Release Notes For GenBank Release 188

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2012

               NCBI-GenBank Flat File Release 188.0

                    Distribution Release Notes

 149819246 loci, 137384889783 bases, from 149819246 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 188.0
1.2 Cutoff Date
1.3 Important Changes in Release 188.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 188.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 188.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 188.0, incorporates data available to the collaborating
databases as of February 11, 2012 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 188.0

1.3.1 Organizational changes

The total number of sequence data files increased by 33 with this release:

  - the BCT division is now composed of  82 files (+2)
  - the CON division is now composed of 166 files (+4)
  - the ENV division is now composed of  50 files (+4)
  - the EST division is now composed of 455 files (+4)
  - the GSS division is now composed of 255 files (+4)
  - the HTC division is now composed of  15 files (+1)
  - the PAT division is now composed of 176 files (+3)
  - the PLN division is now composed of  53 files (+1)
  - the TSA division is now composed of  60 files (+9)
  - the VRL division is now composed of  20 files (+1)

The total number of 'index' files increased by 4 with this release:

  - the AUT (author name)  index is now composed of 96 files (+4)

1.3.2 Project DBLINKs transitioning to BioProject

  The Genome Project Database resource at the NCBI was redesigned in
recent months, culminating in the implementation of a new BioProject
resource:

        http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

An article that describes the goals of BioProject is available:

        http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54015/

BioProject is a collaborative effort of the International Nucleotide
Sequence Database Collaboration (INSDC), and project data are exchanged 
with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject
website is also available at DDBJ:

        http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml

BioProjects are uniquely identified by BioProject Accession Numbers,
which utilize this format:

        "PRJ"
        "E" or "N" or "D"
        one letter
        one or more digits

Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 .

With BioProject now in operation, we are preparing to implement links
from sequence records to the new resource. Previously, links to the
Genome Project Database were provided by numeric 'Project' DBLINKs .
Here's an example for a bacterial complete-genome record:

LOCUS       CP002497             1110245 bp    DNA     linear   PLN 14-NOV-2011
DEFINITION  Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
            sequence.
ACCESSION   CP002497
VERSION     CP002497.1  GI:356887709
DBLINK      Project: 60715

When this link is switched to a BioProject accession, the DBLINK
line will change slightly:

LOCUS       CP002497             1110245 bp    DNA     linear   PLN 14-NOV-2011
DEFINITION  Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
            sequence.
ACCESSION   CP002497
VERSION     CP002497.1  GI:356887709
DBLINK      BioProject: PRJNA60715

In the coming months, many millions of sequence records will gradually
be modified, to make use of the new BioProject DBLINK. They will not be
distributed via daily GenBank and RefSeq incremetal update products.
However, these new BioProject links *will* start to be seen in GenBank
and RefSeq release products as of December 2011. In addition, the new
BioProject links will become visible via NCBI's Entrez:Nucleotide
resource, as soon as the modification process begins. 

1.3.3 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 188.0. Consider gbgss153.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2012

                NCBI-GenBank Flat File Release 188.0

                           GSS Sequences (Part 1)

   87119 loci,    64001690 bases, from    87119 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "153" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New representation for Transcriptome Shotgun Assembly (TSA) records.

  The TSA division of GenBank has grown much more quickly than expected.
In order to accommodate the increasing TSA submission volume, GenBank plans 
to use a WGS-like approach for TSA projects.

  TSA projects will be assigned a four-letter project code, starting with
the letter "G" (for example, GAAA). Individual mRNA sequences within a 
project will make use of the 4+2+6 accession number convention, familiar
to users of WGS data (for example, GAAA01000001). Unlike WGS, there is
no concept of "re-assembly" for a TSA project, and so we expect that the
2-digit assembly-version number will always be "01" for TSA mRNAs. Similar
to WGS, a TSA master record will provide a convenient overview of a
TSA project, with an 'all-zeroes' accession number (eg: GAAA00000000) . 

  TSA projects that make use of this new representation will be provided
in a separate FTP directory at the NCBI FTP site: genbank/tsa . And like
WGS, the various data files for a TSA project will be grouped by the
4-letter project code, and they will be updated independently of the
GenBank release cycle.

  Plans aren't yet finalized for the 5.2 million TSA records currently
provided by the divisional gbtsa* files of a GenBank release. Ideally,
all would be converted to the new WGS-like representation, so that all 
TSA records in GenBank utilize a common approach. However, the resources
for such a conversion might not be readily available, in which case
older/legacy TSA records might remain as they are now.

  Further details about this new approach for handling TSA data will be
made available via these release notes and the GenBank newsgroup, as we
get closer to implementation. 

1.4.2 New /pseudogene qualifier; /pseudo will be deprecated

  A new controlled-vocabulary /pseudogene qualifier has been under
discussion within the INSDC since the last collaborative INSD meeting
in May 2011. The goal of the new qualifier is to use it for the annotation
of certain well-defined classes of pseudogenes. And at the same time,
to cease using the poorly-defined /pseudo qualifier, which has been
used for a variety of different situations by each INSDC member.

  Although a formal definition of /pseudogene is not yet available, we
do have a tentative list of the values for the new qualifier:

"processed" - the pseudogene has arisen by reverse
transcription of a mRNA into cDNA, followed by reintegration into the
genome. Therefore, it has lost any intron/exon structure, and it will
have a pseudo-polyA-tail (if a young pseudogene).

"unprocessed" - the pseudogene has arisen from a copy of
the parent gene by means other than reverse transcription. This covers
usually duplication (transposition [not retrotransposition] and perhaps
recombination) followed by accumulation of random mutation. The changes,
compared to their functional homolog, include insertion, deletions,
premature stop codons, frameshifts and a higher proportion of
non-synonymous versus synonymous substitutions.

"unitary" - the pseudogene has no parent. It is the
original gene, which is functional is some species but disrupted in some
way (indels, mutation, recombination) in another species or strain. In a
lot of cases, such changes would kill the organism, particularly with
house-keeping genes.

"allelic" - a (unitary) pseudogene that is stable in the
population but importantly it has a functional alternative allele also
in the population. i.e., one strain may have the gene, another strain
may have the pseudogene. MHC haplotypes have allelic pseudogenes.

"unknown" - would imply that the submitter does not know
the method of pseudogenisation

  If a final definition of /pseudogene can be arrived at within the
next few weeks, then the new qualifier would be legal as of GenBank
Release 190.0 in June of 2012. We will keep users posted about this
new qualifier via the GenBank newsgroup and these release notes.

1.4.3 Extension of position syntax for /anticodon qualifiers

  Starting with the April 2012 GenBank Release 189.0, the format
of the /anticodon qualifier will be extended to allow the use
of join() and complement() for the location of a tRNA's anticodon.

  Currently, the qualifier supports only a simple continuous
basepair range. For example:

	 /anticodon=(pos:34..36,aa:Phe)

  But there are rare cases of intron-containing tRNAs, for which a
simple X..Y location will not suffice:

     tRNA            join(<1..5,495..544)
                     /gene="trnL"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /anticodon=(pos:join(5,495..496),aa:Leu)

  To support cases like these, the "pos" field will be allowed to
make use of the join() and complement() location operators.
Anticodons are usually three (sometimes four) bases in length, and 
this *remains* true even though the join() operator could theoretically
be (mis)used to assert a much more complex/larger location than that.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1761 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbaut93.idx - Index of the entries according to author name, part 93.
97. gbaut94.idx - Index of the entries according to author name, part 94.
98. gbaut95.idx - Index of the entries according to author name, part 95.
99. gbaut96.idx - Index of the entries according to author name, part 96.
100. gbbct1.seq - Bacterial sequence entries, part 1.
101. gbbct10.seq - Bacterial sequence entries, part 10.
102. gbbct11.seq - Bacterial sequence entries, part 11.
103. gbbct12.seq - Bacterial sequence entries, part 12.
104. gbbct13.seq - Bacterial sequence entries, part 13.
105. gbbct14.seq - Bacterial sequence entries, part 14.
106. gbbct15.seq - Bacterial sequence entries, part 15.
107. gbbct16.seq - Bacterial sequence entries, part 16.
108. gbbct17.seq - Bacterial sequence entries, part 17.
109. gbbct18.seq - Bacterial sequence entries, part 18.
110. gbbct19.seq - Bacterial sequence entries, part 19.
111. gbbct2.seq - Bacterial sequence entries, part 2.
112. gbbct20.seq - Bacterial sequence entries, part 20.
113. gbbct21.seq - Bacterial sequence entries, part 21.
114. gbbct22.seq - Bacterial sequence entries, part 22.
115. gbbct23.seq - Bacterial sequence entries, part 23.
116. gbbct24.seq - Bacterial sequence entries, part 24.
117. gbbct25.seq - Bacterial sequence entries, part 25.
118. gbbct26.seq - Bacterial sequence entries, part 26.
119. gbbct27.seq - Bacterial sequence entries, part 27.
120. gbbct28.seq - Bacterial sequence entries, part 28.
121. gbbct29.seq - Bacterial sequence entries, part 29.
122. gbbct3.seq - Bacterial sequence entries, part 3.
123. gbbct30.seq - Bacterial sequence entries, part 30.
124. gbbct31.seq - Bacterial sequence entries, part 31.
125. gbbct32.seq - Bacterial sequence entries, part 32.
126. gbbct33.seq - Bacterial sequence entries, part 33.
127. gbbct34.seq - Bacterial sequence entries, part 34.
128. gbbct35.seq - Bacterial sequence entries, part 35.
129. gbbct36.seq - Bacterial sequence entries, part 36.
130. gbbct37.seq - Bacterial sequence entries, part 37.
131. gbbct38.seq - Bacterial sequence entries, part 38.
132. gbbct39.seq - Bacterial sequence entries, part 39.
133. gbbct4.seq - Bacterial sequence entries, part 4.
134. gbbct40.seq - Bacterial sequence entries, part 40.
135. gbbct41.seq - Bacterial sequence entries, part 41.
136. gbbct42.seq - Bacterial sequence entries, part 42.
137. gbbct43.seq - Bacterial sequence entries, part 43.
138. gbbct44.seq - Bacterial sequence entries, part 44.
139. gbbct45.seq - Bacterial sequence entries, part 45.
140. gbbct46.seq - Bacterial sequence entries, part 46.
141. gbbct47.seq - Bacterial sequence entries, part 47.
142. gbbct48.seq - Bacterial sequence entries, part 48.
143. gbbct49.seq - Bacterial sequence entries, part 49.
144. gbbct5.seq - Bacterial sequence entries, part 5.
145. gbbct50.seq - Bacterial sequence entries, part 50.
146. gbbct51.seq - Bacterial sequence entries, part 51.
147. gbbct52.seq - Bacterial sequence entries, part 52.
148. gbbct53.seq - Bacterial sequence entries, part 53.
149. gbbct54.seq - Bacterial sequence entries, part 54.
150. gbbct55.seq - Bacterial sequence entries, part 55.
151. gbbct56.seq - Bacterial sequence entries, part 56.
152. gbbct57.seq - Bacterial sequence entries, part 57.
153. gbbct58.seq - Bacterial sequence entries, part 58.
154. gbbct59.seq - Bacterial sequence entries, part 59.
155. gbbct6.seq - Bacterial sequence entries, part 6.
156. gbbct60.seq - Bacterial sequence entries, part 60.
157. gbbct61.seq - Bacterial sequence entries, part 61.
158. gbbct62.seq - Bacterial sequence entries, part 62.
159. gbbct63.seq - Bacterial sequence entries, part 63.
160. gbbct64.seq - Bacterial sequence entries, part 64.
161. gbbct65.seq - Bacterial sequence entries, part 65.
162. gbbct66.seq - Bacterial sequence entries, part 66.
163. gbbct67.seq - Bacterial sequence entries, part 67.
164. gbbct68.seq - Bacterial sequence entries, part 68.
165. gbbct69.seq - Bacterial sequence entries, part 69.
166. gbbct7.seq - Bacterial sequence entries, part 7.
167. gbbct70.seq - Bacterial sequence entries, part 70.
168. gbbct71.seq - Bacterial sequence entries, part 71.
169. gbbct72.seq - Bacterial sequence entries, part 72.
170. gbbct73.seq - Bacterial sequence entries, part 73.
171. gbbct74.seq - Bacterial sequence entries, part 74.
172. gbbct75.seq - Bacterial sequence entries, part 75.
173. gbbct76.seq - Bacterial sequence entries, part 76.
174. gbbct77.seq - Bacterial sequence entries, part 77.
175. gbbct78.seq - Bacterial sequence entries, part 78.
176. gbbct79.seq - Bacterial sequence entries, part 79.
177. gbbct8.seq - Bacterial sequence entries, part 8.
178. gbbct80.seq - Bacterial sequence entries, part 80.
179. gbbct81.seq - Bacterial sequence entries, part 81.
180. gbbct82.seq - Bacterial sequence entries, part 82.
181. gbbct9.seq - Bacterial sequence entries, part 9.
182. gbchg.txt - Accession numbers of entries updated since the previous release.
183. gbcon1.seq - Constructed sequence entries, part 1.
184. gbcon10.seq - Constructed sequence entries, part 10.
185. gbcon100.seq - Constructed sequence entries, part 100.
186. gbcon101.seq - Constructed sequence entries, part 101.
187. gbcon102.seq - Constructed sequence entries, part 102.
188. gbcon103.seq - Constructed sequence entries, part 103.
189. gbcon104.seq - Constructed sequence entries, part 104.
190. gbcon105.seq - Constructed sequence entries, part 105.
191. gbcon106.seq - Constructed sequence entries, part 106.
192. gbcon107.seq - Constructed sequence entries, part 107.
193. gbcon108.seq - Constructed sequence entries, part 108.
194. gbcon109.seq - Constructed sequence entries, part 109.
195. gbcon11.seq - Constructed sequence entries, part 11.
196. gbcon110.seq - Constructed sequence entries, part 110.
197. gbcon111.seq - Constructed sequence entries, part 111.
198. gbcon112.seq - Constructed sequence entries, part 112.
199. gbcon113.seq - Constructed sequence entries, part 113.
200. gbcon114.seq - Constructed sequence entries, part 114.
201. gbcon115.seq - Constructed sequence entries, part 115.
202. gbcon116.seq - Constructed sequence entries, part 116.
203. gbcon117.seq - Constructed sequence entries, part 117.
204. gbcon118.seq - Constructed sequence entries, part 118.
205. gbcon119.seq - Constructed sequence entries, part 119.
206. gbcon12.seq - Constructed sequence entries, part 12.
207. gbcon120.seq - Constructed sequence entries, part 120.
208. gbcon121.seq - Constructed sequence entries, part 121.
209. gbcon122.seq - Constructed sequence entries, part 122.
210. gbcon123.seq - Constructed sequence entries, part 123.
211. gbcon124.seq - Constructed sequence entries, part 124.
212. gbcon125.seq - Constructed sequence entries, part 125.
213. gbcon126.seq - Constructed sequence entries, part 126.
214. gbcon127.seq - Constructed sequence entries, part 127.
215. gbcon128.seq - Constructed sequence entries, part 128.
216. gbcon129.seq - Constructed sequence entries, part 129.
217. gbcon13.seq - Constructed sequence entries, part 13.
218. gbcon130.seq - Constructed sequence entries, part 130.
219. gbcon131.seq - Constructed sequence entries, part 131.
220. gbcon132.seq - Constructed sequence entries, part 132.
221. gbcon133.seq - Constructed sequence entries, part 133.
222. gbcon134.seq - Constructed sequence entries, part 134.
223. gbcon135.seq - Constructed sequence entries, part 135.
224. gbcon136.seq - Constructed sequence entries, part 136.
225. gbcon137.seq - Constructed sequence entries, part 137.
226. gbcon138.seq - Constructed sequence entries, part 138.
227. gbcon139.seq - Constructed sequence entries, part 139.
228. gbcon14.seq - Constructed sequence entries, part 14.
229. gbcon140.seq - Constructed sequence entries, part 140.
230. gbcon141.seq - Constructed sequence entries, part 141.
231. gbcon142.seq - Constructed sequence entries, part 142.
232. gbcon143.seq - Constructed sequence entries, part 143.
233. gbcon144.seq - Constructed sequence entries, part 144.
234. gbcon145.seq - Constructed sequence entries, part 145.
235. gbcon146.seq - Constructed sequence entries, part 146.
236. gbcon147.seq - Constructed sequence entries, part 147.
237. gbcon148.seq - Constructed sequence entries, part 148.
238. gbcon149.seq - Constructed sequence entries, part 149.
239. gbcon15.seq - Constructed sequence entries, part 15.
240. gbcon150.seq - Constructed sequence entries, part 150.
241. gbcon151.seq - Constructed sequence entries, part 151.
242. gbcon152.seq - Constructed sequence entries, part 152.
243. gbcon153.seq - Constructed sequence entries, part 153.
244. gbcon154.seq - Constructed sequence entries, part 154.
245. gbcon155.seq - Constructed sequence entries, part 155.
246. gbcon156.seq - Constructed sequence entries, part 156.
247. gbcon157.seq - Constructed sequence entries, part 157.
248. gbcon158.seq - Constructed sequence entries, part 158.
249. gbcon159.seq - Constructed sequence entries, part 159.
250. gbcon16.seq - Constructed sequence entries, part 16.
251. gbcon160.seq - Constructed sequence entries, part 160.
252. gbcon161.seq - Constructed sequence entries, part 161.
253. gbcon162.seq - Constructed sequence entries, part 162.
254. gbcon163.seq - Constructed sequence entries, part 163.
255. gbcon164.seq - Constructed sequence entries, part 164.
256. gbcon165.seq - Constructed sequence entries, part 165.
257. gbcon166.seq - Constructed sequence entries, part 166.
258. gbcon17.seq - Constructed sequence entries, part 17.
259. gbcon18.seq - Constructed sequence entries, part 18.
260. gbcon19.seq - Constructed sequence entries, part 19.
261. gbcon2.seq - Constructed sequence entries, part 2.
262. gbcon20.seq - Constructed sequence entries, part 20.
263. gbcon21.seq - Constructed sequence entries, part 21.
264. gbcon22.seq - Constructed sequence entries, part 22.
265. gbcon23.seq - Constructed sequence entries, part 23.
266. gbcon24.seq - Constructed sequence entries, part 24.
267. gbcon25.seq - Constructed sequence entries, part 25.
268. gbcon26.seq - Constructed sequence entries, part 26.
269. gbcon27.seq - Constructed sequence entries, part 27.
270. gbcon28.seq - Constructed sequence entries, part 28.
271. gbcon29.seq - Constructed sequence entries, part 29.
272. gbcon3.seq - Constructed sequence entries, part 3.
273. gbcon30.seq - Constructed sequence entries, part 30.
274. gbcon31.seq - Constructed sequence entries, part 31.
275. gbcon32.seq - Constructed sequence entries, part 32.
276. gbcon33.seq - Constructed sequence entries, part 33.
277. gbcon34.seq - Constructed sequence entries, part 34.
278. gbcon35.seq - Constructed sequence entries, part 35.
279. gbcon36.seq - Constructed sequence entries, part 36.
280. gbcon37.seq - Constructed sequence entries, part 37.
281. gbcon38.seq - Constructed sequence entries, part 38.
282. gbcon39.seq - Constructed sequence entries, part 39.
283. gbcon4.seq - Constructed sequence entries, part 4.
284. gbcon40.seq - Constructed sequence entries, part 40.
285. gbcon41.seq - Constructed sequence entries, part 41.
286. gbcon42.seq - Constructed sequence entries, part 42.
287. gbcon43.seq - Constructed sequence entries, part 43.
288. gbcon44.seq - Constructed sequence entries, part 44.
289. gbcon45.seq - Constructed sequence entries, part 45.
290. gbcon46.seq - Constructed sequence entries, part 46.
291. gbcon47.seq - Constructed sequence entries, part 47.
292. gbcon48.seq - Constructed sequence entries, part 48.
293. gbcon49.seq - Constructed sequence entries, part 49.
294. gbcon5.seq - Constructed sequence entries, part 5.
295. gbcon50.seq - Constructed sequence entries, part 50.
296. gbcon51.seq - Constructed sequence entries, part 51.
297. gbcon52.seq - Constructed sequence entries, part 52.
298. gbcon53.seq - Constructed sequence entries, part 53.
299. gbcon54.seq - Constructed sequence entries, part 54.
300. gbcon55.seq - Constructed sequence entries, part 55.
301. gbcon56.seq - Constructed sequence entries, part 56.
302. gbcon57.seq - Constructed sequence entries, part 57.
303. gbcon58.seq - Constructed sequence entries, part 58.
304. gbcon59.seq - Constructed sequence entries, part 59.
305. gbcon6.seq - Constructed sequence entries, part 6.
306. gbcon60.seq - Constructed sequence entries, part 60.
307. gbcon61.seq - Constructed sequence entries, part 61.
308. gbcon62.seq - Constructed sequence entries, part 62.
309. gbcon63.seq - Constructed sequence entries, part 63.
310. gbcon64.seq - Constructed sequence entries, part 64.
311. gbcon65.seq - Constructed sequence entries, part 65.
312. gbcon66.seq - Constructed sequence entries, part 66.
313. gbcon67.seq - Constructed sequence entries, part 67.
314. gbcon68.seq - Constructed sequence entries, part 68.
315. gbcon69.seq - Constructed sequence entries, part 69.
316. gbcon7.seq - Constructed sequence entries, part 7.
317. gbcon70.seq - Constructed sequence entries, part 70.
318. gbcon71.seq - Constructed sequence entries, part 71.
319. gbcon72.seq - Constructed sequence entries, part 72.
320. gbcon73.seq - Constructed sequence entries, part 73.
321. gbcon74.seq - Constructed sequence entries, part 74.
322. gbcon75.seq - Constructed sequence entries, part 75.
323. gbcon76.seq - Constructed sequence entries, part 76.
324. gbcon77.seq - Constructed sequence entries, part 77.
325. gbcon78.seq - Constructed sequence entries, part 78.
326. gbcon79.seq - Constructed sequence entries, part 79.
327. gbcon8.seq - Constructed sequence entries, part 8.
328. gbcon80.seq - Constructed sequence entries, part 80.
329. gbcon81.seq - Constructed sequence entries, part 81.
330. gbcon82.seq - Constructed sequence entries, part 82.
331. gbcon83.seq - Constructed sequence entries, part 83.
332. gbcon84.seq - Constructed sequence entries, part 84.
333. gbcon85.seq - Constructed sequence entries, part 85.
334. gbcon86.seq - Constructed sequence entries, part 86.
335. gbcon87.seq - Constructed sequence entries, part 87.
336. gbcon88.seq - Constructed sequence entries, part 88.
337. gbcon89.seq - Constructed sequence entries, part 89.
338. gbcon9.seq - Constructed sequence entries, part 9.
339. gbcon90.seq - Constructed sequence entries, part 90.
340. gbcon91.seq - Constructed sequence entries, part 91.
341. gbcon92.seq - Constructed sequence entries, part 92.
342. gbcon93.seq - Constructed sequence entries, part 93.
343. gbcon94.seq - Constructed sequence entries, part 94.
344. gbcon95.seq - Constructed sequence entries, part 95.
345. gbcon96.seq - Constructed sequence entries, part 96.
346. gbcon97.seq - Constructed sequence entries, part 97.
347. gbcon98.seq - Constructed sequence entries, part 98.
348. gbcon99.seq - Constructed sequence entries, part 99.
349. gbdel.txt - Accession numbers of entries deleted since the previous release.
350. gbenv1.seq - Environmental sampling sequence entries, part 1.
351. gbenv10.seq - Environmental sampling sequence entries, part 10.
352. gbenv11.seq - Environmental sampling sequence entries, part 11.
353. gbenv12.seq - Environmental sampling sequence entries, part 12.
354. gbenv13.seq - Environmental sampling sequence entries, part 13.
355. gbenv14.seq - Environmental sampling sequence entries, part 14.
356. gbenv15.seq - Environmental sampling sequence entries, part 15.
357. gbenv16.seq - Environmental sampling sequence entries, part 16.
358. gbenv17.seq - Environmental sampling sequence entries, part 17.
359. gbenv18.seq - Environmental sampling sequence entries, part 18.
360. gbenv19.seq - Environmental sampling sequence entries, part 19.
361. gbenv2.seq - Environmental sampling sequence entries, part 2.
362. gbenv20.seq - Environmental sampling sequence entries, part 20.
363. gbenv21.seq - Environmental sampling sequence entries, part 21.
364. gbenv22.seq - Environmental sampling sequence entries, part 22.
365. gbenv23.seq - Environmental sampling sequence entries, part 23.
366. gbenv24.seq - Environmental sampling sequence entries, part 24.
367. gbenv25.seq - Environmental sampling sequence entries, part 25.
368. gbenv26.seq - Environmental sampling sequence entries, part 26.
369. gbenv27.seq - Environmental sampling sequence entries, part 27.
370. gbenv28.seq - Environmental sampling sequence entries, part 28.
371. gbenv29.seq - Environmental sampling sequence entries, part 29.
372. gbenv3.seq - Environmental sampling sequence entries, part 3.
373. gbenv30.seq - Environmental sampling sequence entries, part 30.
374. gbenv31.seq - Environmental sampling sequence entries, part 31.
375. gbenv32.seq - Environmental sampling sequence entries, part 32.
376. gbenv33.seq - Environmental sampling sequence entries, part 33.
377. gbenv34.seq - Environmental sampling sequence entries, part 34.
378. gbenv35.seq - Environmental sampling sequence entries, part 35.
379. gbenv36.seq - Environmental sampling sequence entries, part 36.
380. gbenv37.seq - Environmental sampling sequence entries, part 37.
381. gbenv38.seq - Environmental sampling sequence entries, part 38.
382. gbenv39.seq - Environmental sampling sequence entries, part 39.
383. gbenv4.seq - Environmental sampling sequence entries, part 4.
384. gbenv40.seq - Environmental sampling sequence entries, part 40.
385. gbenv41.seq - Environmental sampling sequence entries, part 41.
386. gbenv42.seq - Environmental sampling sequence entries, part 42.
387. gbenv43.seq - Environmental sampling sequence entries, part 43.
388. gbenv44.seq - Environmental sampling sequence entries, part 44.
389. gbenv45.seq - Environmental sampling sequence entries, part 45.
390. gbenv46.seq - Environmental sampling sequence entries, part 46.
391. gbenv47.seq - Environmental sampling sequence entries, part 47.
392. gbenv48.seq - Environmental sampling sequence entries, part 48.
393. gbenv49.seq - Environmental sampling sequence entries, part 49.
394. gbenv5.seq - Environmental sampling sequence entries, part 5.
395. gbenv50.seq - Environmental sampling sequence entries, part 50.
396. gbenv6.seq - Environmental sampling sequence entries, part 6.
397. gbenv7.seq - Environmental sampling sequence entries, part 7.
398. gbenv8.seq - Environmental sampling sequence entries, part 8.
399. gbenv9.seq - Environmental sampling sequence entries, part 9.
400. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
401. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
402. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
403. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
404. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
405. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
406. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
407. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
408. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
409. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
410. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
411. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
412. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
413. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
414. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
415. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
416. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
417. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
418. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
419. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
420. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
421. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
422. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
423. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
424. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
425. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
426. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
427. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
428. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
429. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
430. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
431. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
432. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
433. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
434. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
435. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
436. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
437. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
438. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
439. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
440. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
441. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
442. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
443. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
444. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
445. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
446. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
447. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
448. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
449. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
450. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
451. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
452. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
453. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
454. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
455. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
456. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
457. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
458. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
459. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
460. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
461. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
462. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
463. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
464. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
465. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
466. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
467. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
468. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
469. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
470. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
471. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
472. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
473. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
474. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
475. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
476. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
477. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
478. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
479. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
480. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
481. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
482. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
483. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
484. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
485. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
486. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
487. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
488. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
489. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
490. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
491. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
492. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
493. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
494. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
495. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
496. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
497. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
498. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
499. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
500. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
501. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
502. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
503. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
504. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
505. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
506. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
507. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
508. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
509. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
510. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
511. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
512. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
513. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
514. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
515. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
516. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
517. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
518. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
519. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
520. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
521. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
522. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
523. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
524. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
525. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
526. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
527. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
528. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
529. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
530. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
531. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
532. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
533. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
534. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
535. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
536. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
537. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
538. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
539. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
540. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
541. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
542. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
543. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
544. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
545. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
546. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
547. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
548. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
549. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
550. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
551. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
552. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
553. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
554. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
555. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
556. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
557. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
558. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
559. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
560. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
561. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
562. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
563. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
564. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
565. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
566. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
567. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
568. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
569. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
570. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
571. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
572. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
573. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
574. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
575. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
576. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
577. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
578. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
579. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
580. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
581. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
582. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
583. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
584. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
585. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
586. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
587. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
588. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
589. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
590. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
591. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
592. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
593. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
594. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
595. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
596. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
597. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
598. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
599. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
600. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
601. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
602. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
603. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
604. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
605. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
606. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
607. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
608. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
609. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
610. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
611. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
612. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
613. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
614. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
615. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
616. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
617. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
618. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
619. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
620. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
621. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
622. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
623. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
624. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
625. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
626. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
627. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
628. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
629. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
630. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
631. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
632. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
633. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
634. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
635. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
636. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
637. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
638. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
639. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
640. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
641. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
642. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
643. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
644. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
645. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
646. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
647. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
648. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
649. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
650. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
651. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
652. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
653. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
654. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
655. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
656. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
657. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
658. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
659. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
660. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
661. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
662. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
663. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
664. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
665. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
666. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
667. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
668. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
669. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
670. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
671. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
672. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
673. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
674. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
675. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
676. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
677. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
678. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
679. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
680. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
681. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
682. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
683. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
684. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
685. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
686. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
687. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
688. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
689. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
690. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
691. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
692. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
693. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
694. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
695. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
696. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
697. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
698. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
699. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
700. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
701. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
702. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
703. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
704. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
705. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
706. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
707. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
708. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
709. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
710. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
711. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
712. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
713. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
714. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
715. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
716. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
717. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
718. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
719. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
720. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
721. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
722. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
723. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
724. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
725. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
726. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
727. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
728. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
729. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
730. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
731. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
732. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
733. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
734. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
735. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
736. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
737. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
738. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
739. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
740. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
741. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
742. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
743. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
744. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
745. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
746. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
747. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
748. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
749. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
750. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
751. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
752. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
753. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
754. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
755. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
756. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
757. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
758. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
759. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
760. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
761. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
762. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
763. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
764. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
765. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
766. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
767. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
768. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
769. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
770. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
771. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
772. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
773. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
774. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
775. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
776. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
777. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
778. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
779. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
780. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
781. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
782. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
783. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
784. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
785. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
786. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
787. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
788. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
789. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
790. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
791. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
792. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
793. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
794. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
795. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
796. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
797. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
798. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
799. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
800. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
801. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
802. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
803. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
804. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
805. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
806. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
807. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
808. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
809. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
810. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
811. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
812. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
813. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
814. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
815. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
816. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
817. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
818. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
819. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
820. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
821. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
822. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
823. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
824. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
825. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
826. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
827. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
828. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
829. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
830. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
831. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
832. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
833. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
834. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
835. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
836. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
837. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
838. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
839. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
840. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
841. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
842. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
843. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
844. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
845. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
846. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
847. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
848. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
849. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
850. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
851. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
852. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
853. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
854. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
855. gbgen.idx - Index of the entries according to gene symbols.
856. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
857. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
858. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
859. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
860. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
861. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
862. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
863. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
864. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
865. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
866. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
867. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
868. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
869. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
870. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
871. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
872. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
873. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
874. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
875. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
876. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
877. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
878. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
879. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
880. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
881. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
882. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
883. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
884. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
885. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
886. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
887. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
888. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
889. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
890. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
891. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
892. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
893. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
894. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
895. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
896. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
897. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
898. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
899. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
900. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
901. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
902. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
903. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
904. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
905. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
906. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
907. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
908. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
909. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
910. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
911. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
912. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
913. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
914. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
915. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
916. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
917. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
918. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
919. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
920. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
921. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
922. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
923. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
924. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
925. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
926. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
927. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
928. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
929. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
930. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
931. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
932. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
933. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
934. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
935. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
936. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
937. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
938. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
939. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
940. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
941. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
942. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
943. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
944. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
945. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
946. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
947. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
948. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
949. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
950. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
951. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
952. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
953. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
954. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
955. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
956. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
957. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
958. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
959. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
960. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
961. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
962. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
963. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
964. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
965. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
966. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
967. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
968. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
969. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
970. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
971. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
972. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
973. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
974. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
975. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
976. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
977. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
978. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
979. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
980. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
981. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
982. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
983. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
984. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
985. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
986. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
987. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
988. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
989. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
990. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
991. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
992. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
993. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
994. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
995. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
996. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
997. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
998. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
999. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1000. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1001. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1002. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1003. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1004. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1005. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1006. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1007. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1008. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1009. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1010. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1011. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1012. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1013. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1014. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1015. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1016. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1017. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1018. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1019. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1020. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1021. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1022. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1023. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1024. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1025. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1026. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1027. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1028. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1029. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1030. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1031. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1032. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1033. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1034. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1035. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1036. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1037. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1038. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1039. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1040. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1041. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1042. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1043. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1044. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1045. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1046. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1047. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1048. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1049. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1050. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1051. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1052. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1053. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1054. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1055. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1056. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1057. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1058. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1059. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1060. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1061. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1062. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1063. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1064. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1065. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1066. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1067. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1068. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1069. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1070. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1071. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1072. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1073. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1074. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1075. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1076. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1077. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1078. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1079. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1080. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1081. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1082. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1083. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1084. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1085. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1086. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1087. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1088. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1089. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1090. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1091. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1092. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1093. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1094. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1095. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1096. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1097. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1098. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1099. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1100. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1101. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1102. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1103. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1104. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1105. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1106. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1107. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1108. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1109. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1110. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1111. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1112. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1113. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1114. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1115. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1116. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1117. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1118. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1119. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1120. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1121. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1122. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1123. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1124. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1125. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1126. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1127. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1128. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1129. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1130. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1131. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1132. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1133. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1134. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1135. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1136. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1137. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1138. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1139. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1140. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1141. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1142. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1143. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1144. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1145. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1146. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1147. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1148. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1149. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1150. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1151. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1152. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1153. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1154. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1155. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1156. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1157. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1158. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1159. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1160. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1161. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1162. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1163. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1164. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1165. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1166. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1167. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1168. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1169. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1170. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1171. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1172. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1173. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1174. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1175. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1176. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1177. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1178. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1179. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1180. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1181. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1182. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1183. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1184. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1185. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1186. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1187. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1188. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1189. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1190. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1191. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1192. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1193. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1194. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1195. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1196. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1197. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1198. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1199. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1200. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1201. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1202. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1203. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1204. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1205. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1206. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1207. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1208. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1209. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1210. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1211. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1212. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1213. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1214. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1215. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1216. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1217. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1218. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1219. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1220. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1221. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1222. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1223. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1224. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1225. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1226. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1227. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1228. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1229. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1230. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1231. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1232. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1233. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1234. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1235. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1236. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1237. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1238. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1239. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1240. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1241. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1242. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1243. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1244. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1245. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1246. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1247. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1248. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1249. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1250. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1251. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1252. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1253. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1254. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1255. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1256. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1257. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1258. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1259. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1260. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1261. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1262. gbinv1.seq - Invertebrate sequence entries, part 1.
1263. gbinv10.seq - Invertebrate sequence entries, part 10.
1264. gbinv11.seq - Invertebrate sequence entries, part 11.
1265. gbinv12.seq - Invertebrate sequence entries, part 12.
1266. gbinv13.seq - Invertebrate sequence entries, part 13.
1267. gbinv14.seq - Invertebrate sequence entries, part 14.
1268. gbinv15.seq - Invertebrate sequence entries, part 15.
1269. gbinv16.seq - Invertebrate sequence entries, part 16.
1270. gbinv17.seq - Invertebrate sequence entries, part 17.
1271. gbinv18.seq - Invertebrate sequence entries, part 18.
1272. gbinv19.seq - Invertebrate sequence entries, part 19.
1273. gbinv2.seq - Invertebrate sequence entries, part 2.
1274. gbinv20.seq - Invertebrate sequence entries, part 20.
1275. gbinv21.seq - Invertebrate sequence entries, part 21.
1276. gbinv22.seq - Invertebrate sequence entries, part 22.
1277. gbinv23.seq - Invertebrate sequence entries, part 23.
1278. gbinv24.seq - Invertebrate sequence entries, part 24.
1279. gbinv25.seq - Invertebrate sequence entries, part 25.
1280. gbinv26.seq - Invertebrate sequence entries, part 26.
1281. gbinv27.seq - Invertebrate sequence entries, part 27.
1282. gbinv28.seq - Invertebrate sequence entries, part 28.
1283. gbinv29.seq - Invertebrate sequence entries, part 29.
1284. gbinv3.seq - Invertebrate sequence entries, part 3.
1285. gbinv30.seq - Invertebrate sequence entries, part 30.
1286. gbinv31.seq - Invertebrate sequence entries, part 31.
1287. gbinv32.seq - Invertebrate sequence entries, part 32.
1288. gbinv4.seq - Invertebrate sequence entries, part 4.
1289. gbinv5.seq - Invertebrate sequence entries, part 5.
1290. gbinv6.seq - Invertebrate sequence entries, part 6.
1291. gbinv7.seq - Invertebrate sequence entries, part 7.
1292. gbinv8.seq - Invertebrate sequence entries, part 8.
1293. gbinv9.seq - Invertebrate sequence entries, part 9.
1294. gbjou1.idx - Index of the entries according to journal citation, part 1.
1295. gbjou10.idx - Index of the entries according to journal citation, part 10.
1296. gbjou11.idx - Index of the entries according to journal citation, part 11.
1297. gbjou12.idx - Index of the entries according to journal citation, part 12.
1298. gbjou13.idx - Index of the entries according to journal citation, part 13.
1299. gbjou2.idx - Index of the entries according to journal citation, part 2.
1300. gbjou3.idx - Index of the entries according to journal citation, part 3.
1301. gbjou4.idx - Index of the entries according to journal citation, part 4.
1302. gbjou5.idx - Index of the entries according to journal citation, part 5.
1303. gbjou6.idx - Index of the entries according to journal citation, part 6.
1304. gbjou7.idx - Index of the entries according to journal citation, part 7.
1305. gbjou8.idx - Index of the entries according to journal citation, part 8.
1306. gbjou9.idx - Index of the entries according to journal citation, part 9.
1307. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1308. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1309. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1310. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1311. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1312. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1313. gbmam1.seq - Other mammalian sequence entries, part 1.
1314. gbmam2.seq - Other mammalian sequence entries, part 2.
1315. gbmam3.seq - Other mammalian sequence entries, part 3.
1316. gbmam4.seq - Other mammalian sequence entries, part 4.
1317. gbmam5.seq - Other mammalian sequence entries, part 5.
1318. gbmam6.seq - Other mammalian sequence entries, part 6.
1319. gbmam7.seq - Other mammalian sequence entries, part 7.
1320. gbnew.txt - Accession numbers of entries new since the previous release.
1321. gbpat1.seq - Patent sequence entries, part 1.
1322. gbpat10.seq - Patent sequence entries, part 10.
1323. gbpat100.seq - Patent sequence entries, part 100.
1324. gbpat101.seq - Patent sequence entries, part 101.
1325. gbpat102.seq - Patent sequence entries, part 102.
1326. gbpat103.seq - Patent sequence entries, part 103.
1327. gbpat104.seq - Patent sequence entries, part 104.
1328. gbpat105.seq - Patent sequence entries, part 105.
1329. gbpat106.seq - Patent sequence entries, part 106.
1330. gbpat107.seq - Patent sequence entries, part 107.
1331. gbpat108.seq - Patent sequence entries, part 108.
1332. gbpat109.seq - Patent sequence entries, part 109.
1333. gbpat11.seq - Patent sequence entries, part 11.
1334. gbpat110.seq - Patent sequence entries, part 110.
1335. gbpat111.seq - Patent sequence entries, part 111.
1336. gbpat112.seq - Patent sequence entries, part 112.
1337. gbpat113.seq - Patent sequence entries, part 113.
1338. gbpat114.seq - Patent sequence entries, part 114.
1339. gbpat115.seq - Patent sequence entries, part 115.
1340. gbpat116.seq - Patent sequence entries, part 116.
1341. gbpat117.seq - Patent sequence entries, part 117.
1342. gbpat118.seq - Patent sequence entries, part 118.
1343. gbpat119.seq - Patent sequence entries, part 119.
1344. gbpat12.seq - Patent sequence entries, part 12.
1345. gbpat120.seq - Patent sequence entries, part 120.
1346. gbpat121.seq - Patent sequence entries, part 121.
1347. gbpat122.seq - Patent sequence entries, part 122.
1348. gbpat123.seq - Patent sequence entries, part 123.
1349. gbpat124.seq - Patent sequence entries, part 124.
1350. gbpat125.seq - Patent sequence entries, part 125.
1351. gbpat126.seq - Patent sequence entries, part 126.
1352. gbpat127.seq - Patent sequence entries, part 127.
1353. gbpat128.seq - Patent sequence entries, part 128.
1354. gbpat129.seq - Patent sequence entries, part 129.
1355. gbpat13.seq - Patent sequence entries, part 13.
1356. gbpat130.seq - Patent sequence entries, part 130.
1357. gbpat131.seq - Patent sequence entries, part 131.
1358. gbpat132.seq - Patent sequence entries, part 132.
1359. gbpat133.seq - Patent sequence entries, part 133.
1360. gbpat134.seq - Patent sequence entries, part 134.
1361. gbpat135.seq - Patent sequence entries, part 135.
1362. gbpat136.seq - Patent sequence entries, part 136.
1363. gbpat137.seq - Patent sequence entries, part 137.
1364. gbpat138.seq - Patent sequence entries, part 138.
1365. gbpat139.seq - Patent sequence entries, part 139.
1366. gbpat14.seq - Patent sequence entries, part 14.
1367. gbpat140.seq - Patent sequence entries, part 140.
1368. gbpat141.seq - Patent sequence entries, part 141.
1369. gbpat142.seq - Patent sequence entries, part 142.
1370. gbpat143.seq - Patent sequence entries, part 143.
1371. gbpat144.seq - Patent sequence entries, part 144.
1372. gbpat145.seq - Patent sequence entries, part 145.
1373. gbpat146.seq - Patent sequence entries, part 146.
1374. gbpat147.seq - Patent sequence entries, part 147.
1375. gbpat148.seq - Patent sequence entries, part 148.
1376. gbpat149.seq - Patent sequence entries, part 149.
1377. gbpat15.seq - Patent sequence entries, part 15.
1378. gbpat150.seq - Patent sequence entries, part 150.
1379. gbpat151.seq - Patent sequence entries, part 151.
1380. gbpat152.seq - Patent sequence entries, part 152.
1381. gbpat153.seq - Patent sequence entries, part 153.
1382. gbpat154.seq - Patent sequence entries, part 154.
1383. gbpat155.seq - Patent sequence entries, part 155.
1384. gbpat156.seq - Patent sequence entries, part 156.
1385. gbpat157.seq - Patent sequence entries, part 157.
1386. gbpat158.seq - Patent sequence entries, part 158.
1387. gbpat159.seq - Patent sequence entries, part 159.
1388. gbpat16.seq - Patent sequence entries, part 16.
1389. gbpat160.seq - Patent sequence entries, part 160.
1390. gbpat161.seq - Patent sequence entries, part 161.
1391. gbpat162.seq - Patent sequence entries, part 162.
1392. gbpat163.seq - Patent sequence entries, part 163.
1393. gbpat164.seq - Patent sequence entries, part 164.
1394. gbpat165.seq - Patent sequence entries, part 165.
1395. gbpat166.seq - Patent sequence entries, part 166.
1396. gbpat167.seq - Patent sequence entries, part 167.
1397. gbpat168.seq - Patent sequence entries, part 168.
1398. gbpat169.seq - Patent sequence entries, part 169.
1399. gbpat17.seq - Patent sequence entries, part 17.
1400. gbpat170.seq - Patent sequence entries, part 170.
1401. gbpat171.seq - Patent sequence entries, part 171.
1402. gbpat172.seq - Patent sequence entries, part 172.
1403. gbpat173.seq - Patent sequence entries, part 173.
1404. gbpat174.seq - Patent sequence entries, part 174.
1405. gbpat175.seq - Patent sequence entries, part 175.
1406. gbpat176.seq - Patent sequence entries, part 176.
1407. gbpat18.seq - Patent sequence entries, part 18.
1408. gbpat19.seq - Patent sequence entries, part 19.
1409. gbpat2.seq - Patent sequence entries, part 2.
1410. gbpat20.seq - Patent sequence entries, part 20.
1411. gbpat21.seq - Patent sequence entries, part 21.
1412. gbpat22.seq - Patent sequence entries, part 22.
1413. gbpat23.seq - Patent sequence entries, part 23.
1414. gbpat24.seq - Patent sequence entries, part 24.
1415. gbpat25.seq - Patent sequence entries, part 25.
1416. gbpat26.seq - Patent sequence entries, part 26.
1417. gbpat27.seq - Patent sequence entries, part 27.
1418. gbpat28.seq - Patent sequence entries, part 28.
1419. gbpat29.seq - Patent sequence entries, part 29.
1420. gbpat3.seq - Patent sequence entries, part 3.
1421. gbpat30.seq - Patent sequence entries, part 30.
1422. gbpat31.seq - Patent sequence entries, part 31.
1423. gbpat32.seq - Patent sequence entries, part 32.
1424. gbpat33.seq - Patent sequence entries, part 33.
1425. gbpat34.seq - Patent sequence entries, part 34.
1426. gbpat35.seq - Patent sequence entries, part 35.
1427. gbpat36.seq - Patent sequence entries, part 36.
1428. gbpat37.seq - Patent sequence entries, part 37.
1429. gbpat38.seq - Patent sequence entries, part 38.
1430. gbpat39.seq - Patent sequence entries, part 39.
1431. gbpat4.seq - Patent sequence entries, part 4.
1432. gbpat40.seq - Patent sequence entries, part 40.
1433. gbpat41.seq - Patent sequence entries, part 41.
1434. gbpat42.seq - Patent sequence entries, part 42.
1435. gbpat43.seq - Patent sequence entries, part 43.
1436. gbpat44.seq - Patent sequence entries, part 44.
1437. gbpat45.seq - Patent sequence entries, part 45.
1438. gbpat46.seq - Patent sequence entries, part 46.
1439. gbpat47.seq - Patent sequence entries, part 47.
1440. gbpat48.seq - Patent sequence entries, part 48.
1441. gbpat49.seq - Patent sequence entries, part 49.
1442. gbpat5.seq - Patent sequence entries, part 5.
1443. gbpat50.seq - Patent sequence entries, part 50.
1444. gbpat51.seq - Patent sequence entries, part 51.
1445. gbpat52.seq - Patent sequence entries, part 52.
1446. gbpat53.seq - Patent sequence entries, part 53.
1447. gbpat54.seq - Patent sequence entries, part 54.
1448. gbpat55.seq - Patent sequence entries, part 55.
1449. gbpat56.seq - Patent sequence entries, part 56.
1450. gbpat57.seq - Patent sequence entries, part 57.
1451. gbpat58.seq - Patent sequence entries, part 58.
1452. gbpat59.seq - Patent sequence entries, part 59.
1453. gbpat6.seq - Patent sequence entries, part 6.
1454. gbpat60.seq - Patent sequence entries, part 60.
1455. gbpat61.seq - Patent sequence entries, part 61.
1456. gbpat62.seq - Patent sequence entries, part 62.
1457. gbpat63.seq - Patent sequence entries, part 63.
1458. gbpat64.seq - Patent sequence entries, part 64.
1459. gbpat65.seq - Patent sequence entries, part 65.
1460. gbpat66.seq - Patent sequence entries, part 66.
1461. gbpat67.seq - Patent sequence entries, part 67.
1462. gbpat68.seq - Patent sequence entries, part 68.
1463. gbpat69.seq - Patent sequence entries, part 69.
1464. gbpat7.seq - Patent sequence entries, part 7.
1465. gbpat70.seq - Patent sequence entries, part 70.
1466. gbpat71.seq - Patent sequence entries, part 71.
1467. gbpat72.seq - Patent sequence entries, part 72.
1468. gbpat73.seq - Patent sequence entries, part 73.
1469. gbpat74.seq - Patent sequence entries, part 74.
1470. gbpat75.seq - Patent sequence entries, part 75.
1471. gbpat76.seq - Patent sequence entries, part 76.
1472. gbpat77.seq - Patent sequence entries, part 77.
1473. gbpat78.seq - Patent sequence entries, part 78.
1474. gbpat79.seq - Patent sequence entries, part 79.
1475. gbpat8.seq - Patent sequence entries, part 8.
1476. gbpat80.seq - Patent sequence entries, part 80.
1477. gbpat81.seq - Patent sequence entries, part 81.
1478. gbpat82.seq - Patent sequence entries, part 82.
1479. gbpat83.seq - Patent sequence entries, part 83.
1480. gbpat84.seq - Patent sequence entries, part 84.
1481. gbpat85.seq - Patent sequence entries, part 85.
1482. gbpat86.seq - Patent sequence entries, part 86.
1483. gbpat87.seq - Patent sequence entries, part 87.
1484. gbpat88.seq - Patent sequence entries, part 88.
1485. gbpat89.seq - Patent sequence entries, part 89.
1486. gbpat9.seq - Patent sequence entries, part 9.
1487. gbpat90.seq - Patent sequence entries, part 90.
1488. gbpat91.seq - Patent sequence entries, part 91.
1489. gbpat92.seq - Patent sequence entries, part 92.
1490. gbpat93.seq - Patent sequence entries, part 93.
1491. gbpat94.seq - Patent sequence entries, part 94.
1492. gbpat95.seq - Patent sequence entries, part 95.
1493. gbpat96.seq - Patent sequence entries, part 96.
1494. gbpat97.seq - Patent sequence entries, part 97.
1495. gbpat98.seq - Patent sequence entries, part 98.
1496. gbpat99.seq - Patent sequence entries, part 99.
1497. gbphg1.seq - Phage sequence entries, part 1.
1498. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1499. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1500. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1501. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1502. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1503. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1504. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1505. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1506. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1507. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1508. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1509. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1510. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1511. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1512. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1513. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1514. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1515. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1516. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1517. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1518. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1519. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1520. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1521. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1522. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1523. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1524. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1525. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1526. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1527. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1528. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1529. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1530. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1531. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1532. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1533. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1534. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1535. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1536. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1537. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1538. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1539. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1540. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1541. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1542. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1543. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1544. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1545. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1546. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1547. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1548. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1549. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1550. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1551. gbpri1.seq - Primate sequence entries, part 1.
1552. gbpri10.seq - Primate sequence entries, part 10.
1553. gbpri11.seq - Primate sequence entries, part 11.
1554. gbpri12.seq - Primate sequence entries, part 12.
1555. gbpri13.seq - Primate sequence entries, part 13.
1556. gbpri14.seq - Primate sequence entries, part 14.
1557. gbpri15.seq - Primate sequence entries, part 15.
1558. gbpri16.seq - Primate sequence entries, part 16.
1559. gbpri17.seq - Primate sequence entries, part 17.
1560. gbpri18.seq - Primate sequence entries, part 18.
1561. gbpri19.seq - Primate sequence entries, part 19.
1562. gbpri2.seq - Primate sequence entries, part 2.
1563. gbpri20.seq - Primate sequence entries, part 20.
1564. gbpri21.seq - Primate sequence entries, part 21.
1565. gbpri22.seq - Primate sequence entries, part 22.
1566. gbpri23.seq - Primate sequence entries, part 23.
1567. gbpri24.seq - Primate sequence entries, part 24.
1568. gbpri25.seq - Primate sequence entries, part 25.
1569. gbpri26.seq - Primate sequence entries, part 26.
1570. gbpri27.seq - Primate sequence entries, part 27.
1571. gbpri28.seq - Primate sequence entries, part 28.
1572. gbpri29.seq - Primate sequence entries, part 29.
1573. gbpri3.seq - Primate sequence entries, part 3.
1574. gbpri30.seq - Primate sequence entries, part 30.
1575. gbpri31.seq - Primate sequence entries, part 31.
1576. gbpri32.seq - Primate sequence entries, part 32.
1577. gbpri33.seq - Primate sequence entries, part 33.
1578. gbpri34.seq - Primate sequence entries, part 34.
1579. gbpri35.seq - Primate sequence entries, part 35.
1580. gbpri36.seq - Primate sequence entries, part 36.
1581. gbpri37.seq - Primate sequence entries, part 37.
1582. gbpri38.seq - Primate sequence entries, part 38.
1583. gbpri39.seq - Primate sequence entries, part 39.
1584. gbpri4.seq - Primate sequence entries, part 4.
1585. gbpri40.seq - Primate sequence entries, part 40.
1586. gbpri41.seq - Primate sequence entries, part 41.
1587. gbpri42.seq - Primate sequence entries, part 42.
1588. gbpri43.seq - Primate sequence entries, part 43.
1589. gbpri44.seq - Primate sequence entries, part 44.
1590. gbpri5.seq - Primate sequence entries, part 5.
1591. gbpri6.seq - Primate sequence entries, part 6.
1592. gbpri7.seq - Primate sequence entries, part 7.
1593. gbpri8.seq - Primate sequence entries, part 8.
1594. gbpri9.seq - Primate sequence entries, part 9.
1595. gbrel.txt - Release notes (this document).
1596. gbrod1.seq - Rodent sequence entries, part 1.
1597. gbrod10.seq - Rodent sequence entries, part 10.
1598. gbrod11.seq - Rodent sequence entries, part 11.
1599. gbrod12.seq - Rodent sequence entries, part 12.
1600. gbrod13.seq - Rodent sequence entries, part 13.
1601. gbrod14.seq - Rodent sequence entries, part 14.
1602. gbrod15.seq - Rodent sequence entries, part 15.
1603. gbrod16.seq - Rodent sequence entries, part 16.
1604. gbrod17.seq - Rodent sequence entries, part 17.
1605. gbrod18.seq - Rodent sequence entries, part 18.
1606. gbrod19.seq - Rodent sequence entries, part 19.
1607. gbrod2.seq - Rodent sequence entries, part 2.
1608. gbrod20.seq - Rodent sequence entries, part 20.
1609. gbrod21.seq - Rodent sequence entries, part 21.
1610. gbrod22.seq - Rodent sequence entries, part 22.
1611. gbrod23.seq - Rodent sequence entries, part 23.
1612. gbrod24.seq - Rodent sequence entries, part 24.
1613. gbrod25.seq - Rodent sequence entries, part 25.
1614. gbrod26.seq - Rodent sequence entries, part 26.
1615. gbrod27.seq - Rodent sequence entries, part 27.
1616. gbrod28.seq - Rodent sequence entries, part 28.
1617. gbrod29.seq - Rodent sequence entries, part 29.
1618. gbrod3.seq - Rodent sequence entries, part 3.
1619. gbrod4.seq - Rodent sequence entries, part 4.
1620. gbrod5.seq - Rodent sequence entries, part 5.
1621. gbrod6.seq - Rodent sequence entries, part 6.
1622. gbrod7.seq - Rodent sequence entries, part 7.
1623. gbrod8.seq - Rodent sequence entries, part 8.
1624. gbrod9.seq - Rodent sequence entries, part 9.
1625. gbsdr1.txt - Short directory of the data bank, part 1.
1626. gbsdr2.txt - Short directory of the data bank, part 2.
1627. gbsdr3.txt - Short directory of the data bank, part 3.
1628. gbsec.idx - Index of the entries according to secondary accession number.
1629. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1630. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1631. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1632. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1633. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1634. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1635. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1636. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1637. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1638. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1639. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1640. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1641. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1642. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1643. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1644. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1645. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1646. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1647. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1648. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1649. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1650. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1651. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1652. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1653. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1654. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1655. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1656. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1657. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1658. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1659. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1660. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1661. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1662. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1663. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1664. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1665. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1666. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1667. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1668. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1669. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1670. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1671. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1672. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1673. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1674. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1675. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1676. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1677. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1678. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1679. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1680. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1681. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1682. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1683. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1684. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1685. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1686. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1687. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1688. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1689. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1690. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1691. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1692. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1693. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1694. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1695. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1696. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1697. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1698. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1699. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1700. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1701. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1702. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1703. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1704. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1705. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1706. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1707. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1708. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1709. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1710. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1711. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1712. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1713. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1714. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1715. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1716. gbuna1.seq - Unannotated sequence entries, part 1.
1717. gbvrl1.seq - Viral sequence entries, part 1.
1718. gbvrl10.seq - Viral sequence entries, part 10.
1719. gbvrl11.seq - Viral sequence entries, part 11.
1720. gbvrl12.seq - Viral sequence entries, part 12.
1721. gbvrl13.seq - Viral sequence entries, part 13.
1722. gbvrl14.seq - Viral sequence entries, part 14.
1723. gbvrl15.seq - Viral sequence entries, part 15.
1724. gbvrl16.seq - Viral sequence entries, part 16.
1725. gbvrl17.seq - Viral sequence entries, part 17.
1726. gbvrl18.seq - Viral sequence entries, part 18.
1727. gbvrl19.seq - Viral sequence entries, part 19.
1728. gbvrl2.seq - Viral sequence entries, part 2.
1729. gbvrl20.seq - Viral sequence entries, part 20.
1730. gbvrl3.seq - Viral sequence entries, part 3.
1731. gbvrl4.seq - Viral sequence entries, part 4.
1732. gbvrl5.seq - Viral sequence entries, part 5.
1733. gbvrl6.seq - Viral sequence entries, part 6.
1734. gbvrl7.seq - Viral sequence entries, part 7.
1735. gbvrl8.seq - Viral sequence entries, part 8.
1736. gbvrl9.seq - Viral sequence entries, part 9.
1737. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1738. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1739. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1740. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1741. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1742. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1743. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1744. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1745. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1746. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1747. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1748. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1749. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1750. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1751. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1752. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1753. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1754. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1755. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1756. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1757. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1758. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1759. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1760. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1761. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 188.0 flatfiles require roughly 539 GB (sequence
files only) or 580 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1950976907     gbacc1.idx
2368021623     gbacc2.idx
 845658798     gbacc3.idx
 184210033     gbaut1.idx
 184216115     gbaut10.idx
 184088184     gbaut11.idx
 189535057     gbaut12.idx
 232683759     gbaut13.idx
 190079567     gbaut14.idx
 184785382     gbaut15.idx
 190252682     gbaut16.idx
 223199616     gbaut17.idx
 185378896     gbaut18.idx
 187376242     gbaut19.idx
 243590239     gbaut2.idx
 184334002     gbaut20.idx
 247456946     gbaut21.idx
 225911734     gbaut22.idx
 187178044     gbaut23.idx
 187993761     gbaut24.idx
 198722903     gbaut25.idx
 238583777     gbaut26.idx
 183793143     gbaut27.idx
 184712746     gbaut28.idx
 183935066     gbaut29.idx
 220158364     gbaut3.idx
 243694589     gbaut30.idx
 186496287     gbaut31.idx
 184017501     gbaut32.idx
 185847301     gbaut33.idx
 183915277     gbaut34.idx
 188239301     gbaut35.idx
 183872618     gbaut36.idx
 184906088     gbaut37.idx
 233551289     gbaut38.idx
 183982466     gbaut39.idx
 187298463     gbaut4.idx
 184052972     gbaut40.idx
 185155806     gbaut41.idx
 234185545     gbaut42.idx
 184005588     gbaut43.idx
 183829315     gbaut44.idx
 185903122     gbaut45.idx
 194708255     gbaut46.idx
 185134251     gbaut47.idx
 186617193     gbaut48.idx
 184232631     gbaut49.idx
 236724052     gbaut5.idx
 183828392     gbaut50.idx
 183938013     gbaut51.idx
 186430012     gbaut52.idx
 186206141     gbaut53.idx
 183885715     gbaut54.idx
 190332258     gbaut55.idx
 184858708     gbaut56.idx
 201447534     gbaut57.idx
 185798194     gbaut58.idx
 184708419     gbaut59.idx
 199582899     gbaut6.idx
 184877159     gbaut60.idx
 184052894     gbaut61.idx
 183899748     gbaut62.idx
 196915238     gbaut63.idx
 187420308     gbaut64.idx
 212490452     gbaut65.idx
 187855172     gbaut66.idx
 184139887     gbaut67.idx
 185491683     gbaut68.idx
 184058573     gbaut69.idx
 183813298     gbaut7.idx
 184348680     gbaut70.idx
 184095245     gbaut71.idx
 184743943     gbaut72.idx
 185492820     gbaut73.idx
 184759525     gbaut74.idx
 185504248     gbaut75.idx
 185213620     gbaut76.idx
 219051392     gbaut77.idx
 185138172     gbaut78.idx
 186842586     gbaut79.idx
 183938810     gbaut8.idx
 183886506     gbaut80.idx
 187008926     gbaut81.idx
 184443198     gbaut82.idx
 183931927     gbaut83.idx
 184109386     gbaut84.idx
 231764934     gbaut85.idx
 186688729     gbaut86.idx
 185521811     gbaut87.idx
 186831279     gbaut88.idx
 243799160     gbaut89.idx
 195192412     gbaut9.idx
 183887716     gbaut90.idx
 183984878     gbaut91.idx
 184122366     gbaut92.idx
 183958729     gbaut93.idx
 186498579     gbaut94.idx
 187886343     gbaut95.idx
 156162085     gbaut96.idx
 249999738     gbbct1.seq
 244870852     gbbct10.seq
 244613667     gbbct11.seq
 233187001     gbbct12.seq
 186245758     gbbct13.seq
 243158636     gbbct14.seq
 249783326     gbbct15.seq
 245551992     gbbct16.seq
 248628765     gbbct17.seq
 248242091     gbbct18.seq
 249281961     gbbct19.seq
 246115606     gbbct2.seq
 246198630     gbbct20.seq
 245693356     gbbct21.seq
 217806784     gbbct22.seq
 242803771     gbbct23.seq
 241840999     gbbct24.seq
 248677048     gbbct25.seq
 247875345     gbbct26.seq
 249387783     gbbct27.seq
 244185976     gbbct28.seq
 247337077     gbbct29.seq
 242707674     gbbct3.seq
 249996799     gbbct30.seq
 249761453     gbbct31.seq
 249790948     gbbct32.seq
 242886336     gbbct33.seq
 241625458     gbbct34.seq
 160068904     gbbct35.seq
 243880501     gbbct36.seq
 246111304     gbbct37.seq
 242766907     gbbct38.seq
 239636196     gbbct39.seq
 241184574     gbbct4.seq
 247210305     gbbct40.seq
 246790666     gbbct41.seq
 245871228     gbbct42.seq
 244913596     gbbct43.seq
 248036778     gbbct44.seq
 248281432     gbbct45.seq
 242733728     gbbct46.seq
 151177824     gbbct47.seq
 248502088     gbbct48.seq
 238214280     gbbct49.seq
 213971127     gbbct5.seq
 241662812     gbbct50.seq
 245556170     gbbct51.seq
 246292986     gbbct52.seq
 246413031     gbbct53.seq
 249772959     gbbct54.seq
 247794052     gbbct55.seq
 246004771     gbbct56.seq
 227746997     gbbct57.seq
 246886493     gbbct58.seq
 136968377     gbbct59.seq
 242138604     gbbct6.seq
 245003371     gbbct60.seq
 247623991     gbbct61.seq
 249891264     gbbct62.seq
  98438854     gbbct63.seq
   6887564     gbbct64.seq
  14095618     gbbct65.seq
  23197003     gbbct66.seq
  45099055     gbbct67.seq
  87779073     gbbct68.seq
 170059824     gbbct69.seq
 247376572     gbbct7.seq
 249997882     gbbct70.seq
 249998088     gbbct71.seq
 242620278     gbbct72.seq
 249756811     gbbct73.seq
 244158140     gbbct74.seq
 248551747     gbbct75.seq
 249948135     gbbct76.seq
 249996445     gbbct77.seq
  47422777     gbbct78.seq
 242175199     gbbct79.seq
 247183144     gbbct8.seq
 249997878     gbbct80.seq
 250000162     gbbct81.seq
 164194175     gbbct82.seq
 245003435     gbbct9.seq
   6622867     gbchg.txt
 249999578     gbcon1.seq
 249997306     gbcon10.seq
 249994223     gbcon100.seq
 249995660     gbcon101.seq
 249998605     gbcon102.seq
 249998936     gbcon103.seq
 250000223     gbcon104.seq
 156342446     gbcon105.seq
 249996812     gbcon106.seq
 249993767     gbcon107.seq
 249992301     gbcon108.seq
 249998322     gbcon109.seq
 248094953     gbcon11.seq
  71615782     gbcon110.seq
 212826019     gbcon111.seq
 250000256     gbcon112.seq
 250000098     gbcon113.seq
 249995503     gbcon114.seq
 249706231     gbcon115.seq
 149768319     gbcon116.seq
 249914315     gbcon117.seq
 249999874     gbcon118.seq
 179997601     gbcon119.seq
 249733466     gbcon12.seq
 249997285     gbcon120.seq
 250000198     gbcon121.seq
 249998745     gbcon122.seq
 222474383     gbcon123.seq
 249821752     gbcon124.seq
 249878542     gbcon125.seq
 249555609     gbcon126.seq
 249997994     gbcon127.seq
 249995228     gbcon128.seq
 249998722     gbcon129.seq
 249085631     gbcon13.seq
  41196963     gbcon130.seq
 249978699     gbcon131.seq
 249998490     gbcon132.seq
 249993348     gbcon133.seq
 249999880     gbcon134.seq
 249912502     gbcon135.seq
 249948624     gbcon136.seq
 249955490     gbcon137.seq
 233498172     gbcon138.seq
 246632492     gbcon139.seq
 249998859     gbcon14.seq
 247088480     gbcon140.seq
 249512645     gbcon141.seq
 249979698     gbcon142.seq
 108787117     gbcon143.seq
 249997972     gbcon144.seq
 249893238     gbcon145.seq
 249995663     gbcon146.seq
 249972969     gbcon147.seq
 249998239     gbcon148.seq
 249364151     gbcon149.seq
  54269872     gbcon15.seq
 249955451     gbcon150.seq
 249999255     gbcon151.seq
 199658498     gbcon152.seq
 249961712     gbcon153.seq
 249998214     gbcon154.seq
 250000106     gbcon155.seq
 249992598     gbcon156.seq
 249999859     gbcon157.seq
 108527534     gbcon158.seq
 250000007     gbcon159.seq
 245778394     gbcon16.seq
 249982154     gbcon160.seq
 249997011     gbcon161.seq
 249997819     gbcon162.seq
 250000028     gbcon163.seq
 249748567     gbcon164.seq
 221299033     gbcon165.seq
  18856261     gbcon166.seq
 249999263     gbcon17.seq
 249996854     gbcon18.seq
  44927450     gbcon19.seq
 249928196     gbcon2.seq
 249999960     gbcon20.seq
 249360254     gbcon21.seq
 116173132     gbcon22.seq
 249999937     gbcon23.seq
 120041874     gbcon24.seq
 249996870     gbcon25.seq
 249725357     gbcon26.seq
 249997572     gbcon27.seq
 249998238     gbcon28.seq
 186471574     gbcon29.seq
 248161967     gbcon3.seq
 249999756     gbcon30.seq
 249997224     gbcon31.seq
 249999813     gbcon32.seq
 249999952     gbcon33.seq
 247997550     gbcon34.seq
 232565226     gbcon35.seq
 249999237     gbcon36.seq
 249996869     gbcon37.seq
 249995921     gbcon38.seq
 249996351     gbcon39.seq
 248979371     gbcon4.seq
 249999450     gbcon40.seq
 249997210     gbcon41.seq
  61183731     gbcon42.seq
 249997486     gbcon43.seq
 249994070     gbcon44.seq
 249999391     gbcon45.seq
 249997743     gbcon46.seq
 249994859     gbcon47.seq
  43089049     gbcon48.seq
 249993995     gbcon49.seq
 249999843     gbcon5.seq
 249996310     gbcon50.seq
 249994442     gbcon51.seq
 249997248     gbcon52.seq
 250000078     gbcon53.seq
  36404971     gbcon54.seq
 249993185     gbcon55.seq
 249998119     gbcon56.seq
 249995170     gbcon57.seq
 249998154     gbcon58.seq
 249998078     gbcon59.seq
 249993449     gbcon6.seq
 152679523     gbcon60.seq
 249999955     gbcon61.seq
 249999066     gbcon62.seq
 249997558     gbcon63.seq
 249998625     gbcon64.seq
 183609322     gbcon65.seq
 249999870     gbcon66.seq
 249997967     gbcon67.seq
 249997138     gbcon68.seq
 249995207     gbcon69.seq
 231272949     gbcon7.seq
 245488804     gbcon70.seq
 250000182     gbcon71.seq
 249998695     gbcon72.seq
 249998372     gbcon73.seq
 249996966     gbcon74.seq
 250000007     gbcon75.seq
  96627683     gbcon76.seq
 249993448     gbcon77.seq
 249995119     gbcon78.seq
 249997383     gbcon79.seq
 249997708     gbcon8.seq
 249995948     gbcon80.seq
 249999042     gbcon81.seq
  62682749     gbcon82.seq
 249997771     gbcon83.seq
 249996653     gbcon84.seq
 249999445     gbcon85.seq
 249999590     gbcon86.seq
 249998149     gbcon87.seq
  21674116     gbcon88.seq
 249998140     gbcon89.seq
 249996514     gbcon9.seq
 249997503     gbcon90.seq
 249996940     gbcon91.seq
 249995720     gbcon92.seq
 197881888     gbcon93.seq
 249993974     gbcon94.seq
 249996060     gbcon95.seq
 249999726     gbcon96.seq
 249998645     gbcon97.seq
 249996901     gbcon98.seq
 133265984     gbcon99.seq
   4034546     gbdel.txt
 249999118     gbenv1.seq
 249999153     gbenv10.seq
  55961183     gbenv11.seq
 250000069     gbenv12.seq
 249999865     gbenv13.seq
 249999771     gbenv14.seq
 249999357     gbenv15.seq
 249998400     gbenv16.seq
 249999454     gbenv17.seq
 249997032     gbenv18.seq
 196052655     gbenv19.seq
 249998965     gbenv2.seq
 249997542     gbenv20.seq
 250000034     gbenv21.seq
 249999241     gbenv22.seq
 249998697     gbenv23.seq
 156256134     gbenv24.seq
 249999659     gbenv25.seq
 249920954     gbenv26.seq
 250000052     gbenv27.seq
 249998935     gbenv28.seq
 249999437     gbenv29.seq
 249998470     gbenv3.seq
 115347282     gbenv30.seq
 249998069     gbenv31.seq
 249999183     gbenv32.seq
 249999820     gbenv33.seq
 249997235     gbenv34.seq
 135449070     gbenv35.seq
 249997870     gbenv36.seq
 250000083     gbenv37.seq
 249999709     gbenv38.seq
 249998076     gbenv39.seq
 249999480     gbenv4.seq
 249999891     gbenv40.seq
 224801920     gbenv41.seq
 249998740     gbenv42.seq
 249998816     gbenv43.seq
 249999011     gbenv44.seq
 249998535     gbenv45.seq
 249999440     gbenv46.seq
 249999872     gbenv47.seq
 249997574     gbenv48.seq
 249999683     gbenv49.seq
 249998178     gbenv5.seq
 140992399     gbenv50.seq
 230960980     gbenv6.seq
 249998471     gbenv7.seq
 249998516     gbenv8.seq
 249997978     gbenv9.seq
 524292008     gbest1.seq
 524289074     gbest10.seq
 524289941     gbest100.seq
 524291337     gbest101.seq
 524289859     gbest102.seq
 524290377     gbest103.seq
 356067172     gbest104.seq
 524290444     gbest105.seq
 524289882     gbest106.seq
 498295264     gbest107.seq
 388468596     gbest108.seq
 387567407     gbest109.seq
 524290873     gbest11.seq
 383140776     gbest110.seq
 384246085     gbest111.seq
 384330199     gbest112.seq
 381683980     gbest113.seq
 391864302     gbest114.seq
 387826689     gbest115.seq
 386125537     gbest116.seq
 384279666     gbest117.seq
 411713195     gbest118.seq
 524290061     gbest119.seq
 524291034     gbest12.seq
 524289592     gbest120.seq
 524290024     gbest121.seq
 524288922     gbest122.seq
 524290082     gbest123.seq
 463054937     gbest124.seq
 524291624     gbest125.seq
 524292219     gbest126.seq
 524289117     gbest127.seq
 524290681     gbest128.seq
 524289762     gbest129.seq
 156627343     gbest13.seq
 524292389     gbest130.seq
 524288898     gbest131.seq
 524289254     gbest132.seq
 524291522     gbest133.seq
 524288794     gbest134.seq
 524290255     gbest135.seq
 524289041     gbest136.seq
 274581986     gbest137.seq
 524290088     gbest138.seq
 524291115     gbest139.seq
 524288870     gbest14.seq
 524290183     gbest140.seq
 524290265     gbest141.seq
 524289886     gbest142.seq
 524289918     gbest143.seq
 524289020     gbest144.seq
 524290315     gbest145.seq
 524291739     gbest146.seq
 524292448     gbest147.seq
 524289334     gbest148.seq
 524290755     gbest149.seq
 524290155     gbest15.seq
 524290538     gbest150.seq
 477311655     gbest151.seq
 524291695     gbest152.seq
 524289611     gbest153.seq
 524291256     gbest154.seq
 524289499     gbest155.seq
 524289934     gbest156.seq
 524289994     gbest157.seq
 524289319     gbest158.seq
 524289646     gbest159.seq
 524289567     gbest16.seq
 502954761     gbest160.seq
 524290120     gbest161.seq
 524290259     gbest162.seq
 524290033     gbest163.seq
 248979924     gbest164.seq
 524290805     gbest165.seq
 524291535     gbest166.seq
 524294643     gbest167.seq
 524290660     gbest168.seq
 524290433     gbest169.seq
 524290523     gbest17.seq
 524291496     gbest170.seq
 524290035     gbest171.seq
 524291686     gbest172.seq
 524289937     gbest173.seq
 524290596     gbest174.seq
 524289347     gbest175.seq
 524292575     gbest176.seq
 524291503     gbest177.seq
 101315195     gbest178.seq
 524289180     gbest179.seq
 524289904     gbest18.seq
 524289136     gbest180.seq
 524289221     gbest181.seq
 524290490     gbest182.seq
 524291768     gbest183.seq
 524290757     gbest184.seq
 524290005     gbest185.seq
 524291613     gbest186.seq
 524289871     gbest187.seq
 524291202     gbest188.seq
 524293876     gbest189.seq
 524290621     gbest19.seq
 524289378     gbest190.seq
 456852241     gbest191.seq
 524288790     gbest192.seq
 524288740     gbest193.seq
 524290202     gbest194.seq
 524292433     gbest195.seq
 524291192     gbest196.seq
 524289575     gbest197.seq
 524290098     gbest198.seq
 524289056     gbest199.seq
 524289694     gbest2.seq
 524289338     gbest20.seq
 524289063     gbest200.seq
 524290267     gbest201.seq
 524291391     gbest202.seq
 524290994     gbest203.seq
 524290950     gbest204.seq
  97015180     gbest205.seq
 524290970     gbest206.seq
 524291353     gbest207.seq
 524290055     gbest208.seq
 524290657     gbest209.seq
 524288998     gbest21.seq
 524291159     gbest210.seq
 524288960     gbest211.seq
 524290750     gbest212.seq
 524290565     gbest213.seq
 524290809     gbest214.seq
 524289414     gbest215.seq
 428833873     gbest216.seq
 524288875     gbest217.seq
 524290677     gbest218.seq
 524289103     gbest219.seq
 511927020     gbest22.seq
 524289805     gbest220.seq
 524290688     gbest221.seq
 524290169     gbest222.seq
 524291121     gbest223.seq
 524289106     gbest224.seq
 524289987     gbest225.seq
 524288926     gbest226.seq
 524290948     gbest227.seq
 524290095     gbest228.seq
 524292137     gbest229.seq
 500387580     gbest23.seq
 374644285     gbest230.seq
 524291249     gbest231.seq
 524292507     gbest232.seq
 524293318     gbest233.seq
 524292243     gbest234.seq
 524288842     gbest235.seq
 524290986     gbest236.seq
 524288998     gbest237.seq
 524290397     gbest238.seq
 524289838     gbest239.seq
 509311549     gbest24.seq
 524289477     gbest240.seq
 524292577     gbest241.seq
 524291209     gbest242.seq
 524292667     gbest243.seq
 524288804     gbest244.seq
  49980486     gbest245.seq
 524290629     gbest246.seq
 524290592     gbest247.seq
 524291874     gbest248.seq
 524290456     gbest249.seq
 319437162     gbest25.seq
 524289872     gbest250.seq
 524290091     gbest251.seq
 524289218     gbest252.seq
 524290223     gbest253.seq
 524289785     gbest254.seq
 524290516     gbest255.seq
 524291373     gbest256.seq
 239729287     gbest257.seq
 524289955     gbest258.seq
 524289945     gbest259.seq
 524290900     gbest26.seq
 524289588     gbest260.seq
 524289852     gbest261.seq
 524290264     gbest262.seq
 524292224     gbest263.seq
 524289171     gbest264.seq
 524289794     gbest265.seq
 524291070     gbest266.seq
 524292248     gbest267.seq
 287769686     gbest268.seq
 524290474     gbest269.seq
 524289014     gbest27.seq
 524289236     gbest270.seq
 524289480     gbest271.seq
 524290409     gbest272.seq
 524288778     gbest273.seq
 524289165     gbest274.seq
 524288801     gbest275.seq
 524291013     gbest276.seq
 524291788     gbest277.seq
 524290141     gbest278.seq
 524289847     gbest279.seq
 524289431     gbest28.seq
 294998876     gbest280.seq
 524292740     gbest281.seq
 524291647     gbest282.seq
 524289321     gbest283.seq
 524289192     gbest284.seq
 524288821     gbest285.seq
 524292076     gbest286.seq
 524290725     gbest287.seq
 524288822     gbest288.seq
 524288784     gbest289.seq
 524291872     gbest29.seq
 524290143     gbest290.seq
 524290467     gbest291.seq
 230581210     gbest292.seq
 524291554     gbest293.seq
 524289109     gbest294.seq
 524289799     gbest295.seq
 524290690     gbest296.seq
 524291630     gbest297.seq
 524288972     gbest298.seq
 524289697     gbest299.seq
 497701912     gbest3.seq
 524292549     gbest30.seq
 524290233     gbest300.seq
 479524832     gbest301.seq
 485129560     gbest302.seq
 486633612     gbest303.seq
 314725057     gbest304.seq
 524291639     gbest305.seq
 524289239     gbest306.seq
 524290860     gbest307.seq
 524290383     gbest308.seq
 524289192     gbest309.seq
 524288756     gbest31.seq
 524290466     gbest310.seq
 524290184     gbest311.seq
 524289430     gbest312.seq
 524291713     gbest313.seq
 524289829     gbest314.seq
 524289317     gbest315.seq
 524290529     gbest316.seq
 512074338     gbest317.seq
 524291101     gbest318.seq
 524288782     gbest319.seq
 524289945     gbest32.seq
 524291357     gbest320.seq
 524291798     gbest321.seq
 524291027     gbest322.seq
 524290585     gbest323.seq
 524289278     gbest324.seq
 524290829     gbest325.seq
 524290817     gbest326.seq
 524291128     gbest327.seq
 524290194     gbest328.seq
 524291250     gbest329.seq
 524290428     gbest33.seq
 524292590     gbest330.seq
 263975353     gbest331.seq
 524290768     gbest332.seq
 524291223     gbest333.seq
 524289919     gbest334.seq
 524292957     gbest335.seq
 524291092     gbest336.seq
 524289977     gbest337.seq
 524288844     gbest338.seq
 524291963     gbest339.seq
 519456801     gbest34.seq
 524289432     gbest340.seq
 524290534     gbest341.seq
 524290105     gbest342.seq
 524290240     gbest343.seq
 524290696     gbest344.seq
 341259917     gbest345.seq
 524289552     gbest346.seq
 524289259     gbest347.seq
 524291284     gbest348.seq
 524291261     gbest349.seq
 492728679     gbest35.seq
 524290851     gbest350.seq
 524290786     gbest351.seq
 524293094     gbest352.seq
 524289611     gbest353.seq
 524289707     gbest354.seq
 524289103     gbest355.seq
 524290155     gbest356.seq
 524292000     gbest357.seq
 524292192     gbest358.seq
 507279497     gbest359.seq
 494454216     gbest36.seq
 524290736     gbest360.seq
 524288985     gbest361.seq
 524289055     gbest362.seq
 524291175     gbest363.seq
 524290982     gbest364.seq
 524289634     gbest365.seq
 524291250     gbest366.seq
 524288817     gbest367.seq
 524289632     gbest368.seq
 524290906     gbest369.seq
 493339530     gbest37.seq
 457135229     gbest370.seq
 524289984     gbest371.seq
 524290313     gbest372.seq
 524291793     gbest373.seq
 524291234     gbest374.seq
 524290339     gbest375.seq
 524289554     gbest376.seq
 509910119     gbest377.seq
 524290954     gbest378.seq
 524289802     gbest379.seq
 487999109     gbest38.seq
 524289143     gbest380.seq
 524289832     gbest381.seq
 280060364     gbest382.seq
 524290498     gbest383.seq
 524289336     gbest384.seq
 524290362     gbest385.seq
 524290862     gbest386.seq
 524288990     gbest387.seq
 524289729     gbest388.seq
 524291304     gbest389.seq
 493269666     gbest39.seq
 524290361     gbest390.seq
 524290188     gbest391.seq
 524290853     gbest392.seq
 524290257     gbest393.seq
 356933081     gbest394.seq
 524290936     gbest395.seq
 524289274     gbest396.seq
 524289485     gbest397.seq
 524289862     gbest398.seq
 524290453     gbest399.seq
 524288944     gbest4.seq
 111902842     gbest40.seq
 524289806     gbest400.seq
 524291302     gbest401.seq
 524290535     gbest402.seq
 524289855     gbest403.seq
 524290485     gbest404.seq
 524290547     gbest405.seq
 524290563     gbest406.seq
 428545235     gbest407.seq
 524291933     gbest408.seq
 524290947     gbest409.seq
 524292786     gbest41.seq
 524289871     gbest410.seq
 524291312     gbest411.seq
 524289152     gbest412.seq
 524289711     gbest413.seq
 524291828     gbest414.seq
 524289016     gbest415.seq
 524291948     gbest416.seq
 524288781     gbest417.seq
 524291072     gbest418.seq
 524290074     gbest419.seq
 524289049     gbest42.seq
 524291816     gbest420.seq
 524291315     gbest421.seq
  24850705     gbest422.seq
 524290525     gbest423.seq
 524289194     gbest424.seq
 524292359     gbest425.seq
 524290703     gbest426.seq
 524290271     gbest427.seq
 524292953     gbest428.seq
 524290192     gbest429.seq
 524289876     gbest43.seq
 524291469     gbest430.seq
 524289402     gbest431.seq
 524289929     gbest432.seq
 524292268     gbest433.seq
 524290426     gbest434.seq
 514877618     gbest435.seq
 524292089     gbest436.seq
 524291066     gbest437.seq
 524290666     gbest438.seq
 524292420     gbest439.seq
 524290680     gbest44.seq
 524289887     gbest440.seq
 524289156     gbest441.seq
 524291160     gbest442.seq
 524291222     gbest443.seq
 524289359     gbest444.seq
 524291140     gbest445.seq
 524290746     gbest446.seq
 309086173     gbest447.seq
 524289225     gbest448.seq
 524291157     gbest449.seq
 524290824     gbest45.seq
 524291614     gbest450.seq
 524292492     gbest451.seq
 524289389     gbest452.seq
 524291537     gbest453.seq
 524291136     gbest454.seq
 180069222     gbest455.seq
 524290407     gbest46.seq
 524290423     gbest47.seq
 524290276     gbest48.seq
 524289439     gbest49.seq
 524289625     gbest5.seq
 524290590     gbest50.seq
 524291356     gbest51.seq
 524289225     gbest52.seq
 524288899     gbest53.seq
 272574733     gbest54.seq
 524290709     gbest55.seq
 524288752     gbest56.seq
 524290193     gbest57.seq
 524290427     gbest58.seq
 524290141     gbest59.seq
 524288762     gbest6.seq
 524292004     gbest60.seq
 524291197     gbest61.seq
 524290276     gbest62.seq
 524290080     gbest63.seq
 524292904     gbest64.seq
 524289035     gbest65.seq
 524292721     gbest66.seq
 464668608     gbest67.seq
 524290678     gbest68.seq
 524288774     gbest69.seq
 524291145     gbest7.seq
 524290941     gbest70.seq
 524289318     gbest71.seq
 524289634     gbest72.seq
 524289100     gbest73.seq
 524289764     gbest74.seq
 524291984     gbest75.seq
 524290526     gbest76.seq
 524290605     gbest77.seq
 524288813     gbest78.seq
 524290658     gbest79.seq
 524289737     gbest8.seq
 203820323     gbest80.seq
 524289461     gbest81.seq
 524290721     gbest82.seq
 524290860     gbest83.seq
 524289624     gbest84.seq
 524291467     gbest85.seq
 524291710     gbest86.seq
 524291688     gbest87.seq
 524291317     gbest88.seq
 524291256     gbest89.seq
 524292211     gbest9.seq
 524290796     gbest90.seq
 524289921     gbest91.seq
 448858073     gbest92.seq
 524291246     gbest93.seq
 524291357     gbest94.seq
 524291406     gbest95.seq
 524292756     gbest96.seq
 524290446     gbest97.seq
 524291978     gbest98.seq
 524288877     gbest99.seq
 181594679     gbgen.idx
 524290352     gbgss1.seq
 524292173     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524290642     gbgss103.seq
 418354153     gbgss104.seq
 524290801     gbgss105.seq
 524290070     gbgss106.seq
 524290718     gbgss107.seq
 524288882     gbgss108.seq
 524289975     gbgss109.seq
 524291375     gbgss11.seq
 524291421     gbgss110.seq
 524290148     gbgss111.seq
 524289356     gbgss112.seq
 524290277     gbgss113.seq
 524291060     gbgss114.seq
 524289445     gbgss115.seq
  55567015     gbgss116.seq
 524289697     gbgss117.seq
 524288912     gbgss118.seq
 524289314     gbgss119.seq
 524290109     gbgss12.seq
 524288887     gbgss120.seq
 524290753     gbgss121.seq
 524289754     gbgss122.seq
 524291612     gbgss123.seq
 524290534     gbgss124.seq
 524289380     gbgss125.seq
 524290623     gbgss126.seq
 524290024     gbgss127.seq
 524289234     gbgss128.seq
 211213109     gbgss129.seq
 524289051     gbgss13.seq
 524289179     gbgss130.seq
 524289525     gbgss131.seq
 524289495     gbgss132.seq
 524291043     gbgss133.seq
 524288845     gbgss134.seq
 524291036     gbgss135.seq
 524292513     gbgss136.seq
 524288848     gbgss137.seq
 524289218     gbgss138.seq
 515991190     gbgss139.seq
 524289106     gbgss14.seq
 516016648     gbgss140.seq
 112195886     gbgss141.seq
 524289708     gbgss142.seq
 524291315     gbgss143.seq
 524290702     gbgss144.seq
 524290251     gbgss145.seq
 524290273     gbgss146.seq
 524288750     gbgss147.seq
 524290580     gbgss148.seq
 524290056     gbgss149.seq
 524289040     gbgss15.seq
 524290016     gbgss150.seq
 524290246     gbgss151.seq
 173867414     gbgss152.seq
 249999115     gbgss153.seq
 249999188     gbgss154.seq
 249998375     gbgss155.seq
 249999676     gbgss156.seq
  28632839     gbgss157.seq
 249997137     gbgss158.seq
 250000033     gbgss159.seq
 524290486     gbgss16.seq
 249998542     gbgss160.seq
 249998333     gbgss161.seq
 224919493     gbgss162.seq
 249998415     gbgss163.seq
 249998761     gbgss164.seq
 249998880     gbgss165.seq
 249997707     gbgss166.seq
 189046598     gbgss167.seq
 249999433     gbgss168.seq
 249998390     gbgss169.seq
 524288946     gbgss17.seq
 249999267     gbgss170.seq
 249997904     gbgss171.seq
 249997062     gbgss172.seq
  76835987     gbgss173.seq
 249998100     gbgss174.seq
   2079852     gbgss175.seq
  79542394     gbgss176.seq
 249999009     gbgss177.seq
 250000259     gbgss178.seq
  87380505     gbgss179.seq
 524291200     gbgss18.seq
 249999685     gbgss180.seq
 249998355     gbgss181.seq
 249998984     gbgss182.seq
 202719103     gbgss183.seq
 249999232     gbgss184.seq
 249999013     gbgss185.seq
 249998851     gbgss186.seq
 246250899     gbgss187.seq
 249999268     gbgss188.seq
 249997406     gbgss189.seq
 314849258     gbgss19.seq
 249999279     gbgss190.seq
 243520281     gbgss191.seq
 249999336     gbgss192.seq
 249997150     gbgss193.seq
 249998209     gbgss194.seq
 249998771     gbgss195.seq
 122182588     gbgss196.seq
 249998013     gbgss197.seq
 250000031     gbgss198.seq
 249999974     gbgss199.seq
 524289034     gbgss2.seq
 524288952     gbgss20.seq
 249998152     gbgss200.seq
  94058788     gbgss201.seq
 249998892     gbgss202.seq
 249999850     gbgss203.seq
 249998239     gbgss204.seq
 249999582     gbgss205.seq
 180308144     gbgss206.seq
 249999236     gbgss207.seq
 249997993     gbgss208.seq
 249998006     gbgss209.seq
 524289034     gbgss21.seq
 249999353     gbgss210.seq
  95926739     gbgss211.seq
 249999461     gbgss212.seq
 249999350     gbgss213.seq
 249998406     gbgss214.seq
 249998619     gbgss215.seq
 249999398     gbgss216.seq
 249999995     gbgss217.seq
  17245248     gbgss218.seq
 249999424     gbgss219.seq
 524291398     gbgss22.seq
 249999963     gbgss220.seq
 249997369     gbgss221.seq
  43648880     gbgss222.seq
  52862187     gbgss223.seq
 249999126     gbgss224.seq
 249999236     gbgss225.seq
 249997873     gbgss226.seq
 249998364     gbgss227.seq
  30976250     gbgss228.seq
 249997670     gbgss229.seq
 524290800     gbgss23.seq
 249997588     gbgss230.seq
 249999018     gbgss231.seq
 250000000     gbgss232.seq
  28042636     gbgss233.seq
 249997661     gbgss234.seq
 249998578     gbgss235.seq
 249998526     gbgss236.seq
 249998842     gbgss237.seq
 249999591     gbgss238.seq
 249998244     gbgss239.seq
 524291392     gbgss24.seq
 178918094     gbgss240.seq
 249999812     gbgss241.seq
 249998926     gbgss242.seq
 249999095     gbgss243.seq
 220154622     gbgss244.seq
 250000034     gbgss245.seq
 249997956     gbgss246.seq
 250000074     gbgss247.seq
 249998729     gbgss248.seq
 195288113     gbgss249.seq
 524290581     gbgss25.seq
 249999561     gbgss250.seq
 249998751     gbgss251.seq
 249999600     gbgss252.seq
 249999029     gbgss253.seq
 250000096     gbgss254.seq
  16614102     gbgss255.seq
 524290713     gbgss26.seq
 524289900     gbgss27.seq
 524288854     gbgss28.seq
 524289528     gbgss29.seq
 524289102     gbgss3.seq
 524289655     gbgss30.seq
  38849864     gbgss31.seq
 524289075     gbgss32.seq
 524290723     gbgss33.seq
 524288828     gbgss34.seq
 524289728     gbgss35.seq
 524289696     gbgss36.seq
 524289533     gbgss37.seq
 524290149     gbgss38.seq
 509095937     gbgss39.seq
 524290615     gbgss4.seq
 524291541     gbgss40.seq
 524289016     gbgss41.seq
 524291234     gbgss42.seq
  28742152     gbgss43.seq
 524288882     gbgss44.seq
 524291090     gbgss45.seq
 524290976     gbgss46.seq
 524290985     gbgss47.seq
 209346767     gbgss48.seq
 524291863     gbgss49.seq
 168350020     gbgss5.seq
 524291582     gbgss50.seq
 524290401     gbgss51.seq
 524290464     gbgss52.seq
 524290548     gbgss53.seq
 524290689     gbgss54.seq
 524289963     gbgss55.seq
 524289945     gbgss56.seq
 524290428     gbgss57.seq
 524291284     gbgss58.seq
 524290900     gbgss59.seq
 524290951     gbgss6.seq
   5856233     gbgss60.seq
 524289023     gbgss61.seq
 524290882     gbgss62.seq
 524290246     gbgss63.seq
 457238462     gbgss64.seq
 524290719     gbgss65.seq
 524291022     gbgss66.seq
 524290625     gbgss67.seq
 524289509     gbgss68.seq
 524291296     gbgss69.seq
 524289102     gbgss7.seq
 524290162     gbgss70.seq
 524290171     gbgss71.seq
 524290218     gbgss72.seq
 524289197     gbgss73.seq
 524291503     gbgss74.seq
 524289627     gbgss75.seq
 524291206     gbgss76.seq
  32487361     gbgss77.seq
 524289473     gbgss78.seq
 524291931     gbgss79.seq
 524291704     gbgss8.seq
 524289482     gbgss80.seq
 524290727     gbgss81.seq
 524289703     gbgss82.seq
 524289751     gbgss83.seq
 524289336     gbgss84.seq
 524290248     gbgss85.seq
 524289011     gbgss86.seq
 524292247     gbgss87.seq
 524290044     gbgss88.seq
 376569727     gbgss89.seq
 524290120     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249992912     gbhtc1.seq
 249993927     gbhtc10.seq
 249997743     gbhtc11.seq
  16726469     gbhtc12.seq
 249997534     gbhtc13.seq
 249996320     gbhtc14.seq
  59293891     gbhtc15.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  83873876     gbhtc8.seq
 249996616     gbhtc9.seq
 249904748     gbhtg1.seq
 249868447     gbhtg10.seq
 249917503     gbhtg100.seq
 249844944     gbhtg101.seq
 249902534     gbhtg102.seq
 249987029     gbhtg103.seq
   5671243     gbhtg104.seq
 249895732     gbhtg105.seq
 249878049     gbhtg106.seq
 249900433     gbhtg107.seq
 249851884     gbhtg108.seq
 249852416     gbhtg109.seq
   1107147     gbhtg11.seq
 249894066     gbhtg110.seq
 249963230     gbhtg111.seq
 249925320     gbhtg112.seq
 247164576     gbhtg113.seq
 189877972     gbhtg114.seq
 249974219     gbhtg115.seq
 249854932     gbhtg116.seq
 249918615     gbhtg117.seq
 249806582     gbhtg118.seq
 249809192     gbhtg119.seq
 249657443     gbhtg12.seq
  53489426     gbhtg120.seq
 249935891     gbhtg121.seq
 249834856     gbhtg122.seq
 249930798     gbhtg123.seq
 249875691     gbhtg124.seq
 249782400     gbhtg125.seq
 134760056     gbhtg126.seq
 249793216     gbhtg127.seq
 249910238     gbhtg128.seq
 249870863     gbhtg129.seq
 249699749     gbhtg13.seq
 249863756     gbhtg130.seq
 249968033     gbhtg131.seq
 249824826     gbhtg132.seq
 249737985     gbhtg133.seq
 249883130     gbhtg134.seq
 249907858     gbhtg135.seq
  71030319     gbhtg136.seq
 249765870     gbhtg14.seq
 249760883     gbhtg15.seq
 249998122     gbhtg16.seq
 249532502     gbhtg17.seq
 249983662     gbhtg18.seq
 249677291     gbhtg19.seq
 249994630     gbhtg2.seq
 249988730     gbhtg20.seq
 237145184     gbhtg21.seq
 249760624     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761207     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249841969     gbhtg29.seq
 249950135     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249920767     gbhtg33.seq
 249929437     gbhtg34.seq
 249919058     gbhtg35.seq
 249858205     gbhtg36.seq
 249814604     gbhtg37.seq
 249767419     gbhtg38.seq
 249627604     gbhtg39.seq
 249984089     gbhtg4.seq
 249839726     gbhtg40.seq
 224363115     gbhtg41.seq
 249889211     gbhtg42.seq
 249786793     gbhtg43.seq
 249972417     gbhtg44.seq
 249775813     gbhtg45.seq
 249913172     gbhtg46.seq
 249598316     gbhtg47.seq
 249865084     gbhtg48.seq
 249793045     gbhtg49.seq
 249882044     gbhtg5.seq
 249922715     gbhtg50.seq
 235040956     gbhtg51.seq
 249732687     gbhtg52.seq
 249918496     gbhtg53.seq
 249773162     gbhtg54.seq
 249971361     gbhtg55.seq
 249962512     gbhtg56.seq
  18795863     gbhtg57.seq
 249861195     gbhtg58.seq
 249939539     gbhtg59.seq
 249898460     gbhtg6.seq
 249990521     gbhtg60.seq
 249920368     gbhtg61.seq
 225327613     gbhtg62.seq
 249854069     gbhtg63.seq
 249787680     gbhtg64.seq
 249883720     gbhtg65.seq
 249980764     gbhtg66.seq
 249833261     gbhtg67.seq
  16614633     gbhtg68.seq
 249960711     gbhtg69.seq
 249933725     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249976832     gbhtg72.seq
 225297486     gbhtg73.seq
 249811217     gbhtg74.seq
 249874983     gbhtg75.seq
 249800230     gbhtg76.seq
 249959810     gbhtg77.seq
 244236211     gbhtg78.seq
 249883527     gbhtg79.seq
 249933567     gbhtg8.seq
 249989775     gbhtg80.seq
 249839558     gbhtg81.seq
 249838461     gbhtg82.seq
 216751380     gbhtg83.seq
 249966974     gbhtg84.seq
 249803194     gbhtg85.seq
 249757813     gbhtg86.seq
 249850131     gbhtg87.seq
 220831145     gbhtg88.seq
 249970053     gbhtg89.seq
 249923766     gbhtg9.seq
 249954204     gbhtg90.seq
 249999447     gbhtg91.seq
 249963669     gbhtg92.seq
 208918917     gbhtg93.seq
 249866049     gbhtg94.seq
 249911674     gbhtg95.seq
 249904005     gbhtg96.seq
 249804025     gbhtg97.seq
 168109739     gbhtg98.seq
 249744688     gbhtg99.seq
 249999673     gbinv1.seq
 249997453     gbinv10.seq
 165453589     gbinv11.seq
 249999290     gbinv12.seq
 249998664     gbinv13.seq
 249994139     gbinv14.seq
 149023212     gbinv15.seq
 249998069     gbinv16.seq
 248574205     gbinv17.seq
 250000151     gbinv18.seq
 249998912     gbinv19.seq
 249950833     gbinv2.seq
 249999337     gbinv20.seq
 114523974     gbinv21.seq
 249930410     gbinv22.seq
 175506919     gbinv23.seq
 249999260     gbinv24.seq
 249997009     gbinv25.seq
 250000015     gbinv26.seq
 221159464     gbinv27.seq
 249999431     gbinv28.seq
 249997069     gbinv29.seq
 242742644     gbinv3.seq
 249997666     gbinv30.seq
 249999366     gbinv31.seq
 150258267     gbinv32.seq
 249998497     gbinv4.seq
 249999523     gbinv5.seq
 249998746     gbinv6.seq
 219319984     gbinv7.seq
 249999709     gbinv8.seq
 249998875     gbinv9.seq
 140102522     gbjou1.idx
 299070211     gbjou10.idx
 262313186     gbjou11.idx
 235597318     gbjou12.idx
  33117805     gbjou13.idx
 139809971     gbjou2.idx
 164800467     gbjou3.idx
 186122154     gbjou4.idx
 271084558     gbjou5.idx
 277604882     gbjou6.idx
 281000150     gbjou7.idx
 281532811     gbjou8.idx
 305259068     gbjou9.idx
 341466895     gbkey1.idx
 180076044     gbkey2.idx
 179699900     gbkey3.idx
 289064002     gbkey4.idx
 183435417     gbkey5.idx
 112768501     gbkey6.idx
 249993498     gbmam1.seq
 249970151     gbmam2.seq
 249921125     gbmam3.seq
 249997135     gbmam4.seq
 250000133     gbmam5.seq
 249998112     gbmam6.seq
 230773205     gbmam7.seq
  57028188     gbnew.txt
 249999770     gbpat1.seq
 249999665     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192934428     gbpat107.seq
 249999496     gbpat108.seq
 249999625     gbpat109.seq
 179586938     gbpat11.seq
 249996349     gbpat110.seq
  80124376     gbpat111.seq
 250000053     gbpat112.seq
 249999653     gbpat113.seq
 249990767     gbpat114.seq
 249999878     gbpat115.seq
 249849703     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 250000166     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 249995194     gbpat13.seq
 249997452     gbpat130.seq
  66832984     gbpat131.seq
 249992315     gbpat132.seq
 249999867     gbpat133.seq
 250000197     gbpat134.seq
 249999821     gbpat135.seq
 249998337     gbpat136.seq
 249999652     gbpat137.seq
 249998219     gbpat138.seq
 196855168     gbpat139.seq
 249998945     gbpat14.seq
 249998039     gbpat140.seq
 250000068     gbpat141.seq
 250000015     gbpat142.seq
  86028783     gbpat143.seq
 249999922     gbpat144.seq
 249997650     gbpat145.seq
 249999904     gbpat146.seq
  63539765     gbpat147.seq
 249996030     gbpat148.seq
 249999769     gbpat149.seq
 250000196     gbpat15.seq
 249999693     gbpat150.seq
 249999623     gbpat151.seq
 249999693     gbpat152.seq
 249998756     gbpat153.seq
 222137586     gbpat154.seq
 250000249     gbpat155.seq
 249999893     gbpat156.seq
 249999893     gbpat157.seq
 220539897     gbpat158.seq
 249999753     gbpat159.seq
 249999915     gbpat16.seq
 249998685     gbpat160.seq
 249999501     gbpat161.seq
  12381933     gbpat162.seq
 249997013     gbpat163.seq
 249998113     gbpat164.seq
 249999692     gbpat165.seq
 250000218     gbpat166.seq
  35343603     gbpat167.seq
 249998580     gbpat168.seq
 249999008     gbpat169.seq
  65896429     gbpat17.seq
 249999332     gbpat170.seq
 249999797     gbpat171.seq
 250000001     gbpat172.seq
 249999979     gbpat173.seq
 249999414     gbpat174.seq
 250000129     gbpat175.seq
 120826235     gbpat176.seq
 250000027     gbpat18.seq
 249999801     gbpat19.seq
 249999577     gbpat2.seq
 249999076     gbpat20.seq
 249996891     gbpat21.seq
 185825039     gbpat22.seq
 249999073     gbpat23.seq
 249858807     gbpat24.seq
 249999670     gbpat25.seq
 249999337     gbpat26.seq
  71191909     gbpat27.seq
 249986090     gbpat28.seq
 249998686     gbpat29.seq
 249999257     gbpat3.seq
 249997796     gbpat30.seq
 249999847     gbpat31.seq
 250000237     gbpat32.seq
 180194123     gbpat33.seq
 249997899     gbpat34.seq
 249999728     gbpat35.seq
 249999308     gbpat36.seq
 250000194     gbpat37.seq
 130534023     gbpat38.seq
 249996351     gbpat39.seq
 249998049     gbpat4.seq
 249993703     gbpat40.seq
 249999077     gbpat41.seq
 249999014     gbpat42.seq
 249997197     gbpat43.seq
 249845198     gbpat44.seq
 249999190     gbpat45.seq
 250000092     gbpat46.seq
 171468056     gbpat47.seq
 249999830     gbpat48.seq
 249998527     gbpat49.seq
  71794649     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164989586     gbpat56.seq
 249883148     gbpat57.seq
 249999624     gbpat58.seq
 249999654     gbpat59.seq
 249999527     gbpat6.seq
 249999026     gbpat60.seq
 134923930     gbpat61.seq
 249998969     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999577     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249999768     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244403395     gbpat72.seq
 248969066     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999901     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249991472     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 250000008     gbpat82.seq
 249998696     gbpat83.seq
  93332873     gbpat84.seq
 249155886     gbpat85.seq
 249999519     gbpat86.seq
 249999913     gbpat87.seq
 249999359     gbpat88.seq
 249999368     gbpat89.seq
 249999472     gbpat9.seq
 250000155     gbpat90.seq
 145293161     gbpat91.seq
 249999203     gbpat92.seq
 249998980     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196964910     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 176778777     gbphg1.seq
 249998558     gbpln1.seq
 249996097     gbpln10.seq
 249998146     gbpln11.seq
 249760575     gbpln12.seq
 214796021     gbpln13.seq
 249998215     gbpln14.seq
 249985349     gbpln15.seq
 249996352     gbpln16.seq
 249592760     gbpln17.seq
 249984680     gbpln18.seq
 249606536     gbpln19.seq
 249912130     gbpln2.seq
 250000196     gbpln20.seq
  33446762     gbpln21.seq
 249992399     gbpln22.seq
  97611111     gbpln23.seq
 249998695     gbpln24.seq
 249997899     gbpln25.seq
 249464846     gbpln26.seq
 221100868     gbpln27.seq
 241343495     gbpln28.seq
 249928944     gbpln29.seq
 249880937     gbpln3.seq
 246853724     gbpln30.seq
 249998194     gbpln31.seq
 250000030     gbpln32.seq
 245605439     gbpln33.seq
 249998432     gbpln34.seq
 250000164     gbpln35.seq
 249998547     gbpln36.seq
 249997180     gbpln37.seq
 137427689     gbpln38.seq
 249997211     gbpln39.seq
 249847550     gbpln4.seq
 249997547     gbpln40.seq
 249998338     gbpln41.seq
 249998305     gbpln42.seq
 249999352     gbpln43.seq
 177280619     gbpln44.seq
 249998120     gbpln45.seq
 246082663     gbpln46.seq
 249997392     gbpln47.seq
 249997614     gbpln48.seq
 249996903     gbpln49.seq
 249913869     gbpln5.seq
 249841671     gbpln50.seq
 249999521     gbpln51.seq
 249994338     gbpln52.seq
 135119513     gbpln53.seq
 249941327     gbpln6.seq
 249998388     gbpln7.seq
 244688955     gbpln8.seq
 249998386     gbpln9.seq
 148949613     gbpri1.seq
 249783195     gbpri10.seq
 129741660     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902483     gbpri16.seq
 249876241     gbpri17.seq
 249991978     gbpri18.seq
 249903004     gbpri19.seq
 249833335     gbpri2.seq
 249946699     gbpri20.seq
 249965782     gbpri21.seq
 249997606     gbpri22.seq
  23019766     gbpri23.seq
 177481363     gbpri24.seq
 249996755     gbpri25.seq
 211364614     gbpri26.seq
 249987118     gbpri27.seq
 249988725     gbpri28.seq
 249948820     gbpri29.seq
 250000076     gbpri3.seq
 249935405     gbpri30.seq
 249945956     gbpri31.seq
 249992481     gbpri32.seq
 249821502     gbpri33.seq
 249997164     gbpri34.seq
  95885621     gbpri35.seq
 249993971     gbpri36.seq
 249998020     gbpri37.seq
 249953956     gbpri38.seq
 249996013     gbpri39.seq
 249968482     gbpri4.seq
 249999244     gbpri40.seq
 181770071     gbpri41.seq
 249965759     gbpri42.seq
 249864502     gbpri43.seq
  57274461     gbpri44.seq
 249956957     gbpri5.seq
 249788332     gbpri6.seq
 249806906     gbpri7.seq
 249867498     gbpri8.seq
 249957345     gbpri9.seq
    322601     gbrel.txt
 249739971     gbrod1.seq
 249947629     gbrod10.seq
  61165475     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249824125     gbrod18.seq
 243108819     gbrod19.seq
 249823318     gbrod2.seq
 249767627     gbrod20.seq
 249924095     gbrod21.seq
 230194968     gbrod22.seq
 249997396     gbrod23.seq
 249996911     gbrod24.seq
 249980494     gbrod25.seq
 249698931     gbrod26.seq
 250000195     gbrod27.seq
 250000060     gbrod28.seq
 197625777     gbrod29.seq
 249879603     gbrod3.seq
 249870854     gbrod4.seq
 249889593     gbrod5.seq
 249922241     gbrod6.seq
 249963764     gbrod7.seq
 249791979     gbrod8.seq
 249906937     gbrod9.seq
4075873506     gbsdr1.txt
5750726401     gbsdr2.txt
2712808841     gbsdr3.txt
 157926185     gbsec.idx
 249997389     gbsts1.seq
 249997720     gbsts10.seq
 210919464     gbsts11.seq
 249996524     gbsts12.seq
 249999349     gbsts13.seq
 249999266     gbsts14.seq
 249999572     gbsts15.seq
  24470469     gbsts16.seq
 249999107     gbsts17.seq
 249997790     gbsts18.seq
 249999071     gbsts19.seq
 249998220     gbsts2.seq
 148558500     gbsts20.seq
 249999008     gbsts3.seq
 249998277     gbsts4.seq
  39162150     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998706     gbsts9.seq
 249996557     gbsyn1.seq
 249998815     gbsyn2.seq
 249984763     gbsyn3.seq
 249947035     gbsyn4.seq
 249995230     gbsyn5.seq
 249963999     gbsyn6.seq
 131727192     gbsyn7.seq
 249999888     gbtsa1.seq
 249999324     gbtsa10.seq
 250000124     gbtsa11.seq
 103880100     gbtsa12.seq
 249997835     gbtsa13.seq
 249999221     gbtsa14.seq
 249998017     gbtsa15.seq
 249997884     gbtsa16.seq
 167500778     gbtsa17.seq
 249998217     gbtsa18.seq
 250000150     gbtsa19.seq
 249997963     gbtsa2.seq
 249998775     gbtsa20.seq
 249998636     gbtsa21.seq
 249998457     gbtsa22.seq
 249998315     gbtsa23.seq
  30034786     gbtsa24.seq
 249998710     gbtsa25.seq
 249997475     gbtsa26.seq
 249998934     gbtsa27.seq
 249999882     gbtsa28.seq
 249998307     gbtsa29.seq
 249998332     gbtsa3.seq
 249999868     gbtsa30.seq
 119964559     gbtsa31.seq
 249998534     gbtsa32.seq
 249999961     gbtsa33.seq
 249999936     gbtsa34.seq
 249997768     gbtsa35.seq
 249999157     gbtsa36.seq
 249998280     gbtsa37.seq
 250000199     gbtsa38.seq
 249999536     gbtsa39.seq
 250000057     gbtsa4.seq
  14520715     gbtsa40.seq
 249999887     gbtsa41.seq
 249996608     gbtsa42.seq
 249999449     gbtsa43.seq
 249998204     gbtsa44.seq
 249998438     gbtsa45.seq
 249997723     gbtsa46.seq
 249998943     gbtsa47.seq
 110697379     gbtsa48.seq
 249995009     gbtsa49.seq
  83183501     gbtsa5.seq
 249996881     gbtsa50.seq
 249999075     gbtsa51.seq
 250000118     gbtsa52.seq
 171293596     gbtsa53.seq
 249999549     gbtsa54.seq
 249999642     gbtsa55.seq
 249998666     gbtsa56.seq
 249999859     gbtsa57.seq
 249996519     gbtsa58.seq
 249995507     gbtsa59.seq
 249999109     gbtsa6.seq
 155002488     gbtsa60.seq
 249996202     gbtsa7.seq
 249998532     gbtsa8.seq
 249999947     gbtsa9.seq
    483312     gbuna1.seq
 249998531     gbvrl1.seq
 249998716     gbvrl10.seq
 122631559     gbvrl11.seq
 249998278     gbvrl12.seq
 249999459     gbvrl13.seq
 249996666     gbvrl14.seq
 249999005     gbvrl15.seq
 249983590     gbvrl16.seq
 249998486     gbvrl17.seq
 248872137     gbvrl18.seq
 249999564     gbvrl19.seq
 249999629     gbvrl2.seq
  42845633     gbvrl20.seq
 249999748     gbvrl3.seq
 249998265     gbvrl4.seq
 186864801     gbvrl5.seq
 249999313     gbvrl6.seq
 249997804     gbvrl7.seq
 249998121     gbvrl8.seq
 249998669     gbvrl9.seq
 249975650     gbvrt1.seq
 249762539     gbvrt10.seq
 249940020     gbvrt11.seq
 185678776     gbvrt12.seq
 249995062     gbvrt13.seq
 249964366     gbvrt14.seq
 249831294     gbvrt15.seq
 249998244     gbvrt16.seq
 249998335     gbvrt17.seq
 249999421     gbvrt18.seq
  98559517     gbvrt19.seq
 249998108     gbvrt2.seq
 249914234     gbvrt20.seq
 249998095     gbvrt21.seq
 249996116     gbvrt22.seq
 249999033     gbvrt23.seq
 249998863     gbvrt24.seq
 132520878     gbvrt25.seq
 249975066     gbvrt3.seq
 249995434     gbvrt4.seq
  96586634     gbvrt5.seq
 249998200     gbvrt6.seq
 249995207     gbvrt7.seq
 249818477     gbvrt8.seq
 249951536     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64294      86001814
BCT10        64         115520696
BCT11        93         115223175
BCT12        92         107627430
BCT13        16110      78797266
BCT14        53933      85390732
BCT15        93         110189094
BCT16        151        93915681
BCT17        61         112455059
BCT18        52         112042350
BCT19        46         114233015
BCT2         3687       109862960
BCT20        58         114931588
BCT21        67         111284815
BCT22        36         96325907
BCT23        40         106881287
BCT24        58         105533856
BCT25        74         111675186
BCT26        55         110045255
BCT27        63         106845575
BCT28        55         109391288
BCT29        53         108650404
BCT3         51         110598894
BCT30        46         110496749
BCT31        95         109522868
BCT32        59         110966729
BCT33        67         108616570
BCT34        124        106350090
BCT35        36         69419425
BCT36        202        109105429
BCT37        51         109861512
BCT38        40         106911174
BCT39        54         104252121
BCT4         55         106656794
BCT40        58         107350200
BCT41        44         110960713
BCT42        80         107599606
BCT43        52         108571742
BCT44        46         107138318
BCT45        63         108219635
BCT46        73         107730422
BCT47        61         68565025
BCT48        68         109366515
BCT49        65         102053208
BCT5         38315      81647768
BCT50        49         103628191
BCT51        53         107838942
BCT52        54         107298795
BCT53        66         110212402
BCT54        63         106817738
BCT55        51         108471276
BCT56        59         112271787
BCT57        61         101581985
BCT58        51         112256524
BCT59        49         61864990
BCT6         39043      82651736
BCT60        40         109701549
BCT61        76         109232217
BCT62        267        100367663
BCT63        333        36024746
BCT64        1589       2511877
BCT65        3179       5215895
BCT66        6347       7901828
BCT67        12648      15076979
BCT68        25628      27748212
BCT69        50523      53996220
BCT7         5523       96146388
BCT70        76419      77523911
BCT71        71646      77213128
BCT72        9130       93784186
BCT73        5582       104214738
BCT74        3040       104932582
BCT75        68         117066999
BCT76        6090       111349481
BCT77        28736      98141325
BCT78        13508      13475693
BCT79        68275      80482885
BCT8         13867      90150583
BCT80        65338      84200660
BCT81        71797      82607686
BCT82        28499      59774766
BCT9         6748       96304913
ENV1         94336      71367060
ENV10        83176      87258219
ENV11        20151      17417530
ENV12        84824      80874260
ENV13        120528     43471978
ENV14        88803      78146413
ENV15        96648      67746416
ENV16        96131      63481881
ENV17        115137     66005408
ENV18        111280     70659464
ENV19        50578      68290501
ENV2         91303      69206812
ENV20        68113      87692396
ENV21        91179      74668724
ENV22        128367     34403925
ENV23        123053     29095686
ENV24        77627      17793372
ENV25        123136     49870768
ENV26        97611      68195055
ENV27        116372     55934950
ENV28        137000     52573811
ENV29        107637     58857088
ENV3         84915      75668086
ENV30        39271      39538609
ENV31        71058      96548027
ENV32        95515      69640088
ENV33        107731     43880504
ENV34        89966      66930791
ENV35        56971      35960774
ENV36        111419     47247795
ENV37        102180     61266206
ENV38        107426     64312385
ENV39        66717      95281930
ENV4         81943      84206805
ENV40        76780      85413380
ENV41        63294      86014608
ENV42        80539      84909910
ENV43        109558     47774738
ENV44        113978     56791864
ENV45        104184     61223043
ENV46        99788      46951523
ENV47        53479      55223199
ENV48        42545      54913053
ENV49        50522      57905939
ENV5         88040      86934708
ENV50        52831      40337879
ENV6         95906      58076672
ENV7         131779     31253773
ENV8         86386      70482311
ENV9         93283      72934378
EST1         158932     61578479
EST10        167449     72157693
EST100       226264     140239030
EST101       227876     115659958
EST102       201207     104812696
EST103       172048     100993598
EST104       102141     80099408
EST105       165086     110960002
EST106       168528     110445423
EST107       117336     68340860
EST108       63863      23527312
EST109       64115      22727247
EST11        169551     73990710
EST110       64332      23421594
EST111       64296      27232269
EST112       64304      21892571
EST113       65713      25960282
EST114       63774      27850880
EST115       64286      26247748
EST116       64525      26965223
EST117       64244      25128362
EST118       61232      38021283
EST119       162068     76978898
EST12        166812     70069138
EST120       174823     86140156
EST121       158477     92898019
EST122       149626     95761470
EST123       153477     89559420
EST124       125895     78316874
EST125       202876     99251380
EST126       153535     79573162
EST127       157661     84198371
EST128       155783     89048296
EST129       149626     79582445
EST13        72705      34876658
EST130       174498     101221879
EST131       199755     116492004
EST132       182924     99395258
EST133       162692     84591078
EST134       158421     80023195
EST135       145997     89295313
EST136       142146     85882253
EST137       93960      49352258
EST138       188208     107207834
EST139       232320     102104376
EST14        217986     109455110
EST140       153004     89672629
EST141       168259     91528034
EST142       146979     87094926
EST143       137539     86872130
EST144       157510     95441526
EST145       146282     76542905
EST146       123493     64365855
EST147       121742     65859763
EST148       129203     54566948
EST149       127602     50731997
EST15        168490     105323990
EST150       128339     51062027
EST151       119514     45394613
EST152       171932     86436994
EST153       180065     80258706
EST154       154571     109521263
EST155       211737     129261883
EST156       212986     118484045
EST157       174105     93300826
EST158       148709     112122807
EST159       133571     83237599
EST16        179029     112341391
EST160       157444     98145607
EST161       150350     80155185
EST162       141481     81542752
EST163       169364     94462991
EST164       73618      44488129
EST165       154569     95950095
EST166       188990     106179151
EST167       142577     78078416
EST168       135417     71887544
EST169       168396     93985371
EST17        195243     112992327
EST170       180159     103533799
EST171       150823     94202610
EST172       171478     83608777
EST173       129358     86255611
EST174       182198     107533871
EST175       165159     93307646
EST176       112579     66644049
EST177       163530     93202672
EST178       34710      22031886
EST179       169043     101002867
EST18        190717     121438671
EST180       181556     127477884
EST181       148649     106499913
EST182       190815     99702065
EST183       152893     115942608
EST184       144199     86861616
EST185       145313     82975661
EST186       177761     71821018
EST187       149418     84308853
EST188       155265     97136743
EST189       162803     99958406
EST19        159309     114089325
EST190       141910     88193240
EST191       162273     94468553
EST192       133855     89816808
EST193       131328     88454601
EST194       144687     89212211
EST195       134202     89314896
EST196       124157     87254921
EST197       172837     92195051
EST198       173996     95856725
EST199       173450     96328504
EST2         161860     61550624
EST20        187006     99412606
EST200       171159     96079370
EST201       168285     94223836
EST202       172233     95843088
EST203       173454     95045895
EST204       173997     95580344
EST205       32353      17600201
EST206       191190     103860386
EST207       202399     106545611
EST208       174612     105290290
EST209       183703     103807433
EST21        217053     106420614
EST210       197445     118768904
EST211       195632     116461293
EST212       182839     121365485
EST213       174038     104931408
EST214       214275     146902968
EST215       237722     107486446
EST216       138982     107986441
EST217       150845     101470219
EST218       146713     91002724
EST219       205529     111398949
EST22        198810     65934409
EST220       171951     113780568
EST221       100206     91312194
EST222       142424     110344313
EST223       160805     94665708
EST224       145887     106334751
EST225       216110     100555264
EST226       144427     101973020
EST227       137791     96797877
EST228       140548     100920077
EST229       121073     86002347
EST23        140953     40083895
EST230       95681      61722132
EST231       141403     91621985
EST232       133047     97994613
EST233       137803     98183941
EST234       123959     84448347
EST235       132199     86593914
EST236       158292     116643709
EST237       143683     116993241
EST238       133482     113395695
EST239       154615     95276872
EST24        103790     28102181
EST240       178340     113056931
EST241       146211     92203435
EST242       179436     111973974
EST243       164794     123136254
EST244       138960     103017140
EST245       12995      10338977
EST246       164807     100778786
EST247       230812     96671728
EST248       152562     113500463
EST249       178761     65596315
EST25        121323     50824188
EST250       216961     49656200
EST251       212780     81670339
EST252       170960     131660037
EST253       165374     101272276
EST254       168637     107721170
EST255       164804     111350210
EST256       166247     117451460
EST257       87266      44454798
EST258       187641     98453210
EST259       176353     111474148
EST26        213567     97133327
EST260       165193     109409916
EST261       232866     110419695
EST262       278040     120184258
EST263       184361     112203903
EST264       187434     36788592
EST265       259128     124407706
EST266       151769     94429035
EST267       161061     104996037
EST268       96153      56063663
EST269       173732     118471832
EST27        219261     110222276
EST270       183922     98723613
EST271       171922     113285975
EST272       182231     105591250
EST273       207951     37037605
EST274       191352     55825724
EST275       185585     105698019
EST276       187355     118409581
EST277       173193     113520410
EST278       179764     102509586
EST279       156358     104439555
EST28        190448     88579855
EST280       111475     37026413
EST281       129945     81935339
EST282       132677     85876525
EST283       155844     100776555
EST284       259866     27446115
EST285       263841     24254737
EST286       146877     105656582
EST287       168713     109218667
EST288       161516     103164737
EST289       155244     91251515
EST29        157995     68875086
EST290       265124     31874298
EST291       164960     107915265
EST292       73836      43204168
EST293       185152     111347902
EST294       148934     90569926
EST295       195053     109717730
EST296       164749     115054659
EST297       161800     104549986
EST298       189278     113681866
EST299       179235     100232458
EST3         153644     54437600
EST30        171542     69631452
EST300       181207     103505381
EST301       188377     64371570
EST302       187448     69681221
EST303       187279     70947853
EST304       122801     47049026
EST305       187254     91592670
EST306       181990     133376579
EST307       149980     86434895
EST308       154313     90638859
EST309       128613     100430992
EST31        148896     63217399
EST310       156897     97944790
EST311       170040     97302122
EST312       154961     96676546
EST313       170741     98704014
EST314       157177     105017526
EST315       145744     101391698
EST316       165285     106495474
EST317       156576     114299915
EST318       182313     153773675
EST319       172733     95817504
EST32        168362     76138490
EST320       134987     84431174
EST321       143893     98898838
EST322       141053     94417289
EST323       139130     91185759
EST324       146132     101303442
EST325       150947     101392765
EST326       179129     106530175
EST327       149751     86901009
EST328       151785     86169907
EST329       155759     113149793
EST33        173962     66610573
EST330       158584     94640910
EST331       73804      48737847
EST332       139176     87247235
EST333       152418     94688064
EST334       206522     106364357
EST335       115452     63926215
EST336       102494     65094261
EST337       132707     88797098
EST338       139164     88032273
EST339       122287     75088277
EST34        122831     43242860
EST340       216348     82400999
EST341       181678     87208748
EST342       157776     94956094
EST343       178426     108918245
EST344       151229     90220551
EST345       83587      54939881
EST346       134637     90100387
EST347       145777     95314746
EST348       187422     116060164
EST349       158438     91984941
EST35        97393      29892123
EST350       173706     98853201
EST351       176791     128945349
EST352       83329      51200600
EST353       82487      46935356
EST354       148500     85054277
EST355       131122     77274291
EST356       157359     42943688
EST357       158894     31765703
EST358       155034     47945313
EST359       185611     120243412
EST36        97797      30586622
EST360       245901     114144337
EST361       250958     114637605
EST362       177943     100469795
EST363       142525     92278852
EST364       137795     86189021
EST365       155864     92851889
EST366       193886     119159003
EST367       223605     60086256
EST368       183204     112114927
EST369       223166     121529297
EST37        96709      29346134
EST370       140447     68389240
EST371       168272     93109672
EST372       158111     105213526
EST373       196254     132751999
EST374       173225     135238819
EST375       175026     119752921
EST376       163378     96916373
EST377       166455     109595119
EST378       196295     111008314
EST379       187806     97455820
EST38        98630      29837565
EST380       198836     121310026
EST381       192539     128771730
EST382       103802     68436488
EST383       207894     139986587
EST384       215906     131151555
EST385       208860     168492896
EST386       184014     117722530
EST387       195760     110847208
EST388       171411     25348392
EST389       161467     13464054
EST39        99441      31226275
EST390       156725     23284758
EST391       158510     32685506
EST392       158972     31576678
EST393       153035     68277003
EST394       106078     61729486
EST395       181383     115973075
EST396       165683     105418274
EST397       164203     108379743
EST398       143750     95795568
EST399       142090     100612305
EST4         170812     67108330
EST40        23166      5905608
EST400       149119     95110466
EST401       178802     129930010
EST402       146756     93853950
EST403       172524     82486190
EST404       167761     26790112
EST405       165497     87345879
EST406       154826     105070333
EST407       139371     87250639
EST408       149060     92953928
EST409       173331     97527841
EST41        101002     53008237
EST410       184612     126556856
EST411       139198     92155516
EST412       132071     90393747
EST413       154718     95705951
EST414       163636     93716047
EST415       177757     96048778
EST416       148437     93011850
EST417       170665     100990840
EST418       173431     106262437
EST419       129160     81298911
EST42        119591     50876281
EST420       89324      67636175
EST421       81031      61307803
EST422       8126       4213382
EST423       117932     74586021
EST424       152635     84896632
EST425       128601     78239095
EST426       138076     92607343
EST427       141723     83367347
EST428       165100     96295215
EST429       179146     94431334
EST43        164126     85792534
EST430       168897     107318718
EST431       148879     95276212
EST432       173181     77728918
EST433       172158     89977820
EST434       147525     83561865
EST435       196612     115275569
EST436       206016     121379791
EST437       166367     101953408
EST438       148495     110874517
EST439       135526     83036949
EST44        166553     67568905
EST440       137530     86491505
EST441       210049     79447310
EST442       186615     82542769
EST443       205369     87789226
EST444       205437     104923427
EST445       199216     119610825
EST446       171711     104168011
EST447       106741     69861680
EST448       149418     92244251
EST449       157676     107648619
EST45        166151     87494905
EST450       190529     97067882
EST451       152303     85475146
EST452       151141     79116091
EST453       161583     58851294
EST454       167312     62340562
EST455       58140      21404063
EST46        170543     87214631
EST47        162206     87522674
EST48        162815     82218649
EST49        157673     91174856
EST5         168996     66194437
EST50        161232     91055515
EST51        158740     98028371
EST52        157227     69628234
EST53        150414     82908716
EST54        81727      50008137
EST55        167804     67469558
EST56        160637     76530251
EST57        168910     93006890
EST58        156502     101565373
EST59        157574     100365242
EST6         171504     66930687
EST60        163321     100740971
EST61        160517     106017460
EST62        172752     74009357
EST63        173113     100919246
EST64        151399     80261551
EST65        151039     84149386
EST66        159175     99439664
EST67        137256     78680397
EST68        143278     85052060
EST69        196241     109283008
EST7         169800     72720649
EST70        197806     103725202
EST71        211701     118740452
EST72        191988     113282334
EST73        193866     114172508
EST74        160438     86445853
EST75        133292     62214821
EST76        136782     68624799
EST77        158599     108209172
EST78        155640     85577784
EST79        144445     78843794
EST8         179404     72869764
EST80        55909      37367851
EST81        182540     94454774
EST82        211248     123227819
EST83        214378     115129521
EST84        209163     98414931
EST85        209040     91195659
EST86        148529     90253143
EST87        144306     83890167
EST88        162803     81161627
EST89        159941     80848835
EST9         168515     69281418
EST90        151958     102903772
EST91        152622     99264915
EST92        133417     75842326
EST93        152420     115234390
EST94        141968     104568184
EST95        145379     105381481
EST96        139442     88336562
EST97        152795     86184751
EST98        174897     107332720
EST99        243563     149230578
GSS1         200062     87617305
GSS10        132040     60283336
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167238     128921102
GSS104       149783     82569304
GSS105       191527     120854119
GSS106       167747     112125081
GSS107       197328     115524481
GSS108       204979     134772318
GSS109       209812     138226237
GSS11        137026     73963213
GSS110       207578     140849552
GSS111       206236     142442659
GSS112       205251     143737410
GSS113       205175     143938693
GSS114       202120     146641002
GSS115       182321     139888903
GSS116       18410      10872590
GSS117       132848     84052151
GSS118       169611     80019194
GSS119       184271     79450634
GSS12        147892     75892246
GSS120       170296     148327490
GSS121       177468     120473044
GSS122       184875     149490039
GSS123       192483     124742719
GSS124       187594     137810663
GSS125       192263     126742219
GSS126       190506     95556959
GSS127       166327     152962022
GSS128       164142     115734017
GSS129       65893      42218697
GSS13        145394     68606713
GSS130       171037     155489454
GSS131       172571     154290391
GSS132       172231     155358474
GSS133       173848     154157454
GSS134       172390     153324435
GSS135       184233     143887127
GSS136       182583     147198604
GSS137       163082     115404420
GSS138       206389     88572477
GSS139       265737     40934133
GSS14        169809     84775223
GSS140       265732     40960783
GSS141       57803      8869777
GSS142       256185     58367796
GSS143       253136     60903252
GSS144       193386     82083863
GSS145       194899     73134952
GSS146       185020     152902548
GSS147       179264     156888408
GSS148       172593     159246879
GSS149       194033     127388923
GSS15        161099     97662972
GSS150       245524     58771424
GSS151       210585     101878246
GSS152       84247      16088316
GSS153       87119      64001690
GSS154       83555      62807025
GSS155       103679     48622004
GSS156       68579      58473846
GSS157       7668       7019084
GSS158       68591      57924394
GSS159       69224      56650935
GSS16        172836     87033449
GSS160       69460      56187403
GSS161       71202      55998401
GSS162       68561      51865315
GSS163       75915      58209304
GSS164       87237      74898207
GSS165       81830      44609896
GSS166       92677      45029689
GSS167       63209      47603494
GSS168       77435      61351403
GSS169       69655      58699293
GSS17        183522     113500748
GSS170       67711      62706526
GSS171       61946      53348157
GSS172       95612      42935517
GSS173       21104      4920928
GSS174       112937     70876701
GSS175       823        560132
GSS176       23226      28867035
GSS177       109043     70652585
GSS178       84533      34668223
GSS179       35815      22222733
GSS18        192358     114306485
GSS180       103304     62490220
GSS181       102329     63761256
GSS182       104268     67656826
GSS183       82099      41276456
GSS184       83102      54651503
GSS185       95673      61335435
GSS186       107323     78547443
GSS187       106375     76684757
GSS188       106058     79947480
GSS189       103996     80016519
GSS19        114078     52104778
GSS190       76374      51039123
GSS191       104572     63292187
GSS192       109868     66415305
GSS193       106205     59313311
GSS194       68379      37446344
GSS195       69573      38736929
GSS196       37145      17774305
GSS197       85481      46023427
GSS198       97119      55907586
GSS199       94982      49597190
GSS2         182294     92190593
GSS20        181789     101771260
GSS200       96286      55922591
GSS201       42132      23615490
GSS202       114638     43642267
GSS203       117085     39368203
GSS204       108676     55514545
GSS205       101471     78372335
GSS206       71604      45899517
GSS207       95891      36542252
GSS208       95417      37268709
GSS209       96671      35161518
GSS21        166208     114173594
GSS210       94285      39167432
GSS211       37736      17626556
GSS212       103939     66277823
GSS213       94551      61190929
GSS214       95128      60357048
GSS215       94773      60868501
GSS216       75675      70017159
GSS217       75117      74330280
GSS218       4473       7127270
GSS219       83736      28233267
GSS22        169506     97609042
GSS220       84219      27346468
GSS221       84926      25909272
GSS222       14851      4422302
GSS223       16547      7508221
GSS224       92377      59458826
GSS225       84657      52502700
GSS226       94076      50770605
GSS227       88581      48350254
GSS228       10980      5983348
GSS229       90648      56882510
GSS23        187251     126687349
GSS230       89662      61882079
GSS231       88553      63641206
GSS232       89283      62505584
GSS233       9890       7129098
GSS234       87995      63795538
GSS235       90217      62488977
GSS236       94639      59914104
GSS237       74309      63030713
GSS238       84243      78883806
GSS239       83030      80583817
GSS24        194057     130219707
GSS240       70509      52677201
GSS241       117650     64297121
GSS242       108874     55446727
GSS243       107533     52125503
GSS244       96658      43251344
GSS245       109801     49060015
GSS246       98194      46325477
GSS247       73059      72225597
GSS248       76682      71142435
GSS249       72980      46435649
GSS25        177481     105207105
GSS250       94787      57200301
GSS251       93517      59081345
GSS252       93900      58510429
GSS253       94714      57307691
GSS254       94280      58019875
GSS255       6737       3337348
GSS26        185918     107808246
GSS27        170600     151419573
GSS28        190494     146229226
GSS29        151147     106441309
GSS3         174946     87827370
GSS30        192446     132128206
GSS31        13634      8776287
GSS32        196044     127318947
GSS33        216659     116231837
GSS34        218573     113602417
GSS35        219720     112025390
GSS36        213958     121897898
GSS37        198560     156434224
GSS38        194984     146797396
GSS39        197244     73372753
GSS4         167155     85101061
GSS40        185067     97681159
GSS41        189782     125958599
GSS42        170343     158770231
GSS43        9057       5889153
GSS44        183999     100320381
GSS45        173032     121667203
GSS46        185089     124655109
GSS47        190835     122398633
GSS48        70733      62564650
GSS49        171799     101963548
GSS5         53445      31617730
GSS50        167647     103037030
GSS51        167798     102616122
GSS52        184194     121477291
GSS53        184774     116632196
GSS54        181686     122485290
GSS55        187531     113994336
GSS56        189392     134519036
GSS57        178947     104938173
GSS58        195715     120562907
GSS59        179925     133347062
GSS6         161617     84471320
GSS60        1898       1718384
GSS61        172844     138948397
GSS62        161635     111553347
GSS63        161673     111572480
GSS64        158827     107592995
GSS65        156768     129062324
GSS66        170185     142553826
GSS67        179844     117096102
GSS68        204911     127968663
GSS69        193332     110756601
GSS7         165322     79361222
GSS70        243921     125965583
GSS71        160206     106329772
GSS72        159350     119782538
GSS73        162663     124539011
GSS74        162629     124600834
GSS75        175106     108957765
GSS76        190310     140120939
GSS77        13117      7645415
GSS78        199135     126616367
GSS79        170370     111603100
GSS8         165782     88979718
GSS80        200718     131518447
GSS81        211575     85835271
GSS82        187842     98659368
GSS83        131802     92017231
GSS84        146986     118083551
GSS85        139587     116995322
GSS86        142817     114062378
GSS87        144008     119847686
GSS88        141842     115691442
GSS89        106718     88926972
GSS9         137999     67157765
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        53710      70400749
HTC11        81792      70394487
HTC12        4015       4516038
HTC13        66993      60073171
HTC14        68556      69499762
HTC15        21887      15013323
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         60867      78012683
HTG1         1318       188771164
HTG10        1298       186340737
HTG100       990        189440077
HTG101       996        189331054
HTG102       985        189419172
HTG103       1161       190585510
HTG104       30         4314892
HTG105       1087       189830459
HTG106       1045       189717260
HTG107       1388       191466263
HTG108       1299       190868648
HTG109       1619       191114596
HTG11        6          837687
HTG110       1360       191966709
HTG111       1299       192094007
HTG112       1304       190416994
HTG113       1077       188177466
HTG114       867        138707568
HTG115       1513       182381556
HTG116       992        192178028
HTG117       930        180556880
HTG118       1076       193695026
HTG119       1103       193020481
HTG12        1451       183826858
HTG120       221        41441967
HTG121       1029       189520679
HTG122       1054       192676832
HTG123       1164       192083957
HTG124       1083       192945775
HTG125       1083       192937725
HTG126       590        104030016
HTG127       1121       192542900
HTG128       1081       192449925
HTG129       1078       192374295
HTG13        875        191579912
HTG130       1167       191952071
HTG131       1556       191876222
HTG132       1069       192186265
HTG133       1069       192216080
HTG134       1129       191783557
HTG135       1425       188848158
HTG136       391        49344806
HTG14        753        192058598
HTG15        745        191952430
HTG16        786        192129268
HTG17        797        191629689
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2470       186037380
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185208586
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2550       188439001
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190634433
HTG47        1176       190820695
HTG48        1128       191224702
HTG49        1046       191244150
HTG5         1283       185453274
HTG50        1030       189619303
HTG51        1042       178756613
HTG52        968        190052338
HTG53        1105       190148899
HTG54        1046       190158403
HTG55        1014       189831932
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1031       189990377
HTG6         1273       185124562
HTG60        1078       187304761
HTG61        1125       188306505
HTG62        988        170992054
HTG63        1085       189487801
HTG64        1064       189415560
HTG65        1169       188798107
HTG66        1179       187545797
HTG67        1282       184397923
HTG68        94         12194080
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187688486
HTG73        1020       170303770
HTG74        1118       188293510
HTG75        1103       190775743
HTG76        1135       190789237
HTG77        1182       190871034
HTG78        1096       185997580
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190063261
HTG81        1213       189874691
HTG82        1120       189645029
HTG83        959        164682536
HTG84        1229       188409093
HTG85        1250       187741728
HTG86        1141       189879061
HTG87        1144       189686641
HTG88        978        167870813
HTG89        1182       189961005
HTG9         1200       186916809
HTG90        1104       190233697
HTG91        1146       190217975
HTG92        1109       190471215
HTG93        962        159420591
HTG94        1056       190751235
HTG95        1160       190986098
HTG96        1031       189156227
HTG97        1071       189524206
HTG98        685        127675409
HTG99        1018       189641315
INV1         94059      48396887
INV10        83429      65436341
INV11        55199      43691852
INV12        84916      66264500
INV13        80903      66875305
INV14        78427      68092549
INV15        45593      41645518
INV16        33901      110026272
INV17        2719       147711644
INV18        47224      107252219
INV19        77671      55928467
INV2         18237      160904994
INV20        72705      61812950
INV21        32070      20923466
INV22        29034      130890642
INV23        6          133712559
INV24        53497      98450726
INV25        74974      49539047
INV26        72749      48614433
INV27        65391      45829720
INV28        72944      49473879
INV29        74216      50351117
INV3         1552       171465895
INV30        71767      51977441
INV31        72979      54328643
INV32        21284      62977950
INV4         18468      127200084
INV5         79321      72297813
INV6         53678      95054331
INV7         45660      80973767
INV8         80584      71781516
INV9         58779      86173585
MAM1         15747      161936438
MAM2         20070      157345397
MAM3         58725      83076406
MAM4         8463       183606104
MAM5         79465      74721673
MAM6         52693      120143430
MAM7         68665      58457634
PAT1         222542     70116699
PAT10        124452     102575971
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224730     34113420
PAT109       250080     15844360
PAT11        98645      64114703
PAT110       180680     63677151
PAT111       51648      26046194
PAT112       114184     110462046
PAT113       137702     83278366
PAT114       164163     99348600
PAT115       158877     103325984
PAT116       137417     114988187
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142065     62828791
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105888     59875034
PAT130       44618      171217879
PAT131       9167       47581637
PAT132       33645      178334734
PAT133       153558     109675196
PAT134       178705     90913377
PAT135       136049     115324159
PAT136       120392     123342367
PAT137       145328     106668228
PAT138       194528     83838395
PAT139       156835     54970078
PAT14        103642     50160321
PAT140       203662     47737230
PAT141       277828     9627968
PAT142       220409     46465135
PAT143       106719     2881142
PAT144       270386     21672571
PAT145       186751     61239638
PAT146       109799     106056597
PAT147       47518      9550821
PAT148       87299      88249520
PAT149       78465      95588128
PAT15        121148     53317075
PAT150       145200     77694852
PAT151       167499     71382671
PAT152       121465     92942668
PAT153       102978     85383928
PAT154       165566     46016231
PAT155       270022     5130418
PAT156       269978     5129582
PAT157       269978     5129582
PAT158       237888     4519872
PAT159       269396     5118524
PAT16        113137     61274458
PAT160       235480     25575098
PAT161       203734     47154417
PAT162       12033      422577
PAT163       165317     74871979
PAT164       91686      126656173
PAT165       172588     71662855
PAT166       137862     72260487
PAT167       9532       13982682
PAT168       93111      87244841
PAT169       91681      79829797
PAT17        39159      16235508
PAT170       83213      91467896
PAT171       109150     53717368
PAT172       153919     65291773
PAT173       86670      129668912
PAT174       159700     78661295
PAT175       210493     49060830
PAT176       80131      35859203
PAT18        146771     52594264
PAT19        153705     78039102
PAT2         194544     84644913
PAT20        104995     118172564
PAT21        133550     95503155
PAT22        84598      79322013
PAT23        123563     103405415
PAT24        119415     105656371
PAT25        145486     86670068
PAT26        175165     64299073
PAT27        71371      1784275
PAT28        102171     77387698
PAT29        93955      87644560
PAT3         171983     95894231
PAT30        119942     61673191
PAT31        96645      78968068
PAT32        128387     55025904
PAT33        92210      51123413
PAT34        111297     78150994
PAT35        138100     29119820
PAT36        158503     24081830
PAT37        114681     49019496
PAT38        44867      54579973
PAT39        95732      83191686
PAT4         153734     106065135
PAT40        100232     70984798
PAT41        136206     39303264
PAT42        143774     35446826
PAT43        123731     64736974
PAT44        104361     81207665
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57197      23951583
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92812      89404206
PAT59        106517     74781811
PAT6         170642     91909261
PAT60        122361     64031080
PAT61        67425      30297598
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154779     88234702
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131215     96912207
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        93689      93464843
PAT84        34072      33980702
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164898     19209900
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129375     101133373
PAT90        175305     3330795
PAT91        101391     1926429
PAT92        169171     12412246
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140780     2674820
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6423       72279200
PLN1         59913      93482634
PLN10        37424      49321009
PLN11        40275      65683198
PLN12        22518      123856245
PLN13        21104      99666209
PLN14        17578      144865462
PLN15        17634      146278605
PLN16        17564      146392665
PLN17        24636      128667828
PLN18        6000       149205408
PLN19        1266       170315035
PLN2         41477      113964598
PLN20        14134      155912680
PLN21        7126       8366082
PLN22        67254      69760931
PLN23        29374      31573524
PLN24        76954      76377631
PLN25        65428      81394374
PLN26        44750      113980886
PLN27        42         85481108
PLN28        12         89108600
PLN29        1105       146780237
PLN3         1363       176476880
PLN30        26200      129369586
PLN31        53185      99023003
PLN32        74549      77756632
PLN33        96651      54014836
PLN34        80347      71710179
PLN35        77877      75898146
PLN36        79950      70552731
PLN37        82203      75710369
PLN38        57216      30693412
PLN39        101389     57277860
PLN4         1811       185565915
PLN40        80587      70203744
PLN41        46009      98091162
PLN42        28081      123989013
PLN43        25458      130491551
PLN44        55121      53297644
PLN45        81599      72165507
PLN46        61371      82117495
PLN47        54137      88921145
PLN48        85369      61781333
PLN49        93954      60202106
PLN5         1872       194225431
PLN50        72884      80658877
PLN51        72437      77353859
PLN52        68808      81075707
PLN53        26862      49877588
PLN6         1707       194445638
PLN7         24409      142342126
PLN8         74826      76023897
PLN9         73071      75871379
PRI1         23016      59646733
PRI10        1272       179275558
PRI11        775        94029396
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193666240
PRI18        1099       194310776
PRI19        1166       193657185
PRI2         18354      149253110
PRI20        1737       191816982
PRI21        2647       189802739
PRI22        17625      163586937
PRI23        3173       11984370
PRI24        31573      84616058
PRI25        61950      78204817
PRI26        31351      70630978
PRI27        8521       161801360
PRI28        2251       180645625
PRI29        1618       181509288
PRI3         1433       175278790
PRI30        2007       181705860
PRI31        1958       180727178
PRI32        13185      156524900
PRI33        1327       183635528
PRI34        41711      106642910
PRI35        22923      33121498
PRI36        32189      63608729
PRI37        20141      117697460
PRI38        18566      147144620
PRI39        66629      86847693
PRI4         1282       185555745
PRI40        49464      89700608
PRI41        40024      73768288
PRI42        47521      93835974
PRI43        67795      83513418
PRI44        4972       35397688
PRI5         1325       184390308
PRI6         1180       179907324
PRI7         1246       180917243
PRI8         1212       178442526
PRI9         1367       174647124
ROD1         32322      140559255
ROD10        987        181493125
ROD11        233        44199423
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1189       190476978
ROD19        16757      152103998
ROD2         915        175347589
ROD20        20349      148361192
ROD21        1132       182075942
ROD22        1079       168189648
ROD23        13589      162647066
ROD24        38849      69271355
ROD25        21814      104561488
ROD26        1508       187599166
ROD27        134649     36929314
ROD28        84568      70051573
ROD29        54095      59941994
ROD3         905        173367450
ROD4         901        173868951
ROD5         922        174254651
ROD6         966        178147126
ROD7         969        179628867
ROD8         979        181288926
ROD9         994        181786834
STS1         85282      36763268
STS10        57907      44420267
STS11        48910      37503235
STS12        57924      43637361
STS13        64284      42850769
STS14        93606      34184225
STS15        104286     26517062
STS16        10116      2741066
STS17        103611     27476228
STS18        86929      34448302
STS19        99733      33367597
STS2         84354      49850025
STS20        54905      20993492
STS3         66846      26362760
STS4         76989      36945836
STS5         8457       4958885
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55716      37767321
SYN1         42894      77043743
SYN2         49369      68197252
SYN3         11060      160003305
SYN4         4598       176515018
SYN5         4597       176510678
SYN6         4600       176564711
SYN7         4935       89358939
TSA1         120472     38235688
TSA10        110716     38093008
TSA11        93519      31664452
TSA12        49774      16702893
TSA13        86486      70566494
TSA14        121991     38853496
TSA15        134870     35826510
TSA16        61036      79698424
TSA17        39468      53516874
TSA18        70282      97466599
TSA19        100897     57123531
TSA2         113532     41666458
TSA20        110668     52338593
TSA21        102984     53513191
TSA22        103695     52518403
TSA23        100966     47107597
TSA24        10786      6455891
TSA25        66573      59369298
TSA26        90250      62317379
TSA27        90395      75445863
TSA28        81291      75040690
TSA29        113045     34907447
TSA3         110396     41019325
TSA30        105614     51695041
TSA31        43017      35545468
TSA32        94911      35699810
TSA33        83189      31995816
TSA34        110188     45124503
TSA35        114753     50951737
TSA36        103616     51971055
TSA37        100113     56421822
TSA38        94610      65146277
TSA39        94206      69996985
TSA4         110949     45737681
TSA40        7055       1920813
TSA41        91162      71943438
TSA42        97632      54700174
TSA43        63268      108247018
TSA44        90001      77844852
TSA45        89354      65966978
TSA46        86091      70560990
TSA47        76126      81240833
TSA48        27636      46693467
TSA49        89053      69490190
TSA5         43179      10927440
TSA50        75197      86012084
TSA51        73336      77189655
TSA52        88447      82170809
TSA53        64240      55971265
TSA54        88125      71940981
TSA55        90060      61508710
TSA56        78421      64921397
TSA57        108348     55434079
TSA58        92473      70373420
TSA59        94134      67718698
TSA6         112457     59449948
TSA60        55678      33925708
TSA7         95611      66253193
TSA8         105744     68773673
TSA9         105928     64845351
UNA1         238        125011
VRL1         67973      69334298
VRL10        61479      73561886
VRL11        25765      35681026
VRL12        62855      71152830
VRL13        57454      72787679
VRL14        63149      65193531
VRL15        57236      73370379
VRL16        57393      72403942
VRL17        57536      70967409
VRL18        58694      70357115
VRL19        61263      73409674
VRL2         73737      64144158
VRL20        10812      12554762
VRL3         69768      60851812
VRL4         68088      70040296
VRL5         48765      50727434
VRL6         48246      77523717
VRL7         47335      73299592
VRL8         62471      72329298
VRL9         69479      65994181
VRT1         40667      125390402
VRT10        1256       189144082
VRT11        8274       177844568
VRT12        3994       136790703
VRT13        13095      170781188
VRT14        5348       182619924
VRT15        3936       185905956
VRT16        37546      134661134
VRT17        79796      68486448
VRT18        78306      66439671
VRT19        30899      24950660
VRT2         3070       191484928
VRT20        70811      78359924
VRT21        47915      119146766
VRT22        77099      61957992
VRT23        76958      60744256
VRT24        80384      56136305
VRT25        44908      32599334
VRT3         70669      80189950
VRT4         8525       169594661
VRT5         31214      25805956
VRT6         73011      66719150
VRT7         31732      63525748
VRT8         30652      111958169
VRT9         1202       189984871

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 188.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

19582406 16002319789   Homo sapiens
9695748   9971977248   Mus musculus
2187673   6510998499   Rattus norvegicus
2200084   5384097980   Bos taurus
3932728   5060067429   Zea mays
3240128   4856506514   Sus scrofa
1712904   3123664987   Danio rerio
228318    1352992214   Strongylocentrotus purpuratus
1347700   1253704507   Oryza sativa Japonica Group
1774046   1197044510   Nicotiana tabacum
1424380   1147262471   Xenopus (Silurana) tropicalis
2322720   1141194178   Arabidopsis thaliana
1228416   1083707483   Drosophila melanogaster
216591    1008241510   Pan troglodytes
766599     998751743   Vitis vinifera
1455382    949215720   Canis lupus familiaris
1902683    906453528   Glycine max
814788     899129094   Gallus gallus
739316     841558162   Solanum lycopersicum
83784      830464032   Macaca mulatta

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 188.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         February 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 188.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
	Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
	WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
	Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center