336
EST321       144064     99147104
EST322       140792     94013032
EST323       139703     91324294
EST324       145691     101484586
EST325       151004     101275980
EST326       179196     106400488
EST327       149692     86839432
EST328       151777     86235882
EST329       155374     112729467
EST33        173962     66610573
EST330       158723     94822422
EST331       74390      49422874
EST332       138931     86948346
EST333       153225     95119495
EST334       205828     106193333
EST335       114770     63282157
EST336       102993     65457450
EST337       132636     88739418
EST338       139004     87949026
EST339       122654     75453980
EST34        122831     43242860
EST340       216763     82746611
EST341       181917     86359510
EST342       157361     95282890
EST343       178249     108962362
EST344       150977     90107696
EST345       83956      55221692
EST346       134753     90084495
EST347       146546     95386965
EST348       187026     116555652
EST349       158380     90858403
EST35        97393      29892123
EST350       174616     99974568
EST351       176093     129458614
EST352       81143      49245404
EST353       85774      48302868
EST354       146467     84400465
EST355       131112     77302782
EST356       157942     42002454
EST357       158937     31661733
EST358       156737     49816859
EST359       183581     119658352
EST36        97797      30586622
EST360       247326     114307512
EST361       250821     114811592
EST362       176175     99708914
EST363       142342     92334245
EST364       137895     86153507
EST365       156652     93375963
EST366       194499     119600627
EST367       222572     59058877
EST368       184838     112918675
EST369       222186     121724992
EST37        96709      29346134
EST370       139988     67486398
EST371       171773     95841557
EST372       156980     103067817
EST373       195102     134194068
EST374       174044     135774788
EST375       173741     117986997
EST376       164151     97390563
EST377       164726     108706935
EST378       197406     110844298
EST379       188467     97749709
EST38        98630      29837565
EST380       198001     121751643
EST381       191792     128435267
EST382       103816     68400219
EST383       207838     139687322
EST384       215900     131926680
EST385       209083     168408128
EST386       183831     117142702
EST387       195321     110086673
EST388       171302     24337594
EST389       161251     13455270
EST39        99441      31226275
EST390       156773     23613898
EST391       158559     32568678
EST392       158935     31664048
EST393       152721     69182055
EST394       107118     61792204
EST395       180549     116174556
EST396       166101     105236658
EST397       164241     108866468
EST398       143159     95276948
EST399       142030     100657578
EST4         170812     67108330
EST40        23166      5905608
EST400       149007     95255430
EST401       178587     129604043
EST402       147729     94748452
EST403       171257     79086169
EST404       167807     26687023
EST405       164676     91406067
EST406       155888     104760711
EST407       140735     90216632
EST408       144773     87744110
EST409       181224     100972559
EST41        101002     53008237
EST410       181653     127273000
EST411       135353     90845100
EST412       131792     89991358
EST413       154745     95950369
EST414       167052     95034908
EST415       179818     96284694
EST416       143238     90833265
EST417       174745     103288380
EST418       179067     107707072
EST419       110870     76009381
EST42        119591     50876281
EST420       82772      63109671
EST421       99831      66441497
EST422       7624       4619788
EST423       157814     86990816
EST424       126330     76648260
EST425       138769     91139592
EST426       141764     83375258
EST427       164940     96873405
EST428       156671     87086133
EST429       195358     116333375
EST43        164050     85771021
EST430       128121     85136302
EST431       184295     95110774
EST432       168141     80543556
EST433       146065     82850623
EST434       187745     114299217
EST435       134452     88024023
EST436       138938     91332768
EST437       136022     92119317
EST438       185518     76826596
EST439       185047     81199990
EST44        166556     67561577
EST440       205333     87842792
EST441       202236     93278985
EST442       215926     125171839
EST443       163462     101006306
EST444       184415     115828496
EST445       143279     93839261
EST446       164161     107676646
EST447       126420     62507428
EST448       151268     84041093
EST449       163591     74176152
EST45        166147     87481904
EST450       168651     59228348
EST451       140154     54771794
EST46        170532     87234492
EST47        162219     87511094
EST48        162822     82217467
EST49        157684     91186497
EST5         168996     66194437
EST50        161226     91067430
EST51        158729     97987128
EST52        157238     69645056
EST53        150386     82906321
EST54        81818      50046140
EST55        167804     67469558
EST56        160637     76530251
EST57        168910     93006890
EST58        156502     101565373
EST59        157574     100365242
EST6         171504     66930687
EST60        163321     100740971
EST61        160517     106017460
EST62        172752     74009357
EST63        173113     100919246
EST64        151399     80261551
EST65        151044     84151946
EST66        159172     99437900
EST67        137254     78679601
EST68        143278     85052060
EST69        196241     109283008
EST7         169800     72720649
EST70        197806     103725202
EST71        211701     118740452
EST72        191988     113282334
EST73        193866     114172508
EST74        160443     86448329
EST75        133291     62214755
EST76        136784     68626791
EST77        158599     108207870
EST78        155640     85578818
EST79        144446     78842055
EST8         179404     72869764
EST80        55902      37365456
EST81        182550     94460118
EST82        211237     123221893
EST83        214378     115129525
EST84        209162     98414576
EST85        209040     91195645
EST86        148529     90253217
EST87        144306     83890035
EST88        162803     81161604
EST89        159941     80848909
EST9         168515     69281418
EST90        151957     102903044
EST91        152623     99264682
EST92        133419     75844241
EST93        152420     115234390
EST94        141968     104568184
EST95        145379     105381481
EST96        139442     88336562
EST97        152795     86184751
EST98        174897     107332720
EST99        243563     149230578
GSS1         200062     87617305
GSS10        132040     60283372
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167238     128921102
GSS104       149783     82569304
GSS105       191527     120854119
GSS106       167754     112128998
GSS107       197330     115526115
GSS108       204979     134771775
GSS109       209811     138227419
GSS11        137026     73963307
GSS110       207578     140849257
GSS111       206236     142442604
GSS112       205252     143736524
GSS113       205174     143940262
GSS114       202120     146640781
GSS115       182321     139886386
GSS116       18402      10868805
GSS117       132848     84052151
GSS118       169611     80019194
GSS119       184271     79450634
GSS12        147892     75892162
GSS120       170296     148327490
GSS121       178758     122129958
GSS122       184792     149527338
GSS123       192471     124816227
GSS124       187616     137681247
GSS125       192582     126536809
GSS126       190068     95974036
GSS127       166167     152508730
GSS128       164283     115995268
GSS129       72077      47971984
GSS13        145394     68606548
GSS130       171040     155483774
GSS131       172682     154208585
GSS132       172147     155463991
GSS133       173791     154275835
GSS134       172766     152312161
GSS135       184110     144930584
GSS136       180850     146630825
GSS137       163509     113524702
GSS138       211746     85953665
GSS139       265738     40930491
GSS14        169809     84775490
GSS140       265732     40961625
GSS141       53525      8209147
GSS142       257193     58189558
GSS143       249204     63496141
GSS144       194724     79925705
GSS145       194632     76567977
GSS146       185155     152752062
GSS147       178781     157318949
GSS148       74095      67660841
GSS149       87118      64000130
GSS15        161100     97663213
GSS150       83555      62807097
GSS151       103680     48622710
GSS152       68578      58473263
GSS153       7665       7016900
GSS154       68591      57924394
GSS155       69224      56650935
GSS156       69460      56187403
GSS157       71202      55998401
GSS158       68561      51865315
GSS159       75915      58209304
GSS16        172836     87033749
GSS160       87237      74898207
GSS161       81830      44609896
GSS162       92677      45029689
GSS163       63209      47603494
GSS164       77435      61351403
GSS165       69655      58699293
GSS166       67711      62706526
GSS167       61946      53348157
GSS168       95612      42935517
GSS169       21104      4920928
GSS17        183523     113501533
GSS170       112937     70876701
GSS171       823        560132
GSS172       23226      28867035
GSS173       109043     70652585
GSS174       84533      34668223
GSS175       35815      22222733
GSS176       103304     62490220
GSS177       102329     63761256
GSS178       104268     67656826
GSS179       82099      41276456
GSS18        192358     114305774
GSS180       83102      54651503
GSS181       95673      61335435
GSS182       107323     78547443
GSS183       106375     76684757
GSS184       106058     79947480
GSS185       103996     80016519
GSS186       76374      51039123
GSS187       104572     63292187
GSS188       109868     66415305
GSS189       106205     59313311
GSS19        114075     52103409
GSS190       68379      37446344
GSS191       69573      38736929
GSS192       37145      17774305
GSS193       85481      46023427
GSS194       97119      55907586
GSS195       94982      49597190
GSS196       96286      55922591
GSS197       42132      23615490
GSS198       114638     43642267
GSS199       117085     39368203
GSS2         182294     92190593
GSS20        181789     101771260
GSS200       108676     55514545
GSS201       101471     78372335
GSS202       71100      45542204
GSS203       95891      36542252
GSS204       95417      37268709
GSS205       96671      35161518
GSS206       94285      39167432
GSS207       37736      17626556
GSS208       103939     66277823
GSS209       94551      61190929
GSS21        166208     114173594
GSS210       95128      60357048
GSS211       94773      60868501
GSS212       75675      70017159
GSS213       75117      74330280
GSS214       4473       7127270
GSS215       83736      28233267
GSS216       84219      27346468
GSS217       84926      25909272
GSS218       14851      4422302
GSS219       16547      7508221
GSS22        169506     97609042
GSS220       92648      59635081
GSS221       84649      52506719
GSS222       94060      50733017
GSS223       88580      48352815
GSS224       10706      5829890
GSS225       90648      56882510
GSS226       89662      61882079
GSS227       88553      63641206
GSS228       89283      62505584
GSS229       9890       7129098
GSS23        187251     126687349
GSS230       87995      63795538
GSS231       90217      62488977
GSS232       94639      59914104
GSS233       74309      63030713
GSS234       84243      78883806
GSS235       83030      80583817
GSS236       70509      52677201
GSS237       117650     64297121
GSS238       108874     55446727
GSS239       107533     52125503
GSS24        194057     130219707
GSS240       96658      43251344
GSS241       109801     49060015
GSS242       98194      46325477
GSS243       73059      72225597
GSS244       76682      71142435
GSS245       72980      46435649
GSS246       94787      57200301
GSS247       93517      59081345
GSS248       93900      58510429
GSS249       94714      57307691
GSS25        177481     105207105
GSS250       94279      58016121
GSS251       6701       3333254
GSS26        185918     107808246
GSS27        170600     151419573
GSS28        190494     146229226
GSS29        151147     106441309
GSS3         174946     87827370
GSS30        192446     132128206
GSS31        13634      8776287
GSS32        196044     127318947
GSS33        216659     116231837
GSS34        218573     113602417
GSS35        219720     112025390
GSS36        213958     121897898
GSS37        198560     156434224
GSS38        194991     146802885
GSS39        197241     73368303
GSS4         167155     85101061
GSS40        185065     97681837
GSS41        189783     125959643
GSS42        170343     158769399
GSS43        9054       5887224
GSS44        183999     100320381
GSS45        173032     121667203
GSS46        185089     124655109
GSS47        190835     122398633
GSS48        70733      62564650
GSS49        171799     101963548
GSS5         53445      31617730
GSS50        167647     103037030
GSS51        167798     102616122
GSS52        184194     121477291
GSS53        184774     116632196
GSS54        181686     122485290
GSS55        187531     113994336
GSS56        189392     134519036
GSS57        178947     104938173
GSS58        195715     120562907
GSS59        179925     133347062
GSS6         161617     84471320
GSS60        1898       1718384
GSS61        172844     138948397
GSS62        161635     111553347
GSS63        161673     111572480
GSS64        158827     107592995
GSS65        156768     129062324
GSS66        170185     142553826
GSS67        179844     117096102
GSS68        204911     127968663
GSS69        193332     110756601
GSS7         165323     79361698
GSS70        243921     125965583
GSS71        160206     106329772
GSS72        159350     119782538
GSS73        162663     124539011
GSS74        162629     124600834
GSS75        175106     108957765
GSS76        190310     140120939
GSS77        13117      7645415
GSS78        199135     126616367
GSS79        170370     111603100
GSS8         165782     88979927
GSS80        200718     131518447
GSS81        211575     85835271
GSS82        187842     98659368
GSS83        131802     92017231
GSS84        146986     118083551
GSS85        139587     116995322
GSS86        142817     114062378
GSS87        144008     119847686
GSS88        141842     115691442
GSS89        106718     88926972
GSS9         137999     67157686
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        63431      67180460
HTC11        62746      57492888
HTC12        66993      60073171
HTC13        68556      69499762
HTC14        21666      15118268
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         62355      78487812
HTG1         1318       188771164
HTG10        1298       186333849
HTG100       990        189440077
HTG101       996        189331054
HTG102       985        189419172
HTG103       1161       190585510
HTG104       30         4314892
HTG105       1087       189830459
HTG106       1045       189717260
HTG107       1388       191466263
HTG108       1301       190817637
HTG109       1618       191094779
HTG11        6          837687
HTG110       1360       191866703
HTG111       1299       192131784
HTG112       1308       190200930
HTG113       1044       185728683
HTG114       866        136599513
HTG115       1513       182381556
HTG116       992        192165745
HTG117       930        180556880
HTG118       1076       193695026
HTG119       1103       193020481
HTG12        1451       183826000
HTG120       222        41677204
HTG121       1029       189558680
HTG122       1054       192628794
HTG123       1164       192104076
HTG124       1083       192929368
HTG125       1083       192942392
HTG126       591        104225836
HTG127       1121       192542900
HTG128       1080       192286375
HTG129       1078       192355914
HTG13        875        191579912
HTG130       1165       191935230
HTG131       1542       191732030
HTG132       1070       192316972
HTG133       1069       192283809
HTG134       1129       191726888
HTG135       1380       190128572
HTG136       446        51564651
HTG14        753        192058598
HTG15        745        191952430
HTG16        786        192030578
HTG17        798        191859978
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2470       186037380
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189964220
HTG3         2513       185208586
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191697068
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2550       188439001
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190634433
HTG47        1176       190820823
HTG48        1128       191224702
HTG49        1046       191244150
HTG5         1283       185453274
HTG50        1030       189619303
HTG51        1042       178756613
HTG52        968        190052338
HTG53        1105       190148899
HTG54        1046       190158403
HTG55        1014       189831932
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189396132
HTG59        1031       189967604
HTG6         1273       185124562
HTG60        1077       187192796
HTG61        1125       188251573
HTG62        990        171367209
HTG63        1085       189473966
HTG64        1064       189415560
HTG65        1169       188798107
HTG66        1179       187545797
HTG67        1282       184397923
HTG68        94         12194080
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187688486
HTG73        1020       170303770
HTG74        1118       188293510
HTG75        1103       190775743
HTG76        1135       190789237
HTG77        1182       190871034
HTG78        1096       185997580
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190063261
HTG81        1213       189874691
HTG82        1120       189645029
HTG83        959        164682536
HTG84        1229       188409093
HTG85        1250       187741728
HTG86        1141       189879061
HTG87        1144       189686641
HTG88        978        167870813
HTG89        1182       189961005
HTG9         1200       186916809
HTG90        1104       190233697
HTG91        1146       190099121
HTG92        1109       190495628
HTG93        963        159549226
HTG94        1056       190751235
HTG95        1161       191033671
HTG96        1031       189156227
HTG97        1071       189524206
HTG98        685        127675409
HTG99        1018       189641315
INV1         94145      48350003
INV10        83435      65435227
INV11        54515      43124836
INV12        84921      66267646
INV13        80894      66911394
INV14        78476      68146368
INV15        44771      40991599
INV16        34677      110596616
INV17        386        154397728
INV18        58166      94065731
INV19        74056      62085031
INV2         16009      164228490
INV20        74147      53663002
INV21        21418      13965215
INV22        27268      129946772
INV23        6          133712559
INV24        53103      98220211
INV25        74704      49375238
INV26        73208      49221114
INV27        62005      42630688
INV28        72475      49027732
INV29        73714      50210395
INV3         1336       150507243
INV30        71331      51489216
INV31        68010      63479170
INV32        8388       46389335
INV4         16933      128332256
INV5         78559      72589399
INV6         54253      94946170
INV7         47206      81971624
INV8         80584      71781516
INV9         59161      86005042
MAM1         15605      161967877
MAM2         20361      156939871
MAM3         58435      83515717
MAM4         8982       182828945
MAM5         79368      74719786
MAM6         52965      118935400
MAM7         62400      51901403
PAT1         222542     70116699
PAT10        124452     102575971
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224730     34113420
PAT109       250080     15844360
PAT11        98645      64114703
PAT110       180680     63677151
PAT111       51648      26046194
PAT112       114184     110462046
PAT113       137702     83278366
PAT114       164163     99348600
PAT115       158877     103325984
PAT116       137417     114988187
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142065     62828791
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105888     59875034
PAT130       44618      171217879
PAT131       9167       47581637
PAT132       33645      178334734
PAT133       153558     109675196
PAT134       178705     90913377
PAT135       136049     115324159
PAT136       120392     123342367
PAT137       112436     66489146
PAT138       203662     47737230
PAT139       277828     9627968
PAT14        103642     50160321
PAT140       220409     46465135
PAT141       106719     2881142
PAT142       270386     21672571
PAT143       186751     61239638
PAT144       109799     106056597
PAT145       47518      9550821
PAT146       87299      88249520
PAT147       78465      95588128
PAT148       145201     77694876
PAT149       167499     71382707
PAT15        121148     53317075
PAT150       121465     92942809
PAT151       102977     85383727
PAT152       165566     46016231
PAT153       270022     5130418
PAT154       269978     5129582
PAT155       269978     5129582
PAT156       237888     4519872
PAT157       269396     5118524
PAT158       235480     25575098
PAT159       203734     47154417
PAT16        113137     61274458
PAT160       12033      422577
PAT161       165317     74871979
PAT162       91686      126656173
PAT163       172588     71662855
PAT164       137862     72260487
PAT165       9532       13982682
PAT166       93111      87244841
PAT167       91681      79829797
PAT168       83213      91467896
PAT169       109150     53717368
PAT17        39159      16235508
PAT170       140382     87089805
PAT171       114046     109103441
PAT172       154903     82576933
PAT173       191668     58048079
PAT18        146771     52594264
PAT19        153705     78039102
PAT2         194544     84644913
PAT20        104995     118172564
PAT21        133550     95503155
PAT22        84598      79322013
PAT23        123563     103405415
PAT24        119415     105656371
PAT25        145486     86670068
PAT26        175165     64299073
PAT27        71371      1784275
PAT28        102171     77387698
PAT29        93955      87644560
PAT3         171983     95894231
PAT30        119942     61673191
PAT31        96645      78968068
PAT32        128387     55025904
PAT33        92210      51123413
PAT34        111297     78150994
PAT35        138100     29119820
PAT36        158503     24081830
PAT37        114681     49019496
PAT38        44867      54579973
PAT39        95732      83191686
PAT4         153734     106065135
PAT40        100232     70984798
PAT41        136206     39303264
PAT42        143775     35446842
PAT43        123730     64736958
PAT44        104361     81207665
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57197      23951583
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92812      89404206
PAT59        106517     74781811
PAT6         170642     91909261
PAT60        122361     64031080
PAT61        67425      30297598
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154779     88234702
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131215     96912207
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        93690      93465044
PAT84        34071      33980501
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164898     19209900
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129375     101133373
PAT90        175305     3330795
PAT91        101391     1926429
PAT92        169171     12412246
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140780     2674820
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6377       70021949
PLN1         59897      93484081
PLN10        37435      49339456
PLN11        40284      65703271
PLN12        22496      123991381
PLN13        21103      99490646
PLN14        17578      144865462
PLN15        17634      146278605
PLN16        17564      146392665
PLN17        24586      128622172
PLN18        6000       149205408
PLN19        1266       170315035
PLN2         38356      117281443
PLN20        14134      155912680
PLN21        7126       8366082
PLN22        67256      69764583
PLN23        29372      31563580
PLN24        76964      76375552
PLN25        65424      81402358
PLN26        44731      113954432
PLN27        42         85481108
PLN28        7          95178561
PLN29        3220       146938239
PLN3         1360       177757738
PLN30        24414      133137973
PLN31        60122      88166797
PLN32        76411      77221479
PLN33        87518      45984627
PLN34        80392      71715812
PLN35        77969      75754264
PLN36        80049      70465838
PLN37        82083      75743844
PLN38        56872      30226055
PLN39        101375     57285209
PLN4         1841       185713161
PLN40        80556      70166250
PLN41        44537      98175265
PLN42        29827      123442428
PLN43        16062      134620056
PLN44        63390      71157351
PLN45        81344      72266169
PLN46        61845      82042198
PLN47        61231      83055551
PLN48        87821      61275443
PLN49        89425      64364903
PLN5         1841       194237923
PLN50        67610      87288894
PLN51        70177      77753952
PLN52        31330      56398746
PLN6         1713       194409470
PLN7         30550      132974059
PLN8         68546      68774097
PLN9         73074      75873315
PRI1         23016      59646733
PRI10        1272       179275558
PRI11        775        94029396
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193666240
PRI18        1099       194310776
PRI19        1166       193657185
PRI2         18318      149402096
PRI20        1737       191824483
PRI21        2647       189799961
PRI22        18082      162623904
PRI23        2662       10140267
PRI24        31573      84616058
PRI25        61950      78204817
PRI26        31351      70630978
PRI27        8521       161801360
PRI28        2251       180536345
PRI29        1618       181509288
PRI3         1433       175232985
PRI30        2007       181705860
PRI31        1958       180727178
PRI32        13182      156344247
PRI33        1328       183749995
PRI34        41712      106643745
PRI35        22922      33120663
PRI36        32189      63608729
PRI37        20137      117669283
PRI38        18568      147184451
PRI39        66602      86841579
PRI4         1282       185505233
PRI40        49427      89761235
PRI41        39706      73270313
PRI42        45389      95494997
PRI43        68105      86686545
PRI44        2833       24749741
PRI5         1324       184292917
PRI6         1180       179907324
PRI7         1246       180917243
PRI8         1212       178442526
PRI9         1367       174647124
ROD1         32312      140773658
ROD10        987        181481529
ROD11        232        44057446
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1189       190476978
ROD19        16750      151126619
ROD2         915        175328944
ROD20        20349      148361192
ROD21        1132       182075942
ROD22        1079       168189648
ROD23        13592      162644180
ROD24        38845      69265379
ROD25        21807      104556970
ROD26        1508       187599166
ROD27        134649     36929314
ROD28        84468      70117467
ROD29        46936      54764728
ROD3         905        173323995
ROD4         901        173936926
ROD5         923        174315076
ROD6         966        178209811
ROD7         968        179457909
ROD8         979        181267813
ROD9         994        181774273
STS1         85282      36763268
STS10        57907      44420267
STS11        48910      37503235
STS12        57924      43637361
STS13        64284      42850769
STS14        93606      34184225
STS15        104286     26517062
STS16        10116      2741066
STS17        103611     27476228
STS18        86929      34448302
STS19        99733      33367597
STS2         84354      49850025
STS20        54479      20731657
STS3         66846      26362760
STS4         76989      36945836
STS5         8457       4958885
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55716      37767321
SYN1         43082      76687142
SYN2         49326      68181793
SYN3         10743      160550160
SYN4         4599       176535222
SYN5         4596       176475231
SYN6         4601       176600811
SYN7         4715       87366528
TSA1         120505     38243959
TSA10        110707     38087107
TSA11        93510      31663613
TSA12        49790      16705166
TSA13        86486      70566494
TSA14        121991     38853496
TSA15        134870     35826510
TSA16        60982      79709095
TSA17        39421      53478178
TSA18        70282      97466599
TSA19        100893     57110196
TSA2         113528     41670793
TSA20        110663     52343396
TSA21        102937     53577836
TSA22        103736     52459823
TSA23        100922     47136901
TSA24        10725      6386002
TSA25        66573      59369298
TSA26        90250      62317379
TSA27        90395      75445863
TSA28        81291      75040690
TSA29        113045     34907447
TSA3         110398     41018342
TSA30        105614     51695041
TSA31        43017      35545468
TSA32        117006     42754122
TSA33        100254     55661219
TSA34        104927     53272065
TSA35        89834      69966029
TSA36        94138      70090503
TSA37        8432       2306791
TSA38        91228      72116539
TSA39        96026      56830673
TSA4         110952     45737441
TSA40        65364      106745352
TSA41        88818      78124099
TSA42        76071      81314094
TSA43        27377      46400956
TSA44        89053      69490190
TSA45        75197      86012084
TSA46        73336      77189655
TSA47        88445      82175735
TSA48        93774      84045049
TSA49        87724      67729510
TSA5         43145      10916057
TSA50        70645      65573403
TSA51        24567      11714134
TSA6         112460     59451131
TSA7         95611      66256273
TSA8         105745     68771636
TSA9         105926     64847592
UNA1         238        125011
VRL1         68339      68920830
VRL10        61946      72891123
VRL11        21350      31318272
VRL12        62820      71199258
VRL13        57510      72744374
VRL14        62975      65177941
VRL15        56675      74134409
VRL16        57508      72117308
VRL17        57619      71080866
VRL18        57775      70787880
VRL19        56941      57376269
VRL2         73433      64330658
VRL3         69704      60993796
VRL4         68159      70041598
VRL5         47565      49612533
VRL6         48252      77528882
VRL7         48500      73318366
VRL8         63041      71830291
VRL9         68745      66537284
VRT1         39444      127438981
VRT10        1256       189144082
VRT11        8274       177844568
VRT12        3994       136790703
VRT13        13095      170781188
VRT14        5348       182619924
VRT15        3936       185905956
VRT16        37547      134662096
VRT17        79796      68487148
VRT18        78401      66470518
VRT19        30574      24779295
VRT2         4381       189270242
VRT20        70217      79239317
VRT21        48712      118053901
VRT22        76703      62511632
VRT23        77611      60419637
VRT24        80313      56499892
VRT25        9875       9491030
VRT3         69380      81681978
VRT4         9602       168230313
VRT5         30067      23830691
VRT6         73012      66721467
VRT7         31732      63525065
VRT8         30651      111956535
VRT9         1202       189984871

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 187.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

19445681 15964956444   Homo sapiens
9317799   9884836246   Mus musculus
2187523   6506940433   Rattus norvegicus
2199739   5383949303   Bos taurus
3932517   5059842686   Zea mays
3227493   4837305038   Sus scrofa
1707183   3126299357   Danio rerio
228316    1352989825   Strongylocentrotus purpuratus
1347274   1253406828   Oryza sativa Japonica Group
1772107   1196186274   Nicotiana tabacum
1424332   1147248014   Xenopus (Silurana) tropicalis
2322316   1140559423   Arabidopsis thaliana
1226961   1063159869   Drosophila melanogaster
216458    1007860551   Pan troglodytes
766573     998717841   Vitis vinifera
1455267    948944699   Canis lupus familiaris
1902619    905699264   Glycine max
813754     898332820   Gallus gallus
83587      830368867   Macaca mulatta
739106     829516000   Solanum lycopersicum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 187.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 187.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Gert Roosen, Susan Schafer,
	Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
	Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Ben Slade,	Constantin Vasilyev

User Support
	Peter Cooper, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center