Release Notes For GenBank Release 188
GBREL.TXT Genetic Sequence Data Bank
February 15 2012
NCBI-GenBank Flat File Release 188.0
Distribution Release Notes
149819246 loci, 137384889783 bases, from 149819246 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 188.0
1.2 Cutoff Date
1.3 Important Changes in Release 188.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 188.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for GenBank's web-based submission tool (BankIt) :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 188.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 188.0, incorporates data available to the collaborating
databases as of February 11, 2012 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 188.0
1.3.1 Organizational changes
The total number of sequence data files increased by 33 with this release:
- the BCT division is now composed of 82 files (+2)
- the CON division is now composed of 166 files (+4)
- the ENV division is now composed of 50 files (+4)
- the EST division is now composed of 455 files (+4)
- the GSS division is now composed of 255 files (+4)
- the HTC division is now composed of 15 files (+1)
- the PAT division is now composed of 176 files (+3)
- the PLN division is now composed of 53 files (+1)
- the TSA division is now composed of 60 files (+9)
- the VRL division is now composed of 20 files (+1)
The total number of 'index' files increased by 4 with this release:
- the AUT (author name) index is now composed of 96 files (+4)
1.3.2 Project DBLINKs transitioning to BioProject
The Genome Project Database resource at the NCBI was redesigned in
recent months, culminating in the implementation of a new BioProject
resource:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/bioproject
An article that describes the goals of BioProject is available:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/books/NBK54015/
BioProject is a collaborative effort of the International Nucleotide
Sequence Database Collaboration (INSDC), and project data are exchanged
with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject
website is also available at DDBJ:
http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml
BioProjects are uniquely identified by BioProject Accession Numbers,
which utilize this format:
"PRJ"
"E" or "N" or "D"
one letter
one or more digits
Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 .
With BioProject now in operation, we are preparing to implement links
from sequence records to the new resource. Previously, links to the
Genome Project Database were provided by numeric 'Project' DBLINKs .
Here's an example for a bacterial complete-genome record:
LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011
DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
sequence.
ACCESSION CP002497
VERSION CP002497.1 GI:356887709
DBLINK Project: 60715
When this link is switched to a BioProject accession, the DBLINK
line will change slightly:
LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011
DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
sequence.
ACCESSION CP002497
VERSION CP002497.1 GI:356887709
DBLINK BioProject: PRJNA60715
In the coming months, many millions of sequence records will gradually
be modified, to make use of the new BioProject DBLINK. They will not be
distributed via daily GenBank and RefSeq incremetal update products.
However, these new BioProject links *will* start to be seen in GenBank
and RefSeq release products as of December 2011. In addition, the new
BioProject links will become visible via NCBI's Entrez:Nucleotide
resource, as soon as the modification process begins.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
info@ncbi.nlm.nih.gov
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 188.0. Consider gbgss153.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
February 15 2012
NCBI-GenBank Flat File Release 188.0
GSS Sequences (Part 1)
87119 loci, 64001690 bases, from 87119 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "153" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New representation for Transcriptome Shotgun Assembly (TSA) records.
The TSA division of GenBank has grown much more quickly than expected.
In order to accommodate the increasing TSA submission volume, GenBank plans
to use a WGS-like approach for TSA projects.
TSA projects will be assigned a four-letter project code, starting with
the letter "G" (for example, GAAA). Individual mRNA sequences within a
project will make use of the 4+2+6 accession number convention, familiar
to users of WGS data (for example, GAAA01000001). Unlike WGS, there is
no concept of "re-assembly" for a TSA project, and so we expect that the
2-digit assembly-version number will always be "01" for TSA mRNAs. Similar
to WGS, a TSA master record will provide a convenient overview of a
TSA project, with an 'all-zeroes' accession number (eg: GAAA00000000) .
TSA projects that make use of this new representation will be provided
in a separate FTP directory at the NCBI FTP site: genbank/tsa . And like
WGS, the various data files for a TSA project will be grouped by the
4-letter project code, and they will be updated independently of the
GenBank release cycle.
Plans aren't yet finalized for the 5.2 million TSA records currently
provided by the divisional gbtsa* files of a GenBank release. Ideally,
all would be converted to the new WGS-like representation, so that all
TSA records in GenBank utilize a common approach. However, the resources
for such a conversion might not be readily available, in which case
older/legacy TSA records might remain as they are now.
Further details about this new approach for handling TSA data will be
made available via these release notes and the GenBank newsgroup, as we
get closer to implementation.
1.4.2 New /pseudogene qualifier; /pseudo will be deprecated
A new controlled-vocabulary /pseudogene qualifier has been under
discussion within the INSDC since the last collaborative INSD meeting
in May 2011. The goal of the new qualifier is to use it for the annotation
of certain well-defined classes of pseudogenes. And at the same time,
to cease using the poorly-defined /pseudo qualifier, which has been
used for a variety of different situations by each INSDC member.
Although a formal definition of /pseudogene is not yet available, we
do have a tentative list of the values for the new qualifier:
"processed" - the pseudogene has arisen by reverse
transcription of a mRNA into cDNA, followed by reintegration into the
genome. Therefore, it has lost any intron/exon structure, and it will
have a pseudo-polyA-tail (if a young pseudogene).
"unprocessed" - the pseudogene has arisen from a copy of
the parent gene by means other than reverse transcription. This covers
usually duplication (transposition [not retrotransposition] and perhaps
recombination) followed by accumulation of random mutation. The changes,
compared to their functional homolog, include insertion, deletions,
premature stop codons, frameshifts and a higher proportion of
non-synonymous versus synonymous substitutions.
"unitary" - the pseudogene has no parent. It is the
original gene, which is functional is some species but disrupted in some
way (indels, mutation, recombination) in another species or strain. In a
lot of cases, such changes would kill the organism, particularly with
house-keeping genes.
"allelic" - a (unitary) pseudogene that is stable in the
population but importantly it has a functional alternative allele also
in the population. i.e., one strain may have the gene, another strain
may have the pseudogene. MHC haplotypes have allelic pseudogenes.
"unknown" - would imply that the submitter does not know
the method of pseudogenisation
If a final definition of /pseudogene can be arrived at within the
next few weeks, then the new qualifier would be legal as of GenBank
Release 190.0 in June of 2012. We will keep users posted about this
new qualifier via the GenBank newsgroup and these release notes.
1.4.3 Extension of position syntax for /anticodon qualifiers
Starting with the April 2012 GenBank Release 189.0, the format
of the /anticodon qualifier will be extended to allow the use
of join() and complement() for the location of a tRNA's anticodon.
Currently, the qualifier supports only a simple continuous
basepair range. For example:
/anticodon=(pos:34..36,aa:Phe)
But there are rare cases of intron-containing tRNAs, for which a
simple X..Y location will not suffice:
tRNA join(<1..5,495..544)
/gene="trnL"
/product="tRNA-Leu"
/note="codon recognized: UUA"
/anticodon=(pos:join(5,495..496),aa:Leu)
To support cases like these, the "pos" field will be allowed to
make use of the join() and complement() location operators.
Anticodons are usually three (sometimes four) bases in length, and
this *remains* true even though the join() operator could theoretically
be (mis)used to assert a much more complex/larger location than that.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1761 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbaut93.idx - Index of the entries according to author name, part 93.
97. gbaut94.idx - Index of the entries according to author name, part 94.
98. gbaut95.idx - Index of the entries according to author name, part 95.
99. gbaut96.idx - Index of the entries according to author name, part 96.
100. gbbct1.seq - Bacterial sequence entries, part 1.
101. gbbct10.seq - Bacterial sequence entries, part 10.
102. gbbct11.seq - Bacterial sequence entries, part 11.
103. gbbct12.seq - Bacterial sequence entries, part 12.
104. gbbct13.seq - Bacterial sequence entries, part 13.
105. gbbct14.seq - Bacterial sequence entries, part 14.
106. gbbct15.seq - Bacterial sequence entries, part 15.
107. gbbct16.seq - Bacterial sequence entries, part 16.
108. gbbct17.seq - Bacterial sequence entries, part 17.
109. gbbct18.seq - Bacterial sequence entries, part 18.
110. gbbct19.seq - Bacterial sequence entries, part 19.
111. gbbct2.seq - Bacterial sequence entries, part 2.
112. gbbct20.seq - Bacterial sequence entries, part 20.
113. gbbct21.seq - Bacterial sequence entries, part 21.
114. gbbct22.seq - Bacterial sequence entries, part 22.
115. gbbct23.seq - Bacterial sequence entries, part 23.
116. gbbct24.seq - Bacterial sequence entries, part 24.
117. gbbct25.seq - Bacterial sequence entries, part 25.
118. gbbct26.seq - Bacterial sequence entries, part 26.
119. gbbct27.seq - Bacterial sequence entries, part 27.
120. gbbct28.seq - Bacterial sequence entries, part 28.
121. gbbct29.seq - Bacterial sequence entries, part 29.
122. gbbct3.seq - Bacterial sequence entries, part 3.
123. gbbct30.seq - Bacterial sequence entries, part 30.
124. gbbct31.seq - Bacterial sequence entries, part 31.
125. gbbct32.seq - Bacterial sequence entries, part 32.
126. gbbct33.seq - Bacterial sequence entries, part 33.
127. gbbct34.seq - Bacterial sequence entries, part 34.
128. gbbct35.seq - Bacterial sequence entries, part 35.
129. gbbct36.seq - Bacterial sequence entries, part 36.
130. gbbct37.seq - Bacterial sequence entries, part 37.
131. gbbct38.seq - Bacterial sequence entries, part 38.
132. gbbct39.seq - Bacterial sequence entries, part 39.
133. gbbct4.seq - Bacterial sequence entries, part 4.
134. gbbct40.seq - Bacterial sequence entries, part 40.
135. gbbct41.seq - Bacterial sequence entries, part 41.
136. gbbct42.seq - Bacterial sequence entries, part 42.
137. gbbct43.seq - Bacterial sequence entries, part 43.
138. gbbct44.seq - Bacterial sequence entries, part 44.
139. gbbct45.seq - Bacterial sequence entries, part 45.
140. gbbct46.seq - Bacterial sequence entries, part 46.
141. gbbct47.seq - Bacterial sequence entries, part 47.
142. gbbct48.seq - Bacterial sequence entries, part 48.
143. gbbct49.seq - Bacterial sequence entries, part 49.
144. gbbct5.seq - Bacterial sequence entries, part 5.
145. gbbct50.seq - Bacterial sequence entries, part 50.
146. gbbct51.seq - Bacterial sequence entries, part 51.
147. gbbct52.seq - Bacterial sequence entries, part 52.
148. gbbct53.seq - Bacterial sequence entries, part 53.
149. gbbct54.seq - Bacterial sequence entries, part 54.
150. gbbct55.seq - Bacterial sequence entries, part 55.
151. gbbct56.seq - Bacterial sequence entries, part 56.
152. gbbct57.seq - Bacterial sequence entries, part 57.
153. gbbct58.seq - Bacterial sequence entries, part 58.
154. gbbct59.seq - Bacterial sequence entries, part 59.
155. gbbct6.seq - Bacterial sequence entries, part 6.
156. gbbct60.seq - Bacterial sequence entries, part 60.
157. gbbct61.seq - Bacterial sequence entries, part 61.
158. gbbct62.seq - Bacterial sequence entries, part 62.
159. gbbct63.seq - Bacterial sequence entries, part 63.
160. gbbct64.seq - Bacterial sequence entries, part 64.
161. gbbct65.seq - Bacterial sequence entries, part 65.
162. gbbct66.seq - Bacterial sequence entries, part 66.
163. gbbct67.seq - Bacterial sequence entries, part 67.
164. gbbct68.seq - Bacterial sequence entries, part 68.
165. gbbct69.seq - Bacterial sequence entries, part 69.
166. gbbct7.seq - Bacterial sequence entries, part 7.
167. gbbct70.seq - Bacterial sequence entries, part 70.
168. gbbct71.seq - Bacterial sequence entries, part 71.
169. gbbct72.seq - Bacterial sequence entries, part 72.
170. gbbct73.seq - Bacterial sequence entries, part 73.
171. gbbct74.seq - Bacterial sequence entries, part 74.
172. gbbct75.seq - Bacterial sequence entries, part 75.
173. gbbct76.seq - Bacterial sequence entries, part 76.
174. gbbct77.seq - Bacterial sequence entries, part 77.
175. gbbct78.seq - Bacterial sequence entries, part 78.
176. gbbct79.seq - Bacterial sequence entries, part 79.
177. gbbct8.seq - Bacterial sequence entries, part 8.
178. gbbct80.seq - Bacterial sequence entries, part 80.
179. gbbct81.seq - Bacterial sequence entries, part 81.
180. gbbct82.seq - Bacterial sequence entries, part 82.
181. gbbct9.seq - Bacterial sequence entries, part 9.
182. gbchg.txt - Accession numbers of entries updated since the previous release.
183. gbcon1.seq - Constructed sequence entries, part 1.
184. gbcon10.seq - Constructed sequence entries, part 10.
185. gbcon100.seq - Constructed sequence entries, part 100.
186. gbcon101.seq - Constructed sequence entries, part 101.
187. gbcon102.seq - Constructed sequence entries, part 102.
188. gbcon103.seq - Constructed sequence entries, part 103.
189. gbcon104.seq - Constructed sequence entries, part 104.
190. gbcon105.seq - Constructed sequence entries, part 105.
191. gbcon106.seq - Constructed sequence entries, part 106.
192. gbcon107.seq - Constructed sequence entries, part 107.
193. gbcon108.seq - Constructed sequence entries, part 108.
194. gbcon109.seq - Constructed sequence entries, part 109.
195. gbcon11.seq - Constructed sequence entries, part 11.
196. gbcon110.seq - Constructed sequence entries, part 110.
197. gbcon111.seq - Constructed sequence entries, part 111.
198. gbcon112.seq - Constructed sequence entries, part 112.
199. gbcon113.seq - Constructed sequence entries, part 113.
200. gbcon114.seq - Constructed sequence entries, part 114.
201. gbcon115.seq - Constructed sequence entries, part 115.
202. gbcon116.seq - Constructed sequence entries, part 116.
203. gbcon117.seq - Constructed sequence entries, part 117.
204. gbcon118.seq - Constructed sequence entries, part 118.
205. gbcon119.seq - Constructed sequence entries, part 119.
206. gbcon12.seq - Constructed sequence entries, part 12.
207. gbcon120.seq - Constructed sequence entries, part 120.
208. gbcon121.seq - Constructed sequence entries, part 121.
209. gbcon122.seq - Constructed sequence entries, part 122.
210. gbcon123.seq - Constructed sequence entries, part 123.
211. gbcon124.seq - Constructed sequence entries, part 124.
212. gbcon125.seq - Constructed sequence entries, part 125.
213. gbcon126.seq - Constructed sequence entries, part 126.
214. gbcon127.seq - Constructed sequence entries, part 127.
215. gbcon128.seq - Constructed sequence entries, part 128.
216. gbcon129.seq - Constructed sequence entries, part 129.
217. gbcon13.seq - Constructed sequence entries, part 13.
218. gbcon130.seq - Constructed sequence entries, part 130.
219. gbcon131.seq - Constructed sequence entries, part 131.
220. gbcon132.seq - Constructed sequence entries, part 132.
221. gbcon133.seq - Constructed sequence entries, part 133.
222. gbcon134.seq - Constructed sequence entries, part 134.
223. gbcon135.seq - Constructed sequence entries, part 135.
224. gbcon136.seq - Constructed sequence entries, part 136.
225. gbcon137.seq - Constructed sequence entries, part 137.
226. gbcon138.seq - Constructed sequence entries, part 138.
227. gbcon139.seq - Constructed sequence entries, part 139.
228. gbcon14.seq - Constructed sequence entries, part 14.
229. gbcon140.seq - Constructed sequence entries, part 140.
230. gbcon141.seq - Constructed sequence entries, part 141.
231. gbcon142.seq - Constructed sequence entries, part 142.
232. gbcon143.seq - Constructed sequence entries, part 143.
233. gbcon144.seq - Constructed sequence entries, part 144.
234. gbcon145.seq - Constructed sequence entries, part 145.
235. gbcon146.seq - Constructed sequence entries, part 146.
236. gbcon147.seq - Constructed sequence entries, part 147.
237. gbcon148.seq - Constructed sequence entries, part 148.
238. gbcon149.seq - Constructed sequence entries, part 149.
239. gbcon15.seq - Constructed sequence entries, part 15.
240. gbcon150.seq - Constructed sequence entries, part 150.
241. gbcon151.seq - Constructed sequence entries, part 151.
242. gbcon152.seq - Constructed sequence entries, part 152.
243. gbcon153.seq - Constructed sequence entries, part 153.
244. gbcon154.seq - Constructed sequence entries, part 154.
245. gbcon155.seq - Constructed sequence entries, part 155.
246. gbcon156.seq - Constructed sequence entries, part 156.
247. gbcon157.seq - Constructed sequence entries, part 157.
248. gbcon158.seq - Constructed sequence entries, part 158.
249. gbcon159.seq - Constructed sequence entries, part 159.
250. gbcon16.seq - Constructed sequence entries, part 16.
251. gbcon160.seq - Constructed sequence entries, part 160.
252. gbcon161.seq - Constructed sequence entries, part 161.
253. gbcon162.seq - Constructed sequence entries, part 162.
254. gbcon163.seq - Constructed sequence entries, part 163.
255. gbcon164.seq - Constructed sequence entries, part 164.
256. gbcon165.seq - Constructed sequence entries, part 165.
257. gbcon166.seq - Constructed sequence entries, part 166.
258. gbcon17.seq - Constructed sequence entries, part 17.
259. gbcon18.seq - Constructed sequence entries, part 18.
260. gbcon19.seq - Constructed sequence entries, part 19.
261. gbcon2.seq - Constructed sequence entries, part 2.
262. gbcon20.seq - Constructed sequence entries, part 20.
263. gbcon21.seq - Constructed sequence entries, part 21.
264. gbcon22.seq - Constructed sequence entries, part 22.
265. gbcon23.seq - Constructed sequence entries, part 23.
266. gbcon24.seq - Constructed sequence entries, part 24.
267. gbcon25.seq - Constructed sequence entries, part 25.
268. gbcon26.seq - Constructed sequence entries, part 26.
269. gbcon27.seq - Constructed sequence entries, part 27.
270. gbcon28.seq - Constructed sequence entries, part 28.
271. gbcon29.seq - Constructed sequence entries, part 29.
272. gbcon3.seq - Constructed sequence entries, part 3.
273. gbcon30.seq - Constructed sequence entries, part 30.
274. gbcon31.seq - Constructed sequence entries, part 31.
275. gbcon32.seq - Constructed sequence entries, part 32.
276. gbcon33.seq - Constructed sequence entries, part 33.
277. gbcon34.seq - Constructed sequence entries, part 34.
278. gbcon35.seq - Constructed sequence entries, part 35.
279. gbcon36.seq - Constructed sequence entries, part 36.
280. gbcon37.seq - Constructed sequence entries, part 37.
281. gbcon38.seq - Constructed sequence entries, part 38.
282. gbcon39.seq - Constructed sequence entries, part 39.
283. gbcon4.seq - Constructed sequence entries, part 4.
284. gbcon40.seq - Constructed sequence entries, part 40.
285. gbcon41.seq - Constructed sequence entries, part 41.
286. gbcon42.seq - Constructed sequence entries, part 42.
287. gbcon43.seq - Constructed sequence entries, part 43.
288. gbcon44.seq - Constructed sequence entries, part 44.
289. gbcon45.seq - Constructed sequence entries, part 45.
290. gbcon46.seq - Constructed sequence entries, part 46.
291. gbcon47.seq - Constructed sequence entries, part 47.
292. gbcon48.seq - Constructed sequence entries, part 48.
293. gbcon49.seq - Constructed sequence entries, part 49.
294. gbcon5.seq - Constructed sequence entries, part 5.
295. gbcon50.seq - Constructed sequence entries, part 50.
296. gbcon51.seq - Constructed sequence entries, part 51.
297. gbcon52.seq - Constructed sequence entries, part 52.
298. gbcon53.seq - Constructed sequence entries, part 53.
299. gbcon54.seq - Constructed sequence entries, part 54.
300. gbcon55.seq - Constructed sequence entries, part 55.
301. gbcon56.seq - Constructed sequence entries, part 56.
302. gbcon57.seq - Constructed sequence entries, part 57.
303. gbcon58.seq - Constructed sequence entries, part 58.
304. gbcon59.seq - Constructed sequence entries, part 59.
305. gbcon6.seq - Constructed sequence entries, part 6.
306. gbcon60.seq - Constructed sequence entries, part 60.
307. gbcon61.seq - Constructed sequence entries, part 61.
308. gbcon62.seq - Constructed sequence entries, part 62.
309. gbcon63.seq - Constructed sequence entries, part 63.
310. gbcon64.seq - Constructed sequence entries, part 64.
311. gbcon65.seq - Constructed sequence entries, part 65.
312. gbcon66.seq - Constructed sequence entries, part 66.
313. gbcon67.seq - Constructed sequence entries, part 67.
314. gbcon68.seq - Constructed sequence entries, part 68.
315. gbcon69.seq - Constructed sequence entries, part 69.
316. gbcon7.seq - Constructed sequence entries, part 7.
317. gbcon70.seq - Constructed sequence entries, part 70.
318. gbcon71.seq - Constructed sequence entries, part 71.
319. gbcon72.seq - Constructed sequence entries, part 72.
320. gbcon73.seq - Constructed sequence entries, part 73.
321. gbcon74.seq - Constructed sequence entries, part 74.
322. gbcon75.seq - Constructed sequence entries, part 75.
323. gbcon76.seq - Constructed sequence entries, part 76.
324. gbcon77.seq - Constructed sequence entries, part 77.
325. gbcon78.seq - Constructed sequence entries, part 78.
326. gbcon79.seq - Constructed sequence entries, part 79.
327. gbcon8.seq - Constructed sequence entries, part 8.
328. gbcon80.seq - Constructed sequence entries, part 80.
329. gbcon81.seq - Constructed sequence entries, part 81.
330. gbcon82.seq - Constructed sequence entries, part 82.
331. gbcon83.seq - Constructed sequence entries, part 83.
332. gbcon84.seq - Constructed sequence entries, part 84.
333. gbcon85.seq - Constructed sequence entries, part 85.
334. gbcon86.seq - Constructed sequence entries, part 86.
335. gbcon87.seq - Constructed sequence entries, part 87.
336. gbcon88.seq - Constructed sequence entries, part 88.
337. gbcon89.seq - Constructed sequence entries, part 89.
338. gbcon9.seq - Constructed sequence entries, part 9.
339. gbcon90.seq - Constructed sequence entries, part 90.
340. gbcon91.seq - Constructed sequence entries, part 91.
341. gbcon92.seq - Constructed sequence entries, part 92.
342. gbcon93.seq - Constructed sequence entries, part 93.
343. gbcon94.seq - Constructed sequence entries, part 94.
344. gbcon95.seq - Constructed sequence entries, part 95.
345. gbcon96.seq - Constructed sequence entries, part 96.
346. gbcon97.seq - Constructed sequence entries, part 97.
347. gbcon98.seq - Constructed sequence entries, part 98.
348. gbcon99.seq - Constructed sequence entries, part 99.
349. gbdel.txt - Accession numbers of entries deleted since the previous release.
350. gbenv1.seq - Environmental sampling sequence entries, part 1.
351. gbenv10.seq - Environmental sampling sequence entries, part 10.
352. gbenv11.seq - Environmental sampling sequence entries, part 11.
353. gbenv12.seq - Environmental sampling sequence entries, part 12.
354. gbenv13.seq - Environmental sampling sequence entries, part 13.
355. gbenv14.seq - Environmental sampling sequence entries, part 14.
356. gbenv15.seq - Environmental sampling sequence entries, part 15.
357. gbenv16.seq - Environmental sampling sequence entries, part 16.
358. gbenv17.seq - Environmental sampling sequence entries, part 17.
359. gbenv18.seq - Environmental sampling sequence entries, part 18.
360. gbenv19.seq - Environmental sampling sequence entries, part 19.
361. gbenv2.seq - Environmental sampling sequence entries, part 2.
362. gbenv20.seq - Environmental sampling sequence entries, part 20.
363. gbenv21.seq - Environmental sampling sequence entries, part 21.
364. gbenv22.seq - Environmental sampling sequence entries, part 22.
365. gbenv23.seq - Environmental sampling sequence entries, part 23.
366. gbenv24.seq - Environmental sampling sequence entries, part 24.
367. gbenv25.seq - Environmental sampling sequence entries, part 25.
368. gbenv26.seq - Environmental sampling sequence entries, part 26.
369. gbenv27.seq - Environmental sampling sequence entries, part 27.
370. gbenv28.seq - Environmental sampling sequence entries, part 28.
371. gbenv29.seq - Environmental sampling sequence entries, part 29.
372. gbenv3.seq - Environmental sampling sequence entries, part 3.
373. gbenv30.seq - Environmental sampling sequence entries, part 30.
374. gbenv31.seq - Environmental sampling sequence entries, part 31.
375. gbenv32.seq - Environmental sampling sequence entries, part 32.
376. gbenv33.seq - Environmental sampling sequence entries, part 33.
377. gbenv34.seq - Environmental sampling sequence entries, part 34.
378. gbenv35.seq - Environmental sampling sequence entries, part 35.
379. gbenv36.seq - Environmental sampling sequence entries, part 36.
380. gbenv37.seq - Environmental sampling sequence entries, part 37.
381. gbenv38.seq - Environmental sampling sequence entries, part 38.
382. gbenv39.seq - Environmental sampling sequence entries, part 39.
383. gbenv4.seq - Environmental sampling sequence entries, part 4.
384. gbenv40.seq - Environmental sampling sequence entries, part 40.
385. gbenv41.seq - Environmental sampling sequence entries, part 41.
386. gbenv42.seq - Environmental sampling sequence entries, part 42.
387. gbenv43.seq - Environmental sampling sequence entries, part 43.
388. gbenv44.seq - Environmental sampling sequence entries, part 44.
389. gbenv45.seq - Environmental sampling sequence entries, part 45.
390. gbenv46.seq - Environmental sampling sequence entries, part 46.
391. gbenv47.seq - Environmental sampling sequence entries, part 47.
392. gbenv48.seq - Environmental sampling sequence entries, part 48.
393. gbenv49.seq - Environmental sampling sequence entries, part 49.
394. gbenv5.seq - Environmental sampling sequence entries, part 5.
395. gbenv50.seq - Environmental sampling sequence entries, part 50.
396. gbenv6.seq - Environmental sampling sequence entries, part 6.
397. gbenv7.seq - Environmental sampling sequence entries, part 7.
398. gbenv8.seq - Environmental sampling sequence entries, part 8.
399. gbenv9.seq - Environmental sampling sequence entries, part 9.
400. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
401. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
402. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
403. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
404. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
405. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
406. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
407. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
408. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
409. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
410. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
411. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
412. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
413. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
414. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
415. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
416. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
417. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
418. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
419. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
420. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
421. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
422. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
423. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
424. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
425. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
426. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
427. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
428. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
429. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
430. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
431. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
432. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
433. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
434. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
435. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
436. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
437. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
438. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
439. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
440. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
441. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
442. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
443. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
444. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
445. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
446. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
447. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
448. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
449. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
450. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
451. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
452. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
453. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
454. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
455. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
456. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
457. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
458. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
459. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
460. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
461. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
462. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
463. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
464. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
465. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
466. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
467. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
468. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
469. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
470. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
471. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
472. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
473. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
474. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
475. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
476. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
477. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
478. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
479. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
480. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
481. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
482. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
483. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
484. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
485. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
486. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
487. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
488. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
489. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
490. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
491. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
492. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
493. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
494. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
495. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
496. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
497. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
498. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
499. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
500. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
501. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
502. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
503. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
504. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
505. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
506. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
507. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
508. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
509. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
510. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
511. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
512. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
513. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
514. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
515. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
516. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
517. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
518. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
519. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
520. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
521. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
522. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
523. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
524. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
525. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
526. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
527. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
528. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
529. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
530. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
531. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
532. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
533. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
534. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
535. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
536. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
537. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
538. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
539. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
540. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
541. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
542. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
543. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
544. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
545. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
546. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
547. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
548. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
549. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
550. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
551. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
552. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
553. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
554. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
555. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
556. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
557. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
558. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
559. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
560. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
561. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
562. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
563. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
564. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
565. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
566. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
567. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
568. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
569. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
570. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
571. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
572. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
573. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
574. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
575. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
576. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
577. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
578. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
579. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
580. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
581. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
582. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
583. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
584. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
585. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
586. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
587. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
588. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
589. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
590. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
591. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
592. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
593. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
594. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
595. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
596. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
597. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
598. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
599. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
600. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
601. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
602. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
603. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
604. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
605. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
606. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
607. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
608. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
609. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
610. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
611. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
612. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
613. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
614. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
615. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
616. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
617. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
618. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
619. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
620. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
621. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
622. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
623. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
624. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
625. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
626. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
627. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
628. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
629. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
630. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
631. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
632. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
633. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
634. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
635. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
636. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
637. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
638. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
639. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
640. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
641. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
642. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
643. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
644. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
645. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
646. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
647. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
648. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
649. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
650. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
651. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
652. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
653. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
654. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
655. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
656. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
657. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
658. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
659. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
660. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
661. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
662. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
663. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
664. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
665. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
666. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
667. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
668. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
669. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
670. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
671. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
672. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
673. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
674. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
675. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
676. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
677. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
678. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
679. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
680. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
681. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
682. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
683. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
684. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
685. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
686. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
687. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
688. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
689. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
690. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
691. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
692. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
693. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
694. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
695. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
696. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
697. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
698. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
699. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
700. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
701. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
702. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
703. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
704. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
705. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
706. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
707. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
708. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
709. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
710. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
711. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
712. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
713. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
714. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
715. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
716. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
717. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
718. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
719. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
720. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
721. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
722. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
723. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
724. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
725. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
726. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
727. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
728. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
729. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
730. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
731. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
732. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
733. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
734. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
735. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
736. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
737. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
738. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
739. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
740. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
741. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
742. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
743. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
744. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
745. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
746. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
747. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
748. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
749. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
750. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
751. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
752. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
753. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
754. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
755. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
756. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
757. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
758. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
759. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
760. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
761. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
762. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
763. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
764. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
765. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
766. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
767. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
768. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
769. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
770. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
771. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
772. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
773. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
774. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
775. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
776. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
777. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
778. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
779. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
780. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
781. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
782. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
783. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
784. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
785. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
786. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
787. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
788. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
789. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
790. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
791. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
792. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
793. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
794. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
795. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
796. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
797. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
798. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
799. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
800. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
801. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
802. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
803. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
804. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
805. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
806. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
807. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
808. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
809. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
810. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
811. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
812. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
813. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
814. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
815. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
816. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
817. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
818. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
819. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
820. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
821. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
822. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
823. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
824. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
825. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
826. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
827. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
828. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
829. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
830. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
831. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
832. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
833. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
834. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
835. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
836. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
837. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
838. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
839. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
840. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
841. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
842. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
843. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
844. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
845. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
846. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
847. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
848. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
849. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
850. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
851. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
852. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
853. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
854. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
855. gbgen.idx - Index of the entries according to gene symbols.
856. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
857. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
858. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
859. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
860. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
861. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
862. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
863. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
864. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
865. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
866. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
867. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
868. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
869. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
870. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
871. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
872. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
873. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
874. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
875. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
876. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
877. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
878. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
879. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
880. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
881. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
882. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
883. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
884. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
885. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
886. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
887. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
888. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
889. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
890. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
891. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
892. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
893. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
894. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
895. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
896. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
897. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
898. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
899. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
900. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
901. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
902. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
903. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
904. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
905. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
906. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
907. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
908. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
909. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
910. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
911. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
912. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
913. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
914. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
915. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
916. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
917. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
918. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
919. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
920. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
921. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
922. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
923. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
924. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
925. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
926. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
927. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
928. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
929. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
930. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
931. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
932. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
933. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
934. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
935. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
936. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
937. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
938. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
939. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
940. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
941. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
942. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
943. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
944. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
945. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
946. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
947. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
948. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
949. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
950. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
951. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
952. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
953. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
954. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
955. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
956. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
957. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
958. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
959. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
960. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
961. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
962. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
963. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
964. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
965. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
966. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
967. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
968. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
969. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
970. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
971. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
972. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
973. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
974. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
975. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
976. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
977. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
978. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
979. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
980. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
981. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
982. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
983. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
984. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
985. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
986. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
987. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
988. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
989. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
990. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
991. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
992. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
993. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
994. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
995. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
996. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
997. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
998. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
999. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1000. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1001. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1002. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1003. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1004. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1005. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1006. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1007. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1008. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1009. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1010. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1011. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1012. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1013. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1014. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1015. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1016. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1017. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1018. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1019. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1020. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1021. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1022. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1023. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1024. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1025. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1026. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1027. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1028. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1029. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1030. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1031. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1032. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1033. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1034. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1035. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1036. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1037. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1038. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1039. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1040. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1041. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1042. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1043. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1044. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1045. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1046. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1047. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1048. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1049. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1050. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1051. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1052. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1053. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1054. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1055. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1056. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1057. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1058. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1059. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1060. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1061. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1062. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1063. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1064. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1065. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1066. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1067. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1068. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1069. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1070. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1071. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1072. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1073. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1074. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1075. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1076. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1077. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1078. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1079. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1080. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1081. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1082. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1083. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1084. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1085. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1086. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1087. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1088. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1089. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1090. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1091. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1092. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1093. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1094. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1095. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1096. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1097. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1098. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1099. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1100. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1101. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1102. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1103. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1104. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1105. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1106. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1107. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1108. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1109. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1110. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1111. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1112. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1113. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1114. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1115. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1116. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1117. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1118. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1119. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1120. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1121. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1122. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1123. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1124. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1125. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1126. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1127. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1128. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1129. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1130. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1131. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1132. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1133. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1134. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1135. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1136. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1137. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1138. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1139. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1140. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1141. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1142. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1143. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1144. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1145. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1146. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1147. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1148. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1149. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1150. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1151. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1152. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1153. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1154. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1155. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1156. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1157. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1158. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1159. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1160. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1161. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1162. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1163. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1164. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1165. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1166. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1167. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1168. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1169. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1170. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1171. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1172. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1173. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1174. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1175. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1176. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1177. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1178. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1179. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1180. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1181. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1182. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1183. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1184. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1185. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1186. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1187. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1188. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1189. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1190. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1191. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1192. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1193. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1194. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1195. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1196. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1197. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1198. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1199. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1200. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1201. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1202. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1203. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1204. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1205. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1206. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1207. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1208. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1209. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1210. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1211. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1212. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1213. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1214. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1215. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1216. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1217. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1218. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1219. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1220. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1221. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1222. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1223. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1224. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1225. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1226. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1227. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1228. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1229. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1230. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1231. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1232. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1233. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1234. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1235. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1236. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1237. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1238. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1239. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1240. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1241. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1242. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1243. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1244. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1245. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1246. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1247. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1248. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1249. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1250. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1251. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1252. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1253. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1254. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1255. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1256. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1257. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1258. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1259. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1260. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1261. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1262. gbinv1.seq - Invertebrate sequence entries, part 1.
1263. gbinv10.seq - Invertebrate sequence entries, part 10.
1264. gbinv11.seq - Invertebrate sequence entries, part 11.
1265. gbinv12.seq - Invertebrate sequence entries, part 12.
1266. gbinv13.seq - Invertebrate sequence entries, part 13.
1267. gbinv14.seq - Invertebrate sequence entries, part 14.
1268. gbinv15.seq - Invertebrate sequence entries, part 15.
1269. gbinv16.seq - Invertebrate sequence entries, part 16.
1270. gbinv17.seq - Invertebrate sequence entries, part 17.
1271. gbinv18.seq - Invertebrate sequence entries, part 18.
1272. gbinv19.seq - Invertebrate sequence entries, part 19.
1273. gbinv2.seq - Invertebrate sequence entries, part 2.
1274. gbinv20.seq - Invertebrate sequence entries, part 20.
1275. gbinv21.seq - Invertebrate sequence entries, part 21.
1276. gbinv22.seq - Invertebrate sequence entries, part 22.
1277. gbinv23.seq - Invertebrate sequence entries, part 23.
1278. gbinv24.seq - Invertebrate sequence entries, part 24.
1279. gbinv25.seq - Invertebrate sequence entries, part 25.
1280. gbinv26.seq - Invertebrate sequence entries, part 26.
1281. gbinv27.seq - Invertebrate sequence entries, part 27.
1282. gbinv28.seq - Invertebrate sequence entries, part 28.
1283. gbinv29.seq - Invertebrate sequence entries, part 29.
1284. gbinv3.seq - Invertebrate sequence entries, part 3.
1285. gbinv30.seq - Invertebrate sequence entries, part 30.
1286. gbinv31.seq - Invertebrate sequence entries, part 31.
1287. gbinv32.seq - Invertebrate sequence entries, part 32.
1288. gbinv4.seq - Invertebrate sequence entries, part 4.
1289. gbinv5.seq - Invertebrate sequence entries, part 5.
1290. gbinv6.seq - Invertebrate sequence entries, part 6.
1291. gbinv7.seq - Invertebrate sequence entries, part 7.
1292. gbinv8.seq - Invertebrate sequence entries, part 8.
1293. gbinv9.seq - Invertebrate sequence entries, part 9.
1294. gbjou1.idx - Index of the entries according to journal citation, part 1.
1295. gbjou10.idx - Index of the entries according to journal citation, part 10.
1296. gbjou11.idx - Index of the entries according to journal citation, part 11.
1297. gbjou12.idx - Index of the entries according to journal citation, part 12.
1298. gbjou13.idx - Index of the entries according to journal citation, part 13.
1299. gbjou2.idx - Index of the entries according to journal citation, part 2.
1300. gbjou3.idx - Index of the entries according to journal citation, part 3.
1301. gbjou4.idx - Index of the entries according to journal citation, part 4.
1302. gbjou5.idx - Index of the entries according to journal citation, part 5.
1303. gbjou6.idx - Index of the entries according to journal citation, part 6.
1304. gbjou7.idx - Index of the entries according to journal citation, part 7.
1305. gbjou8.idx - Index of the entries according to journal citation, part 8.
1306. gbjou9.idx - Index of the entries according to journal citation, part 9.
1307. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1308. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1309. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1310. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1311. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1312. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1313. gbmam1.seq - Other mammalian sequence entries, part 1.
1314. gbmam2.seq - Other mammalian sequence entries, part 2.
1315. gbmam3.seq - Other mammalian sequence entries, part 3.
1316. gbmam4.seq - Other mammalian sequence entries, part 4.
1317. gbmam5.seq - Other mammalian sequence entries, part 5.
1318. gbmam6.seq - Other mammalian sequence entries, part 6.
1319. gbmam7.seq - Other mammalian sequence entries, part 7.
1320. gbnew.txt - Accession numbers of entries new since the previous release.
1321. gbpat1.seq - Patent sequence entries, part 1.
1322. gbpat10.seq - Patent sequence entries, part 10.
1323. gbpat100.seq - Patent sequence entries, part 100.
1324. gbpat101.seq - Patent sequence entries, part 101.
1325. gbpat102.seq - Patent sequence entries, part 102.
1326. gbpat103.seq - Patent sequence entries, part 103.
1327. gbpat104.seq - Patent sequence entries, part 104.
1328. gbpat105.seq - Patent sequence entries, part 105.
1329. gbpat106.seq - Patent sequence entries, part 106.
1330. gbpat107.seq - Patent sequence entries, part 107.
1331. gbpat108.seq - Patent sequence entries, part 108.
1332. gbpat109.seq - Patent sequence entries, part 109.
1333. gbpat11.seq - Patent sequence entries, part 11.
1334. gbpat110.seq - Patent sequence entries, part 110.
1335. gbpat111.seq - Patent sequence entries, part 111.
1336. gbpat112.seq - Patent sequence entries, part 112.
1337. gbpat113.seq - Patent sequence entries, part 113.
1338. gbpat114.seq - Patent sequence entries, part 114.
1339. gbpat115.seq - Patent sequence entries, part 115.
1340. gbpat116.seq - Patent sequence entries, part 116.
1341. gbpat117.seq - Patent sequence entries, part 117.
1342. gbpat118.seq - Patent sequence entries, part 118.
1343. gbpat119.seq - Patent sequence entries, part 119.
1344. gbpat12.seq - Patent sequence entries, part 12.
1345. gbpat120.seq - Patent sequence entries, part 120.
1346. gbpat121.seq - Patent sequence entries, part 121.
1347. gbpat122.seq - Patent sequence entries, part 122.
1348. gbpat123.seq - Patent sequence entries, part 123.
1349. gbpat124.seq - Patent sequence entries, part 124.
1350. gbpat125.seq - Patent sequence entries, part 125.
1351. gbpat126.seq - Patent sequence entries, part 126.
1352. gbpat127.seq - Patent sequence entries, part 127.
1353. gbpat128.seq - Patent sequence entries, part 128.
1354. gbpat129.seq - Patent sequence entries, part 129.
1355. gbpat13.seq - Patent sequence entries, part 13.
1356. gbpat130.seq - Patent sequence entries, part 130.
1357. gbpat131.seq - Patent sequence entries, part 131.
1358. gbpat132.seq - Patent sequence entries, part 132.
1359. gbpat133.seq - Patent sequence entries, part 133.
1360. gbpat134.seq - Patent sequence entries, part 134.
1361. gbpat135.seq - Patent sequence entries, part 135.
1362. gbpat136.seq - Patent sequence entries, part 136.
1363. gbpat137.seq - Patent sequence entries, part 137.
1364. gbpat138.seq - Patent sequence entries, part 138.
1365. gbpat139.seq - Patent sequence entries, part 139.
1366. gbpat14.seq - Patent sequence entries, part 14.
1367. gbpat140.seq - Patent sequence entries, part 140.
1368. gbpat141.seq - Patent sequence entries, part 141.
1369. gbpat142.seq - Patent sequence entries, part 142.
1370. gbpat143.seq - Patent sequence entries, part 143.
1371. gbpat144.seq - Patent sequence entries, part 144.
1372. gbpat145.seq - Patent sequence entries, part 145.
1373. gbpat146.seq - Patent sequence entries, part 146.
1374. gbpat147.seq - Patent sequence entries, part 147.
1375. gbpat148.seq - Patent sequence entries, part 148.
1376. gbpat149.seq - Patent sequence entries, part 149.
1377. gbpat15.seq - Patent sequence entries, part 15.
1378. gbpat150.seq - Patent sequence entries, part 150.
1379. gbpat151.seq - Patent sequence entries, part 151.
1380. gbpat152.seq - Patent sequence entries, part 152.
1381. gbpat153.seq - Patent sequence entries, part 153.
1382. gbpat154.seq - Patent sequence entries, part 154.
1383. gbpat155.seq - Patent sequence entries, part 155.
1384. gbpat156.seq - Patent sequence entries, part 156.
1385. gbpat157.seq - Patent sequence entries, part 157.
1386. gbpat158.seq - Patent sequence entries, part 158.
1387. gbpat159.seq - Patent sequence entries, part 159.
1388. gbpat16.seq - Patent sequence entries, part 16.
1389. gbpat160.seq - Patent sequence entries, part 160.
1390. gbpat161.seq - Patent sequence entries, part 161.
1391. gbpat162.seq - Patent sequence entries, part 162.
1392. gbpat163.seq - Patent sequence entries, part 163.
1393. gbpat164.seq - Patent sequence entries, part 164.
1394. gbpat165.seq - Patent sequence entries, part 165.
1395. gbpat166.seq - Patent sequence entries, part 166.
1396. gbpat167.seq - Patent sequence entries, part 167.
1397. gbpat168.seq - Patent sequence entries, part 168.
1398. gbpat169.seq - Patent sequence entries, part 169.
1399. gbpat17.seq - Patent sequence entries, part 17.
1400. gbpat170.seq - Patent sequence entries, part 170.
1401. gbpat171.seq - Patent sequence entries, part 171.
1402. gbpat172.seq - Patent sequence entries, part 172.
1403. gbpat173.seq - Patent sequence entries, part 173.
1404. gbpat174.seq - Patent sequence entries, part 174.
1405. gbpat175.seq - Patent sequence entries, part 175.
1406. gbpat176.seq - Patent sequence entries, part 176.
1407. gbpat18.seq - Patent sequence entries, part 18.
1408. gbpat19.seq - Patent sequence entries, part 19.
1409. gbpat2.seq - Patent sequence entries, part 2.
1410. gbpat20.seq - Patent sequence entries, part 20.
1411. gbpat21.seq - Patent sequence entries, part 21.
1412. gbpat22.seq - Patent sequence entries, part 22.
1413. gbpat23.seq - Patent sequence entries, part 23.
1414. gbpat24.seq - Patent sequence entries, part 24.
1415. gbpat25.seq - Patent sequence entries, part 25.
1416. gbpat26.seq - Patent sequence entries, part 26.
1417. gbpat27.seq - Patent sequence entries, part 27.
1418. gbpat28.seq - Patent sequence entries, part 28.
1419. gbpat29.seq - Patent sequence entries, part 29.
1420. gbpat3.seq - Patent sequence entries, part 3.
1421. gbpat30.seq - Patent sequence entries, part 30.
1422. gbpat31.seq - Patent sequence entries, part 31.
1423. gbpat32.seq - Patent sequence entries, part 32.
1424. gbpat33.seq - Patent sequence entries, part 33.
1425. gbpat34.seq - Patent sequence entries, part 34.
1426. gbpat35.seq - Patent sequence entries, part 35.
1427. gbpat36.seq - Patent sequence entries, part 36.
1428. gbpat37.seq - Patent sequence entries, part 37.
1429. gbpat38.seq - Patent sequence entries, part 38.
1430. gbpat39.seq - Patent sequence entries, part 39.
1431. gbpat4.seq - Patent sequence entries, part 4.
1432. gbpat40.seq - Patent sequence entries, part 40.
1433. gbpat41.seq - Patent sequence entries, part 41.
1434. gbpat42.seq - Patent sequence entries, part 42.
1435. gbpat43.seq - Patent sequence entries, part 43.
1436. gbpat44.seq - Patent sequence entries, part 44.
1437. gbpat45.seq - Patent sequence entries, part 45.
1438. gbpat46.seq - Patent sequence entries, part 46.
1439. gbpat47.seq - Patent sequence entries, part 47.
1440. gbpat48.seq - Patent sequence entries, part 48.
1441. gbpat49.seq - Patent sequence entries, part 49.
1442. gbpat5.seq - Patent sequence entries, part 5.
1443. gbpat50.seq - Patent sequence entries, part 50.
1444. gbpat51.seq - Patent sequence entries, part 51.
1445. gbpat52.seq - Patent sequence entries, part 52.
1446. gbpat53.seq - Patent sequence entries, part 53.
1447. gbpat54.seq - Patent sequence entries, part 54.
1448. gbpat55.seq - Patent sequence entries, part 55.
1449. gbpat56.seq - Patent sequence entries, part 56.
1450. gbpat57.seq - Patent sequence entries, part 57.
1451. gbpat58.seq - Patent sequence entries, part 58.
1452. gbpat59.seq - Patent sequence entries, part 59.
1453. gbpat6.seq - Patent sequence entries, part 6.
1454. gbpat60.seq - Patent sequence entries, part 60.
1455. gbpat61.seq - Patent sequence entries, part 61.
1456. gbpat62.seq - Patent sequence entries, part 62.
1457. gbpat63.seq - Patent sequence entries, part 63.
1458. gbpat64.seq - Patent sequence entries, part 64.
1459. gbpat65.seq - Patent sequence entries, part 65.
1460. gbpat66.seq - Patent sequence entries, part 66.
1461. gbpat67.seq - Patent sequence entries, part 67.
1462. gbpat68.seq - Patent sequence entries, part 68.
1463. gbpat69.seq - Patent sequence entries, part 69.
1464. gbpat7.seq - Patent sequence entries, part 7.
1465. gbpat70.seq - Patent sequence entries, part 70.
1466. gbpat71.seq - Patent sequence entries, part 71.
1467. gbpat72.seq - Patent sequence entries, part 72.
1468. gbpat73.seq - Patent sequence entries, part 73.
1469. gbpat74.seq - Patent sequence entries, part 74.
1470. gbpat75.seq - Patent sequence entries, part 75.
1471. gbpat76.seq - Patent sequence entries, part 76.
1472. gbpat77.seq - Patent sequence entries, part 77.
1473. gbpat78.seq - Patent sequence entries, part 78.
1474. gbpat79.seq - Patent sequence entries, part 79.
1475. gbpat8.seq - Patent sequence entries, part 8.
1476. gbpat80.seq - Patent sequence entries, part 80.
1477. gbpat81.seq - Patent sequence entries, part 81.
1478. gbpat82.seq - Patent sequence entries, part 82.
1479. gbpat83.seq - Patent sequence entries, part 83.
1480. gbpat84.seq - Patent sequence entries, part 84.
1481. gbpat85.seq - Patent sequence entries, part 85.
1482. gbpat86.seq - Patent sequence entries, part 86.
1483. gbpat87.seq - Patent sequence entries, part 87.
1484. gbpat88.seq - Patent sequence entries, part 88.
1485. gbpat89.seq - Patent sequence entries, part 89.
1486. gbpat9.seq - Patent sequence entries, part 9.
1487. gbpat90.seq - Patent sequence entries, part 90.
1488. gbpat91.seq - Patent sequence entries, part 91.
1489. gbpat92.seq - Patent sequence entries, part 92.
1490. gbpat93.seq - Patent sequence entries, part 93.
1491. gbpat94.seq - Patent sequence entries, part 94.
1492. gbpat95.seq - Patent sequence entries, part 95.
1493. gbpat96.seq - Patent sequence entries, part 96.
1494. gbpat97.seq - Patent sequence entries, part 97.
1495. gbpat98.seq - Patent sequence entries, part 98.
1496. gbpat99.seq - Patent sequence entries, part 99.
1497. gbphg1.seq - Phage sequence entries, part 1.
1498. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1499. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1500. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1501. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1502. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1503. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1504. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1505. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1506. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1507. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1508. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1509. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1510. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1511. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1512. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1513. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1514. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1515. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1516. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1517. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1518. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1519. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1520. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1521. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1522. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1523. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1524. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1525. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1526. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1527. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1528. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1529. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1530. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1531. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1532. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1533. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1534. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1535. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1536. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1537. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1538. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1539. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1540. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1541. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1542. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1543. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1544. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1545. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1546. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1547. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1548. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1549. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1550. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1551. gbpri1.seq - Primate sequence entries, part 1.
1552. gbpri10.seq - Primate sequence entries, part 10.
1553. gbpri11.seq - Primate sequence entries, part 11.
1554. gbpri12.seq - Primate sequence entries, part 12.
1555. gbpri13.seq - Primate sequence entries, part 13.
1556. gbpri14.seq - Primate sequence entries, part 14.
1557. gbpri15.seq - Primate sequence entries, part 15.
1558. gbpri16.seq - Primate sequence entries, part 16.
1559. gbpri17.seq - Primate sequence entries, part 17.
1560. gbpri18.seq - Primate sequence entries, part 18.
1561. gbpri19.seq - Primate sequence entries, part 19.
1562. gbpri2.seq - Primate sequence entries, part 2.
1563. gbpri20.seq - Primate sequence entries, part 20.
1564. gbpri21.seq - Primate sequence entries, part 21.
1565. gbpri22.seq - Primate sequence entries, part 22.
1566. gbpri23.seq - Primate sequence entries, part 23.
1567. gbpri24.seq - Primate sequence entries, part 24.
1568. gbpri25.seq - Primate sequence entries, part 25.
1569. gbpri26.seq - Primate sequence entries, part 26.
1570. gbpri27.seq - Primate sequence entries, part 27.
1571. gbpri28.seq - Primate sequence entries, part 28.
1572. gbpri29.seq - Primate sequence entries, part 29.
1573. gbpri3.seq - Primate sequence entries, part 3.
1574. gbpri30.seq - Primate sequence entries, part 30.
1575. gbpri31.seq - Primate sequence entries, part 31.
1576. gbpri32.seq - Primate sequence entries, part 32.
1577. gbpri33.seq - Primate sequence entries, part 33.
1578. gbpri34.seq - Primate sequence entries, part 34.
1579. gbpri35.seq - Primate sequence entries, part 35.
1580. gbpri36.seq - Primate sequence entries, part 36.
1581. gbpri37.seq - Primate sequence entries, part 37.
1582. gbpri38.seq - Primate sequence entries, part 38.
1583. gbpri39.seq - Primate sequence entries, part 39.
1584. gbpri4.seq - Primate sequence entries, part 4.
1585. gbpri40.seq - Primate sequence entries, part 40.
1586. gbpri41.seq - Primate sequence entries, part 41.
1587. gbpri42.seq - Primate sequence entries, part 42.
1588. gbpri43.seq - Primate sequence entries, part 43.
1589. gbpri44.seq - Primate sequence entries, part 44.
1590. gbpri5.seq - Primate sequence entries, part 5.
1591. gbpri6.seq - Primate sequence entries, part 6.
1592. gbpri7.seq - Primate sequence entries, part 7.
1593. gbpri8.seq - Primate sequence entries, part 8.
1594. gbpri9.seq - Primate sequence entries, part 9.
1595. gbrel.txt - Release notes (this document).
1596. gbrod1.seq - Rodent sequence entries, part 1.
1597. gbrod10.seq - Rodent sequence entries, part 10.
1598. gbrod11.seq - Rodent sequence entries, part 11.
1599. gbrod12.seq - Rodent sequence entries, part 12.
1600. gbrod13.seq - Rodent sequence entries, part 13.
1601. gbrod14.seq - Rodent sequence entries, part 14.
1602. gbrod15.seq - Rodent sequence entries, part 15.
1603. gbrod16.seq - Rodent sequence entries, part 16.
1604. gbrod17.seq - Rodent sequence entries, part 17.
1605. gbrod18.seq - Rodent sequence entries, part 18.
1606. gbrod19.seq - Rodent sequence entries, part 19.
1607. gbrod2.seq - Rodent sequence entries, part 2.
1608. gbrod20.seq - Rodent sequence entries, part 20.
1609. gbrod21.seq - Rodent sequence entries, part 21.
1610. gbrod22.seq - Rodent sequence entries, part 22.
1611. gbrod23.seq - Rodent sequence entries, part 23.
1612. gbrod24.seq - Rodent sequence entries, part 24.
1613. gbrod25.seq - Rodent sequence entries, part 25.
1614. gbrod26.seq - Rodent sequence entries, part 26.
1615. gbrod27.seq - Rodent sequence entries, part 27.
1616. gbrod28.seq - Rodent sequence entries, part 28.
1617. gbrod29.seq - Rodent sequence entries, part 29.
1618. gbrod3.seq - Rodent sequence entries, part 3.
1619. gbrod4.seq - Rodent sequence entries, part 4.
1620. gbrod5.seq - Rodent sequence entries, part 5.
1621. gbrod6.seq - Rodent sequence entries, part 6.
1622. gbrod7.seq - Rodent sequence entries, part 7.
1623. gbrod8.seq - Rodent sequence entries, part 8.
1624. gbrod9.seq - Rodent sequence entries, part 9.
1625. gbsdr1.txt - Short directory of the data bank, part 1.
1626. gbsdr2.txt - Short directory of the data bank, part 2.
1627. gbsdr3.txt - Short directory of the data bank, part 3.
1628. gbsec.idx - Index of the entries according to secondary accession number.
1629. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1630. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1631. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1632. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1633. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1634. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1635. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1636. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1637. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1638. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1639. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1640. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1641. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1642. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1643. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1644. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1645. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1646. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1647. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1648. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1649. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1650. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1651. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1652. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1653. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1654. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1655. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1656. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1657. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1658. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1659. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1660. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1661. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1662. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1663. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1664. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1665. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1666. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1667. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1668. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1669. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1670. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1671. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1672. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1673. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1674. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1675. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1676. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1677. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1678. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1679. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1680. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1681. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1682. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1683. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1684. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1685. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1686. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1687. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1688. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1689. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1690. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1691. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1692. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1693. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1694. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1695. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1696. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1697. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1698. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1699. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1700. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1701. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1702. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1703. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1704. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1705. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1706. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1707. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1708. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1709. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1710. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1711. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1712. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1713. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1714. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1715. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1716. gbuna1.seq - Unannotated sequence entries, part 1.
1717. gbvrl1.seq - Viral sequence entries, part 1.
1718. gbvrl10.seq - Viral sequence entries, part 10.
1719. gbvrl11.seq - Viral sequence entries, part 11.
1720. gbvrl12.seq - Viral sequence entries, part 12.
1721. gbvrl13.seq - Viral sequence entries, part 13.
1722. gbvrl14.seq - Viral sequence entries, part 14.
1723. gbvrl15.seq - Viral sequence entries, part 15.
1724. gbvrl16.seq - Viral sequence entries, part 16.
1725. gbvrl17.seq - Viral sequence entries, part 17.
1726. gbvrl18.seq - Viral sequence entries, part 18.
1727. gbvrl19.seq - Viral sequence entries, part 19.
1728. gbvrl2.seq - Viral sequence entries, part 2.
1729. gbvrl20.seq - Viral sequence entries, part 20.
1730. gbvrl3.seq - Viral sequence entries, part 3.
1731. gbvrl4.seq - Viral sequence entries, part 4.
1732. gbvrl5.seq - Viral sequence entries, part 5.
1733. gbvrl6.seq - Viral sequence entries, part 6.
1734. gbvrl7.seq - Viral sequence entries, part 7.
1735. gbvrl8.seq - Viral sequence entries, part 8.
1736. gbvrl9.seq - Viral sequence entries, part 9.
1737. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1738. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1739. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1740. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1741. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1742. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1743. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1744. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1745. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1746. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1747. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1748. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1749. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1750. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1751. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1752. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1753. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1754. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1755. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1756. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1757. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1758. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1759. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1760. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1761. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 188.0 flatfiles require roughly 539 GB (sequence
files only) or 580 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1950976907 gbacc1.idx
2368021623 gbacc2.idx
845658798 gbacc3.idx
184210033 gbaut1.idx
184216115 gbaut10.idx
184088184 gbaut11.idx
189535057 gbaut12.idx
232683759 gbaut13.idx
190079567 gbaut14.idx
184785382 gbaut15.idx
190252682 gbaut16.idx
223199616 gbaut17.idx
185378896 gbaut18.idx
187376242 gbaut19.idx
243590239 gbaut2.idx
184334002 gbaut20.idx
247456946 gbaut21.idx
225911734 gbaut22.idx
187178044 gbaut23.idx
187993761 gbaut24.idx
198722903 gbaut25.idx
238583777 gbaut26.idx
183793143 gbaut27.idx
184712746 gbaut28.idx
183935066 gbaut29.idx
220158364 gbaut3.idx
243694589 gbaut30.idx
186496287 gbaut31.idx
184017501 gbaut32.idx
185847301 gbaut33.idx
183915277 gbaut34.idx
188239301 gbaut35.idx
183872618 gbaut36.idx
184906088 gbaut37.idx
233551289 gbaut38.idx
183982466 gbaut39.idx
187298463 gbaut4.idx
184052972 gbaut40.idx
185155806 gbaut41.idx
234185545 gbaut42.idx
184005588 gbaut43.idx
183829315 gbaut44.idx
185903122 gbaut45.idx
194708255 gbaut46.idx
185134251 gbaut47.idx
186617193 gbaut48.idx
184232631 gbaut49.idx
236724052 gbaut5.idx
183828392 gbaut50.idx
183938013 gbaut51.idx
186430012 gbaut52.idx
186206141 gbaut53.idx
183885715 gbaut54.idx
190332258 gbaut55.idx
184858708 gbaut56.idx
201447534 gbaut57.idx
185798194 gbaut58.idx
184708419 gbaut59.idx
199582899 gbaut6.idx
184877159 gbaut60.idx
184052894 gbaut61.idx
183899748 gbaut62.idx
196915238 gbaut63.idx
187420308 gbaut64.idx
212490452 gbaut65.idx
187855172 gbaut66.idx
184139887 gbaut67.idx
185491683 gbaut68.idx
184058573 gbaut69.idx
183813298 gbaut7.idx
184348680 gbaut70.idx
184095245 gbaut71.idx
184743943 gbaut72.idx
185492820 gbaut73.idx
184759525 gbaut74.idx
185504248 gbaut75.idx
185213620 gbaut76.idx
219051392 gbaut77.idx
185138172 gbaut78.idx
186842586 gbaut79.idx
183938810 gbaut8.idx
183886506 gbaut80.idx
187008926 gbaut81.idx
184443198 gbaut82.idx
183931927 gbaut83.idx
184109386 gbaut84.idx
231764934 gbaut85.idx
186688729 gbaut86.idx
185521811 gbaut87.idx
186831279 gbaut88.idx
243799160 gbaut89.idx
195192412 gbaut9.idx
183887716 gbaut90.idx
183984878 gbaut91.idx
184122366 gbaut92.idx
183958729 gbaut93.idx
186498579 gbaut94.idx
187886343 gbaut95.idx
156162085 gbaut96.idx
249999738 gbbct1.seq
244870852 gbbct10.seq
244613667 gbbct11.seq
233187001 gbbct12.seq
186245758 gbbct13.seq
243158636 gbbct14.seq
249783326 gbbct15.seq
245551992 gbbct16.seq
248628765 gbbct17.seq
248242091 gbbct18.seq
249281961 gbbct19.seq
246115606 gbbct2.seq
246198630 gbbct20.seq
245693356 gbbct21.seq
217806784 gbbct22.seq
242803771 gbbct23.seq
241840999 gbbct24.seq
248677048 gbbct25.seq
247875345 gbbct26.seq
249387783 gbbct27.seq
244185976 gbbct28.seq
247337077 gbbct29.seq
242707674 gbbct3.seq
249996799 gbbct30.seq
249761453 gbbct31.seq
249790948 gbbct32.seq
242886336 gbbct33.seq
241625458 gbbct34.seq
160068904 gbbct35.seq
243880501 gbbct36.seq
246111304 gbbct37.seq
242766907 gbbct38.seq
239636196 gbbct39.seq
241184574 gbbct4.seq
247210305 gbbct40.seq
246790666 gbbct41.seq
245871228 gbbct42.seq
244913596 gbbct43.seq
248036778 gbbct44.seq
248281432 gbbct45.seq
242733728 gbbct46.seq
151177824 gbbct47.seq
248502088 gbbct48.seq
238214280 gbbct49.seq
213971127 gbbct5.seq
241662812 gbbct50.seq
245556170 gbbct51.seq
246292986 gbbct52.seq
246413031 gbbct53.seq
249772959 gbbct54.seq
247794052 gbbct55.seq
246004771 gbbct56.seq
227746997 gbbct57.seq
246886493 gbbct58.seq
136968377 gbbct59.seq
242138604 gbbct6.seq
245003371 gbbct60.seq
247623991 gbbct61.seq
249891264 gbbct62.seq
98438854 gbbct63.seq
6887564 gbbct64.seq
14095618 gbbct65.seq
23197003 gbbct66.seq
45099055 gbbct67.seq
87779073 gbbct68.seq
170059824 gbbct69.seq
247376572 gbbct7.seq
249997882 gbbct70.seq
249998088 gbbct71.seq
242620278 gbbct72.seq
249756811 gbbct73.seq
244158140 gbbct74.seq
248551747 gbbct75.seq
249948135 gbbct76.seq
249996445 gbbct77.seq
47422777 gbbct78.seq
242175199 gbbct79.seq
247183144 gbbct8.seq
249997878 gbbct80.seq
250000162 gbbct81.seq
164194175 gbbct82.seq
245003435 gbbct9.seq
6622867 gbchg.txt
249999578 gbcon1.seq
249997306 gbcon10.seq
249994223 gbcon100.seq
249995660 gbcon101.seq
249998605 gbcon102.seq
249998936 gbcon103.seq
250000223 gbcon104.seq
156342446 gbcon105.seq
249996812 gbcon106.seq
249993767 gbcon107.seq
249992301 gbcon108.seq
249998322 gbcon109.seq
248094953 gbcon11.seq
71615782 gbcon110.seq
212826019 gbcon111.seq
250000256 gbcon112.seq
250000098 gbcon113.seq
249995503 gbcon114.seq
249706231 gbcon115.seq
149768319 gbcon116.seq
249914315 gbcon117.seq
249999874 gbcon118.seq
179997601 gbcon119.seq
249733466 gbcon12.seq
249997285 gbcon120.seq
250000198 gbcon121.seq
249998745 gbcon122.seq
222474383 gbcon123.seq
249821752 gbcon124.seq
249878542 gbcon125.seq
249555609 gbcon126.seq
249997994 gbcon127.seq
249995228 gbcon128.seq
249998722 gbcon129.seq
249085631 gbcon13.seq
41196963 gbcon130.seq
249978699 gbcon131.seq
249998490 gbcon132.seq
249993348 gbcon133.seq
249999880 gbcon134.seq
249912502 gbcon135.seq
249948624 gbcon136.seq
249955490 gbcon137.seq
233498172 gbcon138.seq
246632492 gbcon139.seq
249998859 gbcon14.seq
247088480 gbcon140.seq
249512645 gbcon141.seq
249979698 gbcon142.seq
108787117 gbcon143.seq
249997972 gbcon144.seq
249893238 gbcon145.seq
249995663 gbcon146.seq
249972969 gbcon147.seq
249998239 gbcon148.seq
249364151 gbcon149.seq
54269872 gbcon15.seq
249955451 gbcon150.seq
249999255 gbcon151.seq
199658498 gbcon152.seq
249961712 gbcon153.seq
249998214 gbcon154.seq
250000106 gbcon155.seq
249992598 gbcon156.seq
249999859 gbcon157.seq
108527534 gbcon158.seq
250000007 gbcon159.seq
245778394 gbcon16.seq
249982154 gbcon160.seq
249997011 gbcon161.seq
249997819 gbcon162.seq
250000028 gbcon163.seq
249748567 gbcon164.seq
221299033 gbcon165.seq
18856261 gbcon166.seq
249999263 gbcon17.seq
249996854 gbcon18.seq
44927450 gbcon19.seq
249928196 gbcon2.seq
249999960 gbcon20.seq
249360254 gbcon21.seq
116173132 gbcon22.seq
249999937 gbcon23.seq
120041874 gbcon24.seq
249996870 gbcon25.seq
249725357 gbcon26.seq
249997572 gbcon27.seq
249998238 gbcon28.seq
186471574 gbcon29.seq
248161967 gbcon3.seq
249999756 gbcon30.seq
249997224 gbcon31.seq
249999813 gbcon32.seq
249999952 gbcon33.seq
247997550 gbcon34.seq
232565226 gbcon35.seq
249999237 gbcon36.seq
249996869 gbcon37.seq
249995921 gbcon38.seq
249996351 gbcon39.seq
248979371 gbcon4.seq
249999450 gbcon40.seq
249997210 gbcon41.seq
61183731 gbcon42.seq
249997486 gbcon43.seq
249994070 gbcon44.seq
249999391 gbcon45.seq
249997743 gbcon46.seq
249994859 gbcon47.seq
43089049 gbcon48.seq
249993995 gbcon49.seq
249999843 gbcon5.seq
249996310 gbcon50.seq
249994442 gbcon51.seq
249997248 gbcon52.seq
250000078 gbcon53.seq
36404971 gbcon54.seq
249993185 gbcon55.seq
249998119 gbcon56.seq
249995170 gbcon57.seq
249998154 gbcon58.seq
249998078 gbcon59.seq
249993449 gbcon6.seq
152679523 gbcon60.seq
249999955 gbcon61.seq
249999066 gbcon62.seq
249997558 gbcon63.seq
249998625 gbcon64.seq
183609322 gbcon65.seq
249999870 gbcon66.seq
249997967 gbcon67.seq
249997138 gbcon68.seq
249995207 gbcon69.seq
231272949 gbcon7.seq
245488804 gbcon70.seq
250000182 gbcon71.seq
249998695 gbcon72.seq
249998372 gbcon73.seq
249996966 gbcon74.seq
250000007 gbcon75.seq
96627683 gbcon76.seq
249993448 gbcon77.seq
249995119 gbcon78.seq
249997383 gbcon79.seq
249997708 gbcon8.seq
249995948 gbcon80.seq
249999042 gbcon81.seq
62682749 gbcon82.seq
249997771 gbcon83.seq
249996653 gbcon84.seq
249999445 gbcon85.seq
249999590 gbcon86.seq
249998149 gbcon87.seq
21674116 gbcon88.seq
249998140 gbcon89.seq
249996514 gbcon9.seq
249997503 gbcon90.seq
249996940 gbcon91.seq
249995720 gbcon92.seq
197881888 gbcon93.seq
249993974 gbcon94.seq
249996060 gbcon95.seq
249999726 gbcon96.seq
249998645 gbcon97.seq
249996901 gbcon98.seq
133265984 gbcon99.seq
4034546 gbdel.txt
249999118 gbenv1.seq
249999153 gbenv10.seq
55961183 gbenv11.seq
250000069 gbenv12.seq
249999865 gbenv13.seq
249999771 gbenv14.seq
249999357 gbenv15.seq
249998400 gbenv16.seq
249999454 gbenv17.seq
249997032 gbenv18.seq
196052655 gbenv19.seq
249998965 gbenv2.seq
249997542 gbenv20.seq
250000034 gbenv21.seq
249999241 gbenv22.seq
249998697 gbenv23.seq
156256134 gbenv24.seq
249999659 gbenv25.seq
249920954 gbenv26.seq
250000052 gbenv27.seq
249998935 gbenv28.seq
249999437 gbenv29.seq
249998470 gbenv3.seq
115347282 gbenv30.seq
249998069 gbenv31.seq
249999183 gbenv32.seq
249999820 gbenv33.seq
249997235 gbenv34.seq
135449070 gbenv35.seq
249997870 gbenv36.seq
250000083 gbenv37.seq
249999709 gbenv38.seq
249998076 gbenv39.seq
249999480 gbenv4.seq
249999891 gbenv40.seq
224801920 gbenv41.seq
249998740 gbenv42.seq
249998816 gbenv43.seq
249999011 gbenv44.seq
249998535 gbenv45.seq
249999440 gbenv46.seq
249999872 gbenv47.seq
249997574 gbenv48.seq
249999683 gbenv49.seq
249998178 gbenv5.seq
140992399 gbenv50.seq
230960980 gbenv6.seq
249998471 gbenv7.seq
249998516 gbenv8.seq
249997978 gbenv9.seq
524292008 gbest1.seq
524289074 gbest10.seq
524289941 gbest100.seq
524291337 gbest101.seq
524289859 gbest102.seq
524290377 gbest103.seq
356067172 gbest104.seq
524290444 gbest105.seq
524289882 gbest106.seq
498295264 gbest107.seq
388468596 gbest108.seq
387567407 gbest109.seq
524290873 gbest11.seq
383140776 gbest110.seq
384246085 gbest111.seq
384330199 gbest112.seq
381683980 gbest113.seq
391864302 gbest114.seq
387826689 gbest115.seq
386125537 gbest116.seq
384279666 gbest117.seq
411713195 gbest118.seq
524290061 gbest119.seq
524291034 gbest12.seq
524289592 gbest120.seq
524290024 gbest121.seq
524288922 gbest122.seq
524290082 gbest123.seq
463054937 gbest124.seq
524291624 gbest125.seq
524292219 gbest126.seq
524289117 gbest127.seq
524290681 gbest128.seq
524289762 gbest129.seq
156627343 gbest13.seq
524292389 gbest130.seq
524288898 gbest131.seq
524289254 gbest132.seq
524291522 gbest133.seq
524288794 gbest134.seq
524290255 gbest135.seq
524289041 gbest136.seq
274581986 gbest137.seq
524290088 gbest138.seq
524291115 gbest139.seq
524288870 gbest14.seq
524290183 gbest140.seq
524290265 gbest141.seq
524289886 gbest142.seq
524289918 gbest143.seq
524289020 gbest144.seq
524290315 gbest145.seq
524291739 gbest146.seq
524292448 gbest147.seq
524289334 gbest148.seq
524290755 gbest149.seq
524290155 gbest15.seq
524290538 gbest150.seq
477311655 gbest151.seq
524291695 gbest152.seq
524289611 gbest153.seq
524291256 gbest154.seq
524289499 gbest155.seq
524289934 gbest156.seq
524289994 gbest157.seq
524289319 gbest158.seq
524289646 gbest159.seq
524289567 gbest16.seq
502954761 gbest160.seq
524290120 gbest161.seq
524290259 gbest162.seq
524290033 gbest163.seq
248979924 gbest164.seq
524290805 gbest165.seq
524291535 gbest166.seq
524294643 gbest167.seq
524290660 gbest168.seq
524290433 gbest169.seq
524290523 gbest17.seq
524291496 gbest170.seq
524290035 gbest171.seq
524291686 gbest172.seq
524289937 gbest173.seq
524290596 gbest174.seq
524289347 gbest175.seq
524292575 gbest176.seq
524291503 gbest177.seq
101315195 gbest178.seq
524289180 gbest179.seq
524289904 gbest18.seq
524289136 gbest180.seq
524289221 gbest181.seq
524290490 gbest182.seq
524291768 gbest183.seq
524290757 gbest184.seq
524290005 gbest185.seq
524291613 gbest186.seq
524289871 gbest187.seq
524291202 gbest188.seq
524293876 gbest189.seq
524290621 gbest19.seq
524289378 gbest190.seq
456852241 gbest191.seq
524288790 gbest192.seq
524288740 gbest193.seq
524290202 gbest194.seq
524292433 gbest195.seq
524291192 gbest196.seq
524289575 gbest197.seq
524290098 gbest198.seq
524289056 gbest199.seq
524289694 gbest2.seq
524289338 gbest20.seq
524289063 gbest200.seq
524290267 gbest201.seq
524291391 gbest202.seq
524290994 gbest203.seq
524290950 gbest204.seq
97015180 gbest205.seq
524290970 gbest206.seq
524291353 gbest207.seq
524290055 gbest208.seq
524290657 gbest209.seq
524288998 gbest21.seq
524291159 gbest210.seq
524288960 gbest211.seq
524290750 gbest212.seq
524290565 gbest213.seq
524290809 gbest214.seq
524289414 gbest215.seq
428833873 gbest216.seq
524288875 gbest217.seq
524290677 gbest218.seq
524289103 gbest219.seq
511927020 gbest22.seq
524289805 gbest220.seq
524290688 gbest221.seq
524290169 gbest222.seq
524291121 gbest223.seq
524289106 gbest224.seq
524289987 gbest225.seq
524288926 gbest226.seq
524290948 gbest227.seq
524290095 gbest228.seq
524292137 gbest229.seq
500387580 gbest23.seq
374644285 gbest230.seq
524291249 gbest231.seq
524292507 gbest232.seq
524293318 gbest233.seq
524292243 gbest234.seq
524288842 gbest235.seq
524290986 gbest236.seq
524288998 gbest237.seq
524290397 gbest238.seq
524289838 gbest239.seq
509311549 gbest24.seq
524289477 gbest240.seq
524292577 gbest241.seq
524291209 gbest242.seq
524292667 gbest243.seq
524288804 gbest244.seq
49980486 gbest245.seq
524290629 gbest246.seq
524290592 gbest247.seq
524291874 gbest248.seq
524290456 gbest249.seq
319437162 gbest25.seq
524289872 gbest250.seq
524290091 gbest251.seq
524289218 gbest252.seq
524290223 gbest253.seq
524289785 gbest254.seq
524290516 gbest255.seq
524291373 gbest256.seq
239729287 gbest257.seq
524289955 gbest258.seq
524289945 gbest259.seq
524290900 gbest26.seq
524289588 gbest260.seq
524289852 gbest261.seq
524290264 gbest262.seq
524292224 gbest263.seq
524289171 gbest264.seq
524289794 gbest265.seq
524291070 gbest266.seq
524292248 gbest267.seq
287769686 gbest268.seq
524290474 gbest269.seq
524289014 gbest27.seq
524289236 gbest270.seq
524289480 gbest271.seq
524290409 gbest272.seq
524288778 gbest273.seq
524289165 gbest274.seq
524288801 gbest275.seq
524291013 gbest276.seq
524291788 gbest277.seq
524290141 gbest278.seq
524289847 gbest279.seq
524289431 gbest28.seq
294998876 gbest280.seq
524292740 gbest281.seq
524291647 gbest282.seq
524289321 gbest283.seq
524289192 gbest284.seq
524288821 gbest285.seq
524292076 gbest286.seq
524290725 gbest287.seq
524288822 gbest288.seq
524288784 gbest289.seq
524291872 gbest29.seq
524290143 gbest290.seq
524290467 gbest291.seq
230581210 gbest292.seq
524291554 gbest293.seq
524289109 gbest294.seq
524289799 gbest295.seq
524290690 gbest296.seq
524291630 gbest297.seq
524288972 gbest298.seq
524289697 gbest299.seq
497701912 gbest3.seq
524292549 gbest30.seq
524290233 gbest300.seq
479524832 gbest301.seq
485129560 gbest302.seq
486633612 gbest303.seq
314725057 gbest304.seq
524291639 gbest305.seq
524289239 gbest306.seq
524290860 gbest307.seq
524290383 gbest308.seq
524289192 gbest309.seq
524288756 gbest31.seq
524290466 gbest310.seq
524290184 gbest311.seq
524289430 gbest312.seq
524291713 gbest313.seq
524289829 gbest314.seq
524289317 gbest315.seq
524290529 gbest316.seq
512074338 gbest317.seq
524291101 gbest318.seq
524288782 gbest319.seq
524289945 gbest32.seq
524291357 gbest320.seq
524291798 gbest321.seq
524291027 gbest322.seq
524290585 gbest323.seq
524289278 gbest324.seq
524290829 gbest325.seq
524290817 gbest326.seq
524291128 gbest327.seq
524290194 gbest328.seq
524291250 gbest329.seq
524290428 gbest33.seq
524292590 gbest330.seq
263975353 gbest331.seq
524290768 gbest332.seq
524291223 gbest333.seq
524289919 gbest334.seq
524292957 gbest335.seq
524291092 gbest336.seq
524289977 gbest337.seq
524288844 gbest338.seq
524291963 gbest339.seq
519456801 gbest34.seq
524289432 gbest340.seq
524290534 gbest341.seq
524290105 gbest342.seq
524290240 gbest343.seq
524290696 gbest344.seq
341259917 gbest345.seq
524289552 gbest346.seq
524289259 gbest347.seq
524291284 gbest348.seq
524291261 gbest349.seq
492728679 gbest35.seq
524290851 gbest350.seq
524290786 gbest351.seq
524293094 gbest352.seq
524289611 gbest353.seq
524289707 gbest354.seq
524289103 gbest355.seq
524290155 gbest356.seq
524292000 gbest357.seq
524292192 gbest358.seq
507279497 gbest359.seq
494454216 gbest36.seq
524290736 gbest360.seq
524288985 gbest361.seq
524289055 gbest362.seq
524291175 gbest363.seq
524290982 gbest364.seq
524289634 gbest365.seq
524291250 gbest366.seq
524288817 gbest367.seq
524289632 gbest368.seq
524290906 gbest369.seq
493339530 gbest37.seq
457135229 gbest370.seq
524289984 gbest371.seq
524290313 gbest372.seq
524291793 gbest373.seq
524291234 gbest374.seq
524290339 gbest375.seq
524289554 gbest376.seq
509910119 gbest377.seq
524290954 gbest378.seq
524289802 gbest379.seq
487999109 gbest38.seq
524289143 gbest380.seq
524289832 gbest381.seq
280060364 gbest382.seq
524290498 gbest383.seq
524289336 gbest384.seq
524290362 gbest385.seq
524290862 gbest386.seq
524288990 gbest387.seq
524289729 gbest388.seq
524291304 gbest389.seq
493269666 gbest39.seq
524290361 gbest390.seq
524290188 gbest391.seq
524290853 gbest392.seq
524290257 gbest393.seq
356933081 gbest394.seq
524290936 gbest395.seq
524289274 gbest396.seq
524289485 gbest397.seq
524289862 gbest398.seq
524290453 gbest399.seq
524288944 gbest4.seq
111902842 gbest40.seq
524289806 gbest400.seq
524291302 gbest401.seq
524290535 gbest402.seq
524289855 gbest403.seq
524290485 gbest404.seq
524290547 gbest405.seq
524290563 gbest406.seq
428545235 gbest407.seq
524291933 gbest408.seq
524290947 gbest409.seq
524292786 gbest41.seq
524289871 gbest410.seq
524291312 gbest411.seq
524289152 gbest412.seq
524289711 gbest413.seq
524291828 gbest414.seq
524289016 gbest415.seq
524291948 gbest416.seq
524288781 gbest417.seq
524291072 gbest418.seq
524290074 gbest419.seq
524289049 gbest42.seq
524291816 gbest420.seq
524291315 gbest421.seq
24850705 gbest422.seq
524290525 gbest423.seq
524289194 gbest424.seq
524292359 gbest425.seq
524290703 gbest426.seq
524290271 gbest427.seq
524292953 gbest428.seq
524290192 gbest429.seq
524289876 gbest43.seq
524291469 gbest430.seq
524289402 gbest431.seq
524289929 gbest432.seq
524292268 gbest433.seq
524290426 gbest434.seq
514877618 gbest435.seq
524292089 gbest436.seq
524291066 gbest437.seq
524290666 gbest438.seq
524292420 gbest439.seq
524290680 gbest44.seq
524289887 gbest440.seq
524289156 gbest441.seq
524291160 gbest442.seq
524291222 gbest443.seq
524289359 gbest444.seq
524291140 gbest445.seq
524290746 gbest446.seq
309086173 gbest447.seq
524289225 gbest448.seq
524291157 gbest449.seq
524290824 gbest45.seq
524291614 gbest450.seq
524292492 gbest451.seq
524289389 gbest452.seq
524291537 gbest453.seq
524291136 gbest454.seq
180069222 gbest455.seq
524290407 gbest46.seq
524290423 gbest47.seq
524290276 gbest48.seq
524289439 gbest49.seq
524289625 gbest5.seq
524290590 gbest50.seq
524291356 gbest51.seq
524289225 gbest52.seq
524288899 gbest53.seq
272574733 gbest54.seq
524290709 gbest55.seq
524288752 gbest56.seq
524290193 gbest57.seq
524290427 gbest58.seq
524290141 gbest59.seq
524288762 gbest6.seq
524292004 gbest60.seq
524291197 gbest61.seq
524290276 gbest62.seq
524290080 gbest63.seq
524292904 gbest64.seq
524289035 gbest65.seq
524292721 gbest66.seq
464668608 gbest67.seq
524290678 gbest68.seq
524288774 gbest69.seq
524291145 gbest7.seq
524290941 gbest70.seq
524289318 gbest71.seq
524289634 gbest72.seq
524289100 gbest73.seq
524289764 gbest74.seq
524291984 gbest75.seq
524290526 gbest76.seq
524290605 gbest77.seq
524288813 gbest78.seq
524290658 gbest79.seq
524289737 gbest8.seq
203820323 gbest80.seq
524289461 gbest81.seq
524290721 gbest82.seq
524290860 gbest83.seq
524289624 gbest84.seq
524291467 gbest85.seq
524291710 gbest86.seq
524291688 gbest87.seq
524291317 gbest88.seq
524291256 gbest89.seq
524292211 gbest9.seq
524290796 gbest90.seq
524289921 gbest91.seq
448858073 gbest92.seq
524291246 gbest93.seq
524291357 gbest94.seq
524291406 gbest95.seq
524292756 gbest96.seq
524290446 gbest97.seq
524291978 gbest98.seq
524288877 gbest99.seq
181594679 gbgen.idx
524290352 gbgss1.seq
524292173 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524290642 gbgss103.seq
418354153 gbgss104.seq
524290801 gbgss105.seq
524290070 gbgss106.seq
524290718 gbgss107.seq
524288882 gbgss108.seq
524289975 gbgss109.seq
524291375 gbgss11.seq
524291421 gbgss110.seq
524290148 gbgss111.seq
524289356 gbgss112.seq
524290277 gbgss113.seq
524291060 gbgss114.seq
524289445 gbgss115.seq
55567015 gbgss116.seq
524289697 gbgss117.seq
524288912 gbgss118.seq
524289314 gbgss119.seq
524290109 gbgss12.seq
524288887 gbgss120.seq
524290753 gbgss121.seq
524289754 gbgss122.seq
524291612 gbgss123.seq
524290534 gbgss124.seq
524289380 gbgss125.seq
524290623 gbgss126.seq
524290024 gbgss127.seq
524289234 gbgss128.seq
211213109 gbgss129.seq
524289051 gbgss13.seq
524289179 gbgss130.seq
524289525 gbgss131.seq
524289495 gbgss132.seq
524291043 gbgss133.seq
524288845 gbgss134.seq
524291036 gbgss135.seq
524292513 gbgss136.seq
524288848 gbgss137.seq
524289218 gbgss138.seq
515991190 gbgss139.seq
524289106 gbgss14.seq
516016648 gbgss140.seq
112195886 gbgss141.seq
524289708 gbgss142.seq
524291315 gbgss143.seq
524290702 gbgss144.seq
524290251 gbgss145.seq
524290273 gbgss146.seq
524288750 gbgss147.seq
524290580 gbgss148.seq
524290056 gbgss149.seq
524289040 gbgss15.seq
524290016 gbgss150.seq
524290246 gbgss151.seq
173867414 gbgss152.seq
249999115 gbgss153.seq
249999188 gbgss154.seq
249998375 gbgss155.seq
249999676 gbgss156.seq
28632839 gbgss157.seq
249997137 gbgss158.seq
250000033 gbgss159.seq
524290486 gbgss16.seq
249998542 gbgss160.seq
249998333 gbgss161.seq
224919493 gbgss162.seq
249998415 gbgss163.seq
249998761 gbgss164.seq
249998880 gbgss165.seq
249997707 gbgss166.seq
189046598 gbgss167.seq
249999433 gbgss168.seq
249998390 gbgss169.seq
524288946 gbgss17.seq
249999267 gbgss170.seq
249997904 gbgss171.seq
249997062 gbgss172.seq
76835987 gbgss173.seq
249998100 gbgss174.seq
2079852 gbgss175.seq
79542394 gbgss176.seq
249999009 gbgss177.seq
250000259 gbgss178.seq
87380505 gbgss179.seq
524291200 gbgss18.seq
249999685 gbgss180.seq
249998355 gbgss181.seq
249998984 gbgss182.seq
202719103 gbgss183.seq
249999232 gbgss184.seq
249999013 gbgss185.seq
249998851 gbgss186.seq
246250899 gbgss187.seq
249999268 gbgss188.seq
249997406 gbgss189.seq
314849258 gbgss19.seq
249999279 gbgss190.seq
243520281 gbgss191.seq
249999336 gbgss192.seq
249997150 gbgss193.seq
249998209 gbgss194.seq
249998771 gbgss195.seq
122182588 gbgss196.seq
249998013 gbgss197.seq
250000031 gbgss198.seq
249999974 gbgss199.seq
524289034 gbgss2.seq
524288952 gbgss20.seq
249998152 gbgss200.seq
94058788 gbgss201.seq
249998892 gbgss202.seq
249999850 gbgss203.seq
249998239 gbgss204.seq
249999582 gbgss205.seq
180308144 gbgss206.seq
249999236 gbgss207.seq
249997993 gbgss208.seq
249998006 gbgss209.seq
524289034 gbgss21.seq
249999353 gbgss210.seq
95926739 gbgss211.seq
249999461 gbgss212.seq
249999350 gbgss213.seq
249998406 gbgss214.seq
249998619 gbgss215.seq
249999398 gbgss216.seq
249999995 gbgss217.seq
17245248 gbgss218.seq
249999424 gbgss219.seq
524291398 gbgss22.seq
249999963 gbgss220.seq
249997369 gbgss221.seq
43648880 gbgss222.seq
52862187 gbgss223.seq
249999126 gbgss224.seq
249999236 gbgss225.seq
249997873 gbgss226.seq
249998364 gbgss227.seq
30976250 gbgss228.seq
249997670 gbgss229.seq
524290800 gbgss23.seq
249997588 gbgss230.seq
249999018 gbgss231.seq
250000000 gbgss232.seq
28042636 gbgss233.seq
249997661 gbgss234.seq
249998578 gbgss235.seq
249998526 gbgss236.seq
249998842 gbgss237.seq
249999591 gbgss238.seq
249998244 gbgss239.seq
524291392 gbgss24.seq
178918094 gbgss240.seq
249999812 gbgss241.seq
249998926 gbgss242.seq
249999095 gbgss243.seq
220154622 gbgss244.seq
250000034 gbgss245.seq
249997956 gbgss246.seq
250000074 gbgss247.seq
249998729 gbgss248.seq
195288113 gbgss249.seq
524290581 gbgss25.seq
249999561 gbgss250.seq
249998751 gbgss251.seq
249999600 gbgss252.seq
249999029 gbgss253.seq
250000096 gbgss254.seq
16614102 gbgss255.seq
524290713 gbgss26.seq
524289900 gbgss27.seq
524288854 gbgss28.seq
524289528 gbgss29.seq
524289102 gbgss3.seq
524289655 gbgss30.seq
38849864 gbgss31.seq
524289075 gbgss32.seq
524290723 gbgss33.seq
524288828 gbgss34.seq
524289728 gbgss35.seq
524289696 gbgss36.seq
524289533 gbgss37.seq
524290149 gbgss38.seq
509095937 gbgss39.seq
524290615 gbgss4.seq
524291541 gbgss40.seq
524289016 gbgss41.seq
524291234 gbgss42.seq
28742152 gbgss43.seq
524288882 gbgss44.seq
524291090 gbgss45.seq
524290976 gbgss46.seq
524290985 gbgss47.seq
209346767 gbgss48.seq
524291863 gbgss49.seq
168350020 gbgss5.seq
524291582 gbgss50.seq
524290401 gbgss51.seq
524290464 gbgss52.seq
524290548 gbgss53.seq
524290689 gbgss54.seq
524289963 gbgss55.seq
524289945 gbgss56.seq
524290428 gbgss57.seq
524291284 gbgss58.seq
524290900 gbgss59.seq
524290951 gbgss6.seq
5856233 gbgss60.seq
524289023 gbgss61.seq
524290882 gbgss62.seq
524290246 gbgss63.seq
457238462 gbgss64.seq
524290719 gbgss65.seq
524291022 gbgss66.seq
524290625 gbgss67.seq
524289509 gbgss68.seq
524291296 gbgss69.seq
524289102 gbgss7.seq
524290162 gbgss70.seq
524290171 gbgss71.seq
524290218 gbgss72.seq
524289197 gbgss73.seq
524291503 gbgss74.seq
524289627 gbgss75.seq
524291206 gbgss76.seq
32487361 gbgss77.seq
524289473 gbgss78.seq
524291931 gbgss79.seq
524291704 gbgss8.seq
524289482 gbgss80.seq
524290727 gbgss81.seq
524289703 gbgss82.seq
524289751 gbgss83.seq
524289336 gbgss84.seq
524290248 gbgss85.seq
524289011 gbgss86.seq
524292247 gbgss87.seq
524290044 gbgss88.seq
376569727 gbgss89.seq
524290120 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
249992912 gbhtc1.seq
249993927 gbhtc10.seq
249997743 gbhtc11.seq
16726469 gbhtc12.seq
249997534 gbhtc13.seq
249996320 gbhtc14.seq
59293891 gbhtc15.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
83873876 gbhtc8.seq
249996616 gbhtc9.seq
249904748 gbhtg1.seq
249868447 gbhtg10.seq
249917503 gbhtg100.seq
249844944 gbhtg101.seq
249902534 gbhtg102.seq
249987029 gbhtg103.seq
5671243 gbhtg104.seq
249895732 gbhtg105.seq
249878049 gbhtg106.seq
249900433 gbhtg107.seq
249851884 gbhtg108.seq
249852416 gbhtg109.seq
1107147 gbhtg11.seq
249894066 gbhtg110.seq
249963230 gbhtg111.seq
249925320 gbhtg112.seq
247164576 gbhtg113.seq
189877972 gbhtg114.seq
249974219 gbhtg115.seq
249854932 gbhtg116.seq
249918615 gbhtg117.seq
249806582 gbhtg118.seq
249809192 gbhtg119.seq
249657443 gbhtg12.seq
53489426 gbhtg120.seq
249935891 gbhtg121.seq
249834856 gbhtg122.seq
249930798 gbhtg123.seq
249875691 gbhtg124.seq
249782400 gbhtg125.seq
134760056 gbhtg126.seq
249793216 gbhtg127.seq
249910238 gbhtg128.seq
249870863 gbhtg129.seq
249699749 gbhtg13.seq
249863756 gbhtg130.seq
249968033 gbhtg131.seq
249824826 gbhtg132.seq
249737985 gbhtg133.seq
249883130 gbhtg134.seq
249907858 gbhtg135.seq
71030319 gbhtg136.seq
249765870 gbhtg14.seq
249760883 gbhtg15.seq
249998122 gbhtg16.seq
249532502 gbhtg17.seq
249983662 gbhtg18.seq
249677291 gbhtg19.seq
249994630 gbhtg2.seq
249988730 gbhtg20.seq
237145184 gbhtg21.seq
249760624 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761207 gbhtg26.seq
249891641 gbhtg27.seq
249961480 gbhtg28.seq
249841969 gbhtg29.seq
249950135 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249920767 gbhtg33.seq
249929437 gbhtg34.seq
249919058 gbhtg35.seq
249858205 gbhtg36.seq
249814604 gbhtg37.seq
249767419 gbhtg38.seq
249627604 gbhtg39.seq
249984089 gbhtg4.seq
249839726 gbhtg40.seq
224363115 gbhtg41.seq
249889211 gbhtg42.seq
249786793 gbhtg43.seq
249972417 gbhtg44.seq
249775813 gbhtg45.seq
249913172 gbhtg46.seq
249598316 gbhtg47.seq
249865084 gbhtg48.seq
249793045 gbhtg49.seq
249882044 gbhtg5.seq
249922715 gbhtg50.seq
235040956 gbhtg51.seq
249732687 gbhtg52.seq
249918496 gbhtg53.seq
249773162 gbhtg54.seq
249971361 gbhtg55.seq
249962512 gbhtg56.seq
18795863 gbhtg57.seq
249861195 gbhtg58.seq
249939539 gbhtg59.seq
249898460 gbhtg6.seq
249990521 gbhtg60.seq
249920368 gbhtg61.seq
225327613 gbhtg62.seq
249854069 gbhtg63.seq
249787680 gbhtg64.seq
249883720 gbhtg65.seq
249980764 gbhtg66.seq
249833261 gbhtg67.seq
16614633 gbhtg68.seq
249960711 gbhtg69.seq
249933725 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249976832 gbhtg72.seq
225297486 gbhtg73.seq
249811217 gbhtg74.seq
249874983 gbhtg75.seq
249800230 gbhtg76.seq
249959810 gbhtg77.seq
244236211 gbhtg78.seq
249883527 gbhtg79.seq
249933567 gbhtg8.seq
249989775 gbhtg80.seq
249839558 gbhtg81.seq
249838461 gbhtg82.seq
216751380 gbhtg83.seq
249966974 gbhtg84.seq
249803194 gbhtg85.seq
249757813 gbhtg86.seq
249850131 gbhtg87.seq
220831145 gbhtg88.seq
249970053 gbhtg89.seq
249923766 gbhtg9.seq
249954204 gbhtg90.seq
249999447 gbhtg91.seq
249963669 gbhtg92.seq
208918917 gbhtg93.seq
249866049 gbhtg94.seq
249911674 gbhtg95.seq
249904005 gbhtg96.seq
249804025 gbhtg97.seq
168109739 gbhtg98.seq
249744688 gbhtg99.seq
249999673 gbinv1.seq
249997453 gbinv10.seq
165453589 gbinv11.seq
249999290 gbinv12.seq
249998664 gbinv13.seq
249994139 gbinv14.seq
149023212 gbinv15.seq
249998069 gbinv16.seq
248574205 gbinv17.seq
250000151 gbinv18.seq
249998912 gbinv19.seq
249950833 gbinv2.seq
249999337 gbinv20.seq
114523974 gbinv21.seq
249930410 gbinv22.seq
175506919 gbinv23.seq
249999260 gbinv24.seq
249997009 gbinv25.seq
250000015 gbinv26.seq
221159464 gbinv27.seq
249999431 gbinv28.seq
249997069 gbinv29.seq
242742644 gbinv3.seq
249997666 gbinv30.seq
249999366 gbinv31.seq
150258267 gbinv32.seq
249998497 gbinv4.seq
249999523 gbinv5.seq
249998746 gbinv6.seq
219319984 gbinv7.seq
249999709 gbinv8.seq
249998875 gbinv9.seq
140102522 gbjou1.idx
299070211 gbjou10.idx
262313186 gbjou11.idx
235597318 gbjou12.idx
33117805 gbjou13.idx
139809971 gbjou2.idx
164800467 gbjou3.idx
186122154 gbjou4.idx
271084558 gbjou5.idx
277604882 gbjou6.idx
281000150 gbjou7.idx
281532811 gbjou8.idx
305259068 gbjou9.idx
341466895 gbkey1.idx
180076044 gbkey2.idx
179699900 gbkey3.idx
289064002 gbkey4.idx
183435417 gbkey5.idx
112768501 gbkey6.idx
249993498 gbmam1.seq
249970151 gbmam2.seq
249921125 gbmam3.seq
249997135 gbmam4.seq
250000133 gbmam5.seq
249998112 gbmam6.seq
230773205 gbmam7.seq
57028188 gbnew.txt
249999770 gbpat1.seq
249999665 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192934428 gbpat107.seq
249999496 gbpat108.seq
249999625 gbpat109.seq
179586938 gbpat11.seq
249996349 gbpat110.seq
80124376 gbpat111.seq
250000053 gbpat112.seq
249999653 gbpat113.seq
249990767 gbpat114.seq
249999878 gbpat115.seq
249849703 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
250000166 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
249995194 gbpat13.seq
249997452 gbpat130.seq
66832984 gbpat131.seq
249992315 gbpat132.seq
249999867 gbpat133.seq
250000197 gbpat134.seq
249999821 gbpat135.seq
249998337 gbpat136.seq
249999652 gbpat137.seq
249998219 gbpat138.seq
196855168 gbpat139.seq
249998945 gbpat14.seq
249998039 gbpat140.seq
250000068 gbpat141.seq
250000015 gbpat142.seq
86028783 gbpat143.seq
249999922 gbpat144.seq
249997650 gbpat145.seq
249999904 gbpat146.seq
63539765 gbpat147.seq
249996030 gbpat148.seq
249999769 gbpat149.seq
250000196 gbpat15.seq
249999693 gbpat150.seq
249999623 gbpat151.seq
249999693 gbpat152.seq
249998756 gbpat153.seq
222137586 gbpat154.seq
250000249 gbpat155.seq
249999893 gbpat156.seq
249999893 gbpat157.seq
220539897 gbpat158.seq
249999753 gbpat159.seq
249999915 gbpat16.seq
249998685 gbpat160.seq
249999501 gbpat161.seq
12381933 gbpat162.seq
249997013 gbpat163.seq
249998113 gbpat164.seq
249999692 gbpat165.seq
250000218 gbpat166.seq
35343603 gbpat167.seq
249998580 gbpat168.seq
249999008 gbpat169.seq
65896429 gbpat17.seq
249999332 gbpat170.seq
249999797 gbpat171.seq
250000001 gbpat172.seq
249999979 gbpat173.seq
249999414 gbpat174.seq
250000129 gbpat175.seq
120826235 gbpat176.seq
250000027 gbpat18.seq
249999801 gbpat19.seq
249999577 gbpat2.seq
249999076 gbpat20.seq
249996891 gbpat21.seq
185825039 gbpat22.seq
249999073 gbpat23.seq
249858807 gbpat24.seq
249999670 gbpat25.seq
249999337 gbpat26.seq
71191909 gbpat27.seq
249986090 gbpat28.seq
249998686 gbpat29.seq
249999257 gbpat3.seq
249997796 gbpat30.seq
249999847 gbpat31.seq
250000237 gbpat32.seq
180194123 gbpat33.seq
249997899 gbpat34.seq
249999728 gbpat35.seq
249999308 gbpat36.seq
250000194 gbpat37.seq
130534023 gbpat38.seq
249996351 gbpat39.seq
249998049 gbpat4.seq
249993703 gbpat40.seq
249999077 gbpat41.seq
249999014 gbpat42.seq
249997197 gbpat43.seq
249845198 gbpat44.seq
249999190 gbpat45.seq
250000092 gbpat46.seq
171468056 gbpat47.seq
249999830 gbpat48.seq
249998527 gbpat49.seq
71794649 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164989586 gbpat56.seq
249883148 gbpat57.seq
249999624 gbpat58.seq
249999654 gbpat59.seq
249999527 gbpat6.seq
249999026 gbpat60.seq
134923930 gbpat61.seq
249998969 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999577 gbpat67.seq
144886744 gbpat68.seq
250000113 gbpat69.seq
249999768 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244403395 gbpat72.seq
248969066 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999901 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249991472 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
250000008 gbpat82.seq
249998696 gbpat83.seq
93332873 gbpat84.seq
249155886 gbpat85.seq
249999519 gbpat86.seq
249999913 gbpat87.seq
249999359 gbpat88.seq
249999368 gbpat89.seq
249999472 gbpat9.seq
250000155 gbpat90.seq
145293161 gbpat91.seq
249999203 gbpat92.seq
249998980 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196964910 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
176778777 gbphg1.seq
249998558 gbpln1.seq
249996097 gbpln10.seq
249998146 gbpln11.seq
249760575 gbpln12.seq
214796021 gbpln13.seq
249998215 gbpln14.seq
249985349 gbpln15.seq
249996352 gbpln16.seq
249592760 gbpln17.seq
249984680 gbpln18.seq
249606536 gbpln19.seq
249912130 gbpln2.seq
250000196 gbpln20.seq
33446762 gbpln21.seq
249992399 gbpln22.seq
97611111 gbpln23.seq
249998695 gbpln24.seq
249997899 gbpln25.seq
249464846 gbpln26.seq
221100868 gbpln27.seq
241343495 gbpln28.seq
249928944 gbpln29.seq
249880937 gbpln3.seq
246853724 gbpln30.seq
249998194 gbpln31.seq
250000030 gbpln32.seq
245605439 gbpln33.seq
249998432 gbpln34.seq
250000164 gbpln35.seq
249998547 gbpln36.seq
249997180 gbpln37.seq
137427689 gbpln38.seq
249997211 gbpln39.seq
249847550 gbpln4.seq
249997547 gbpln40.seq
249998338 gbpln41.seq
249998305 gbpln42.seq
249999352 gbpln43.seq
177280619 gbpln44.seq
249998120 gbpln45.seq
246082663 gbpln46.seq
249997392 gbpln47.seq
249997614 gbpln48.seq
249996903 gbpln49.seq
249913869 gbpln5.seq
249841671 gbpln50.seq
249999521 gbpln51.seq
249994338 gbpln52.seq
135119513 gbpln53.seq
249941327 gbpln6.seq
249998388 gbpln7.seq
244688955 gbpln8.seq
249998386 gbpln9.seq
148949613 gbpri1.seq
249783195 gbpri10.seq
129741660 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902483 gbpri16.seq
249876241 gbpri17.seq
249991978 gbpri18.seq
249903004 gbpri19.seq
249833335 gbpri2.seq
249946699 gbpri20.seq
249965782 gbpri21.seq
249997606 gbpri22.seq
23019766 gbpri23.seq
177481363 gbpri24.seq
249996755 gbpri25.seq
211364614 gbpri26.seq
249987118 gbpri27.seq
249988725 gbpri28.seq
249948820 gbpri29.seq
250000076 gbpri3.seq
249935405 gbpri30.seq
249945956 gbpri31.seq
249992481 gbpri32.seq
249821502 gbpri33.seq
249997164 gbpri34.seq
95885621 gbpri35.seq
249993971 gbpri36.seq
249998020 gbpri37.seq
249953956 gbpri38.seq
249996013 gbpri39.seq
249968482 gbpri4.seq
249999244 gbpri40.seq
181770071 gbpri41.seq
249965759 gbpri42.seq
249864502 gbpri43.seq
57274461 gbpri44.seq
249956957 gbpri5.seq
249788332 gbpri6.seq
249806906 gbpri7.seq
249867498 gbpri8.seq
249957345 gbpri9.seq
322601 gbrel.txt
249739971 gbrod1.seq
249947629 gbrod10.seq
61165475 gbrod11.seq
249871284 gbrod12.seq
249783783 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249885197 gbrod17.seq
249824125 gbrod18.seq
243108819 gbrod19.seq
249823318 gbrod2.seq
249767627 gbrod20.seq
249924095 gbrod21.seq
230194968 gbrod22.seq
249997396 gbrod23.seq
249996911 gbrod24.seq
249980494 gbrod25.seq
249698931 gbrod26.seq
250000195 gbrod27.seq
250000060 gbrod28.seq
197625777 gbrod29.seq
249879603 gbrod3.seq
249870854 gbrod4.seq
249889593 gbrod5.seq
249922241 gbrod6.seq
249963764 gbrod7.seq
249791979 gbrod8.seq
249906937 gbrod9.seq
4075873506 gbsdr1.txt
5750726401 gbsdr2.txt
2712808841 gbsdr3.txt
157926185 gbsec.idx
249997389 gbsts1.seq
249997720 gbsts10.seq
210919464 gbsts11.seq
249996524 gbsts12.seq
249999349 gbsts13.seq
249999266 gbsts14.seq
249999572 gbsts15.seq
24470469 gbsts16.seq
249999107 gbsts17.seq
249997790 gbsts18.seq
249999071 gbsts19.seq
249998220 gbsts2.seq
148558500 gbsts20.seq
249999008 gbsts3.seq
249998277 gbsts4.seq
39162150 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249998706 gbsts9.seq
249996557 gbsyn1.seq
249998815 gbsyn2.seq
249984763 gbsyn3.seq
249947035 gbsyn4.seq
249995230 gbsyn5.seq
249963999 gbsyn6.seq
131727192 gbsyn7.seq
249999888 gbtsa1.seq
249999324 gbtsa10.seq
250000124 gbtsa11.seq
103880100 gbtsa12.seq
249997835 gbtsa13.seq
249999221 gbtsa14.seq
249998017 gbtsa15.seq
249997884 gbtsa16.seq
167500778 gbtsa17.seq
249998217 gbtsa18.seq
250000150 gbtsa19.seq
249997963 gbtsa2.seq
249998775 gbtsa20.seq
249998636 gbtsa21.seq
249998457 gbtsa22.seq
249998315 gbtsa23.seq
30034786 gbtsa24.seq
249998710 gbtsa25.seq
249997475 gbtsa26.seq
249998934 gbtsa27.seq
249999882 gbtsa28.seq
249998307 gbtsa29.seq
249998332 gbtsa3.seq
249999868 gbtsa30.seq
119964559 gbtsa31.seq
249998534 gbtsa32.seq
249999961 gbtsa33.seq
249999936 gbtsa34.seq
249997768 gbtsa35.seq
249999157 gbtsa36.seq
249998280 gbtsa37.seq
250000199 gbtsa38.seq
249999536 gbtsa39.seq
250000057 gbtsa4.seq
14520715 gbtsa40.seq
249999887 gbtsa41.seq
249996608 gbtsa42.seq
249999449 gbtsa43.seq
249998204 gbtsa44.seq
249998438 gbtsa45.seq
249997723 gbtsa46.seq
249998943 gbtsa47.seq
110697379 gbtsa48.seq
249995009 gbtsa49.seq
83183501 gbtsa5.seq
249996881 gbtsa50.seq
249999075 gbtsa51.seq
250000118 gbtsa52.seq
171293596 gbtsa53.seq
249999549 gbtsa54.seq
249999642 gbtsa55.seq
249998666 gbtsa56.seq
249999859 gbtsa57.seq
249996519 gbtsa58.seq
249995507 gbtsa59.seq
249999109 gbtsa6.seq
155002488 gbtsa60.seq
249996202 gbtsa7.seq
249998532 gbtsa8.seq
249999947 gbtsa9.seq
483312 gbuna1.seq
249998531 gbvrl1.seq
249998716 gbvrl10.seq
122631559 gbvrl11.seq
249998278 gbvrl12.seq
249999459 gbvrl13.seq
249996666 gbvrl14.seq
249999005 gbvrl15.seq
249983590 gbvrl16.seq
249998486 gbvrl17.seq
248872137 gbvrl18.seq
249999564 gbvrl19.seq
249999629 gbvrl2.seq
42845633 gbvrl20.seq
249999748 gbvrl3.seq
249998265 gbvrl4.seq
186864801 gbvrl5.seq
249999313 gbvrl6.seq
249997804 gbvrl7.seq
249998121 gbvrl8.seq
249998669 gbvrl9.seq
249975650 gbvrt1.seq
249762539 gbvrt10.seq
249940020 gbvrt11.seq
185678776 gbvrt12.seq
249995062 gbvrt13.seq
249964366 gbvrt14.seq
249831294 gbvrt15.seq
249998244 gbvrt16.seq
249998335 gbvrt17.seq
249999421 gbvrt18.seq
98559517 gbvrt19.seq
249998108 gbvrt2.seq
249914234 gbvrt20.seq
249998095 gbvrt21.seq
249996116 gbvrt22.seq
249999033 gbvrt23.seq
249998863 gbvrt24.seq
132520878 gbvrt25.seq
249975066 gbvrt3.seq
249995434 gbvrt4.seq
96586634 gbvrt5.seq
249998200 gbvrt6.seq
249995207 gbvrt7.seq
249818477 gbvrt8.seq
249951536 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 64294 86001814
BCT10 64 115520696
BCT11 93 115223175
BCT12 92 107627430
BCT13 16110 78797266
BCT14 53933 85390732
BCT15 93 110189094
BCT16 151 93915681
BCT17 61 112455059
BCT18 52 112042350
BCT19 46 114233015
BCT2 3687 109862960
BCT20 58 114931588
BCT21 67 111284815
BCT22 36 96325907
BCT23 40 106881287
BCT24 58 105533856
BCT25 74 111675186
BCT26 55 110045255
BCT27 63 106845575
BCT28 55 109391288
BCT29 53 108650404
BCT3 51 110598894
BCT30 46 110496749
BCT31 95 109522868
BCT32 59 110966729
BCT33 67 108616570
BCT34 124 106350090
BCT35 36 69419425
BCT36 202 109105429
BCT37 51 109861512
BCT38 40 106911174
BCT39 54 104252121
BCT4 55 106656794
BCT40 58 107350200
BCT41 44 110960713
BCT42 80 107599606
BCT43 52 108571742
BCT44 46 107138318
BCT45 63 108219635
BCT46 73 107730422
BCT47 61 68565025
BCT48 68 109366515
BCT49 65 102053208
BCT5 38315 81647768
BCT50 49 103628191
BCT51 53 107838942
BCT52 54 107298795
BCT53 66 110212402
BCT54 63 106817738
BCT55 51 108471276
BCT56 59 112271787
BCT57 61 101581985
BCT58 51 112256524
BCT59 49 61864990
BCT6 39043 82651736
BCT60 40 109701549
BCT61 76 109232217
BCT62 267 100367663
BCT63 333 36024746
BCT64 1589 2511877
BCT65 3179 5215895
BCT66 6347 7901828
BCT67 12648 15076979
BCT68 25628 27748212
BCT69 50523 53996220
BCT7 5523 96146388
BCT70 76419 77523911
BCT71 71646 77213128
BCT72 9130 93784186
BCT73 5582 104214738
BCT74 3040 104932582
BCT75 68 117066999
BCT76 6090 111349481
BCT77 28736 98141325
BCT78 13508 13475693
BCT79 68275 80482885
BCT8 13867 90150583
BCT80 65338 84200660
BCT81 71797 82607686
BCT82 28499 59774766
BCT9 6748 96304913
ENV1 94336 71367060
ENV10 83176 87258219
ENV11 20151 17417530
ENV12 84824 80874260
ENV13 120528 43471978
ENV14 88803 78146413
ENV15 96648 67746416
ENV16 96131 63481881
ENV17 115137 66005408
ENV18 111280 70659464
ENV19 50578 68290501
ENV2 91303 69206812
ENV20 68113 87692396
ENV21 91179 74668724
ENV22 128367 34403925
ENV23 123053 29095686
ENV24 77627 17793372
ENV25 123136 49870768
ENV26 97611 68195055
ENV27 116372 55934950
ENV28 137000 52573811
ENV29 107637 58857088
ENV3 84915 75668086
ENV30 39271 39538609
ENV31 71058 96548027
ENV32 95515 69640088
ENV33 107731 43880504
ENV34 89966 66930791
ENV35 56971 35960774
ENV36 111419 47247795
ENV37 102180 61266206
ENV38 107426 64312385
ENV39 66717 95281930
ENV4 81943 84206805
ENV40 76780 85413380
ENV41 63294 86014608
ENV42 80539 84909910
ENV43 109558 47774738
ENV44 113978 56791864
ENV45 104184 61223043
ENV46 99788 46951523
ENV47 53479 55223199
ENV48 42545 54913053
ENV49 50522 57905939
ENV5 88040 86934708
ENV50 52831 40337879
ENV6 95906 58076672
ENV7 131779 31253773
ENV8 86386 70482311
ENV9 93283 72934378
EST1 158932 61578479
EST10 167449 72157693
EST100 226264 140239030
EST101 227876 115659958
EST102 201207 104812696
EST103 172048 100993598
EST104 102141 80099408
EST105 165086 110960002
EST106 168528 110445423
EST107 117336 68340860
EST108 63863 23527312
EST109 64115 22727247
EST11 169551 73990710
EST110 64332 23421594
EST111 64296 27232269
EST112 64304 21892571
EST113 65713 25960282
EST114 63774 27850880
EST115 64286 26247748
EST116 64525 26965223
EST117 64244 25128362
EST118 61232 38021283
EST119 162068 76978898
EST12 166812 70069138
EST120 174823 86140156
EST121 158477 92898019
EST122 149626 95761470
EST123 153477 89559420
EST124 125895 78316874
EST125 202876 99251380
EST126 153535 79573162
EST127 157661 84198371
EST128 155783 89048296
EST129 149626 79582445
EST13 72705 34876658
EST130 174498 101221879
EST131 199755 116492004
EST132 182924 99395258
EST133 162692 84591078
EST134 158421 80023195
EST135 145997 89295313
EST136 142146 85882253
EST137 93960 49352258
EST138 188208 107207834
EST139 232320 102104376
EST14 217986 109455110
EST140 153004 89672629
EST141 168259 91528034
EST142 146979 87094926
EST143 137539 86872130
EST144 157510 95441526
EST145 146282 76542905
EST146 123493 64365855
EST147 121742 65859763
EST148 129203 54566948
EST149 127602 50731997
EST15 168490 105323990
EST150 128339 51062027
EST151 119514 45394613
EST152 171932 86436994
EST153 180065 80258706
EST154 154571 109521263
EST155 211737 129261883
EST156 212986 118484045
EST157 174105 93300826
EST158 148709 112122807
EST159 133571 83237599
EST16 179029 112341391
EST160 157444 98145607
EST161 150350 80155185
EST162 141481 81542752
EST163 169364 94462991
EST164 73618 44488129
EST165 154569 95950095
EST166 188990 106179151
EST167 142577 78078416
EST168 135417 71887544
EST169 168396 93985371
EST17 195243 112992327
EST170 180159 103533799
EST171 150823 94202610
EST172 171478 83608777
EST173 129358 86255611
EST174 182198 107533871
EST175 165159 93307646
EST176 112579 66644049
EST177 163530 93202672
EST178 34710 22031886
EST179 169043 101002867
EST18 190717 121438671
EST180 181556 127477884
EST181 148649 106499913
EST182 190815 99702065
EST183 152893 115942608
EST184 144199 86861616
EST185 145313 82975661
EST186 177761 71821018
EST187 149418 84308853
EST188 155265 97136743
EST189 162803 99958406
EST19 159309 114089325
EST190 141910 88193240
EST191 162273 94468553
EST192 133855 89816808
EST193 131328 88454601
EST194 144687 89212211
EST195 134202 89314896
EST196 124157 87254921
EST197 172837 92195051
EST198 173996 95856725
EST199 173450 96328504
EST2 161860 61550624
EST20 187006 99412606
EST200 171159 96079370
EST201 168285 94223836
EST202 172233 95843088
EST203 173454 95045895
EST204 173997 95580344
EST205 32353 17600201
EST206 191190 103860386
EST207 202399 106545611
EST208 174612 105290290
EST209 183703 103807433
EST21 217053 106420614
EST210 197445 118768904
EST211 195632 116461293
EST212 182839 121365485
EST213 174038 104931408
EST214 214275 146902968
EST215 237722 107486446
EST216 138982 107986441
EST217 150845 101470219
EST218 146713 91002724
EST219 205529 111398949
EST22 198810 65934409
EST220 171951 113780568
EST221 100206 91312194
EST222 142424 110344313
EST223 160805 94665708
EST224 145887 106334751
EST225 216110 100555264
EST226 144427 101973020
EST227 137791 96797877
EST228 140548 100920077
EST229 121073 86002347
EST23 140953 40083895
EST230 95681 61722132
EST231 141403 91621985
EST232 133047 97994613
EST233 137803 98183941
EST234 123959 84448347
EST235 132199 86593914
EST236 158292 116643709
EST237 143683 116993241
EST238 133482 113395695
EST239 154615 95276872
EST24 103790 28102181
EST240 178340 113056931
EST241 146211 92203435
EST242 179436 111973974
EST243 164794 123136254
EST244 138960 103017140
EST245 12995 10338977
EST246 164807 100778786
EST247 230812 96671728
EST248 152562 113500463
EST249 178761 65596315
EST25 121323 50824188
EST250 216961 49656200
EST251 212780 81670339
EST252 170960 131660037
EST253 165374 101272276
EST254 168637 107721170
EST255 164804 111350210
EST256 166247 117451460
EST257 87266 44454798
EST258 187641 98453210
EST259 176353 111474148
EST26 213567 97133327
EST260 165193 109409916
EST261 232866 110419695
EST262 278040 120184258
EST263 184361 112203903
EST264 187434 36788592
EST265 259128 124407706
EST266 151769 94429035
EST267 161061 104996037
EST268 96153 56063663
EST269 173732 118471832
EST27 219261 110222276
EST270 183922 98723613
EST271 171922 113285975
EST272 182231 105591250
EST273 207951 37037605
EST274 191352 55825724
EST275 185585 105698019
EST276 187355 118409581
EST277 173193 113520410
EST278 179764 102509586
EST279 156358 104439555
EST28 190448 88579855
EST280 111475 37026413
EST281 129945 81935339
EST282 132677 85876525
EST283 155844 100776555
EST284 259866 27446115
EST285 263841 24254737
EST286 146877 105656582
EST287 168713 109218667
EST288 161516 103164737
EST289 155244 91251515
EST29 157995 68875086
EST290 265124 31874298
EST291 164960 107915265
EST292 73836 43204168
EST293 185152 111347902
EST294 148934 90569926
EST295 195053 109717730
EST296 164749 115054659
EST297 161800 104549986
EST298 189278 113681866
EST299 179235 100232458
EST3 153644 54437600
EST30 171542 69631452
EST300 181207 103505381
EST301 188377 64371570
EST302 187448 69681221
EST303 187279 70947853
EST304 122801 47049026
EST305 187254 91592670
EST306 181990 133376579
EST307 149980 86434895
EST308 154313 90638859
EST309 128613 100430992
EST31 148896 63217399
EST310 156897 97944790
EST311 170040 97302122
EST312 154961 96676546
EST313 170741 98704014
EST314 157177 105017526
EST315 145744 101391698
EST316 165285 106495474
EST317 156576 114299915
EST318 182313 153773675
EST319 172733 95817504
EST32 168362 76138490
EST320 134987 84431174
EST321 143893 98898838
EST322 141053 94417289
EST323 139130 91185759
EST324 146132 101303442
EST325 150947 101392765
EST326 179129 106530175
EST327 149751 86901009
EST328 151785 86169907
EST329 155759 113149793
EST33 173962 66610573
EST330 158584 94640910
EST331 73804 48737847
EST332 139176 87247235
EST333 152418 94688064
EST334 206522 106364357
EST335 115452 63926215
EST336 102494 65094261
EST337 132707 88797098
EST338 139164 88032273
EST339 122287 75088277
EST34 122831 43242860
EST340 216348 82400999
EST341 181678 87208748
EST342 157776 94956094
EST343 178426 108918245
EST344 151229 90220551
EST345 83587 54939881
EST346 134637 90100387
EST347 145777 95314746
EST348 187422 116060164
EST349 158438 91984941
EST35 97393 29892123
EST350 173706 98853201
EST351 176791 128945349
EST352 83329 51200600
EST353 82487 46935356
EST354 148500 85054277
EST355 131122 77274291
EST356 157359 42943688
EST357 158894 31765703
EST358 155034 47945313
EST359 185611 120243412
EST36 97797 30586622
EST360 245901 114144337
EST361 250958 114637605
EST362 177943 100469795
EST363 142525 92278852
EST364 137795 86189021
EST365 155864 92851889
EST366 193886 119159003
EST367 223605 60086256
EST368 183204 112114927
EST369 223166 121529297
EST37 96709 29346134
EST370 140447 68389240
EST371 168272 93109672
EST372 158111 105213526
EST373 196254 132751999
EST374 173225 135238819
EST375 175026 119752921
EST376 163378 96916373
EST377 166455 109595119
EST378 196295 111008314
EST379 187806 97455820
EST38 98630 29837565
EST380 198836 121310026
EST381 192539 128771730
EST382 103802 68436488
EST383 207894 139986587
EST384 215906 131151555
EST385 208860 168492896
EST386 184014 117722530
EST387 195760 110847208
EST388 171411 25348392
EST389 161467 13464054
EST39 99441 31226275
EST390 156725 23284758
EST391 158510 32685506
EST392 158972 31576678
EST393 153035 68277003
EST394 106078 61729486
EST395 181383 115973075
EST396 165683 105418274
EST397 164203 108379743
EST398 143750 95795568
EST399 142090 100612305
EST4 170812 67108330
EST40 23166 5905608
EST400 149119 95110466
EST401 178802 129930010
EST402 146756 93853950
EST403 172524 82486190
EST404 167761 26790112
EST405 165497 87345879
EST406 154826 105070333
EST407 139371 87250639
EST408 149060 92953928
EST409 173331 97527841
EST41 101002 53008237
EST410 184612 126556856
EST411 139198 92155516
EST412 132071 90393747
EST413 154718 95705951
EST414 163636 93716047
EST415 177757 96048778
EST416 148437 93011850
EST417 170665 100990840
EST418 173431 106262437
EST419 129160 81298911
EST42 119591 50876281
EST420 89324 67636175
EST421 81031 61307803
EST422 8126 4213382
EST423 117932 74586021
EST424 152635 84896632
EST425 128601 78239095
EST426 138076 92607343
EST427 141723 83367347
EST428 165100 96295215
EST429 179146 94431334
EST43 164126 85792534
EST430 168897 107318718
EST431 148879 95276212
EST432 173181 77728918
EST433 172158 89977820
EST434 147525 83561865
EST435 196612 115275569
EST436 206016 121379791
EST437 166367 101953408
EST438 148495 110874517
EST439 135526 83036949
EST44 166553 67568905
EST440 137530 86491505
EST441 210049 79447310
EST442 186615 82542769
EST443 205369 87789226
EST444 205437 104923427
EST445 199216 119610825
EST446 171711 104168011
EST447 106741 69861680
EST448 149418 92244251
EST449 157676 107648619
EST45 166151 87494905
EST450 190529 97067882
EST451 152303 85475146
EST452 151141 79116091
EST453 161583 58851294
EST454 167312 62340562
EST455 58140 21404063
EST46 170543 87214631
EST47 162206 87522674
EST48 162815 82218649
EST49 157673 91174856
EST5 168996 66194437
EST50 161232 91055515
EST51 158740 98028371
EST52 157227 69628234
EST53 150414 82908716
EST54 81727 50008137
EST55 167804 67469558
EST56 160637 76530251
EST57 168910 93006890
EST58 156502 101565373
EST59 157574 100365242
EST6 171504 66930687
EST60 163321 100740971
EST61 160517 106017460
EST62 172752 74009357
EST63 173113 100919246
EST64 151399 80261551
EST65 151039 84149386
EST66 159175 99439664
EST67 137256 78680397
EST68 143278 85052060
EST69 196241 109283008
EST7 169800 72720649
EST70 197806 103725202
EST71 211701 118740452
EST72 191988 113282334
EST73 193866 114172508
EST74 160438 86445853
EST75 133292 62214821
EST76 136782 68624799
EST77 158599 108209172
EST78 155640 85577784
EST79 144445 78843794
EST8 179404 72869764
EST80 55909 37367851
EST81 182540 94454774
EST82 211248 123227819
EST83 214378 115129521
EST84 209163 98414931
EST85 209040 91195659
EST86 148529 90253143
EST87 144306 83890167
EST88 162803 81161627
EST89 159941 80848835
EST9 168515 69281418
EST90 151958 102903772
EST91 152622 99264915
EST92 133417 75842326
EST93 152420 115234390
EST94 141968 104568184
EST95 145379 105381481
EST96 139442 88336562
EST97 152795 86184751
EST98 174897 107332720
EST99 243563 149230578
GSS1 200062 87617305
GSS10 132040 60283336
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167238 128921102
GSS104 149783 82569304
GSS105 191527 120854119
GSS106 167747 112125081
GSS107 197328 115524481
GSS108 204979 134772318
GSS109 209812 138226237
GSS11 137026 73963213
GSS110 207578 140849552
GSS111 206236 142442659
GSS112 205251 143737410
GSS113 205175 143938693
GSS114 202120 146641002
GSS115 182321 139888903
GSS116 18410 10872590
GSS117 132848 84052151
GSS118 169611 80019194
GSS119 184271 79450634
GSS12 147892 75892246
GSS120 170296 148327490
GSS121 177468 120473044
GSS122 184875 149490039
GSS123 192483 124742719
GSS124 187594 137810663
GSS125 192263 126742219
GSS126 190506 95556959
GSS127 166327 152962022
GSS128 164142 115734017
GSS129 65893 42218697
GSS13 145394 68606713
GSS130 171037 155489454
GSS131 172571 154290391
GSS132 172231 155358474
GSS133 173848 154157454
GSS134 172390 153324435
GSS135 184233 143887127
GSS136 182583 147198604
GSS137 163082 115404420
GSS138 206389 88572477
GSS139 265737 40934133
GSS14 169809 84775223
GSS140 265732 40960783
GSS141 57803 8869777
GSS142 256185 58367796
GSS143 253136 60903252
GSS144 193386 82083863
GSS145 194899 73134952
GSS146 185020 152902548
GSS147 179264 156888408
GSS148 172593 159246879
GSS149 194033 127388923
GSS15 161099 97662972
GSS150 245524 58771424
GSS151 210585 101878246
GSS152 84247 16088316
GSS153 87119 64001690
GSS154 83555 62807025
GSS155 103679 48622004
GSS156 68579 58473846
GSS157 7668 7019084
GSS158 68591 57924394
GSS159 69224 56650935
GSS16 172836 87033449
GSS160 69460 56187403
GSS161 71202 55998401
GSS162 68561 51865315
GSS163 75915 58209304
GSS164 87237 74898207
GSS165 81830 44609896
GSS166 92677 45029689
GSS167 63209 47603494
GSS168 77435 61351403
GSS169 69655 58699293
GSS17 183522 113500748
GSS170 67711 62706526
GSS171 61946 53348157
GSS172 95612 42935517
GSS173 21104 4920928
GSS174 112937 70876701
GSS175 823 560132
GSS176 23226 28867035
GSS177 109043 70652585
GSS178 84533 34668223
GSS179 35815 22222733
GSS18 192358 114306485
GSS180 103304 62490220
GSS181 102329 63761256
GSS182 104268 67656826
GSS183 82099 41276456
GSS184 83102 54651503
GSS185 95673 61335435
GSS186 107323 78547443
GSS187 106375 76684757
GSS188 106058 79947480
GSS189 103996 80016519
GSS19 114078 52104778
GSS190 76374 51039123
GSS191 104572 63292187
GSS192 109868 66415305
GSS193 106205 59313311
GSS194 68379 37446344
GSS195 69573 38736929
GSS196 37145 17774305
GSS197 85481 46023427
GSS198 97119 55907586
GSS199 94982 49597190
GSS2 182294 92190593
GSS20 181789 101771260
GSS200 96286 55922591
GSS201 42132 23615490
GSS202 114638 43642267
GSS203 117085 39368203
GSS204 108676 55514545
GSS205 101471 78372335
GSS206 71604 45899517
GSS207 95891 36542252
GSS208 95417 37268709
GSS209 96671 35161518
GSS21 166208 114173594
GSS210 94285 39167432
GSS211 37736 17626556
GSS212 103939 66277823
GSS213 94551 61190929
GSS214 95128 60357048
GSS215 94773 60868501
GSS216 75675 70017159
GSS217 75117 74330280
GSS218 4473 7127270
GSS219 83736 28233267
GSS22 169506 97609042
GSS220 84219 27346468
GSS221 84926 25909272
GSS222 14851 4422302
GSS223 16547 7508221
GSS224 92377 59458826
GSS225 84657 52502700
GSS226 94076 50770605
GSS227 88581 48350254
GSS228 10980 5983348
GSS229 90648 56882510
GSS23 187251 126687349
GSS230 89662 61882079
GSS231 88553 63641206
GSS232 89283 62505584
GSS233 9890 7129098
GSS234 87995 63795538
GSS235 90217 62488977
GSS236 94639 59914104
GSS237 74309 63030713
GSS238 84243 78883806
GSS239 83030 80583817
GSS24 194057 130219707
GSS240 70509 52677201
GSS241 117650 64297121
GSS242 108874 55446727
GSS243 107533 52125503
GSS244 96658 43251344
GSS245 109801 49060015
GSS246 98194 46325477
GSS247 73059 72225597
GSS248 76682 71142435
GSS249 72980 46435649
GSS25 177481 105207105
GSS250 94787 57200301
GSS251 93517 59081345
GSS252 93900 58510429
GSS253 94714 57307691
GSS254 94280 58019875
GSS255 6737 3337348
GSS26 185918 107808246
GSS27 170600 151419573
GSS28 190494 146229226
GSS29 151147 106441309
GSS3 174946 87827370
GSS30 192446 132128206
GSS31 13634 8776287
GSS32 196044 127318947
GSS33 216659 116231837
GSS34 218573 113602417
GSS35 219720 112025390
GSS36 213958 121897898
GSS37 198560 156434224
GSS38 194984 146797396
GSS39 197244 73372753
GSS4 167155 85101061
GSS40 185067 97681159
GSS41 189782 125958599
GSS42 170343 158770231
GSS43 9057 5889153
GSS44 183999 100320381
GSS45 173032 121667203
GSS46 185089 124655109
GSS47 190835 122398633
GSS48 70733 62564650
GSS49 171799 101963548
GSS5 53445 31617730
GSS50 167647 103037030
GSS51 167798 102616122
GSS52 184194 121477291
GSS53 184774 116632196
GSS54 181686 122485290
GSS55 187531 113994336
GSS56 189392 134519036
GSS57 178947 104938173
GSS58 195715 120562907
GSS59 179925 133347062
GSS6 161617 84471320
GSS60 1898 1718384
GSS61 172844 138948397
GSS62 161635 111553347
GSS63 161673 111572480
GSS64 158827 107592995
GSS65 156768 129062324
GSS66 170185 142553826
GSS67 179844 117096102
GSS68 204911 127968663
GSS69 193332 110756601
GSS7 165322 79361222
GSS70 243921 125965583
GSS71 160206 106329772
GSS72 159350 119782538
GSS73 162663 124539011
GSS74 162629 124600834
GSS75 175106 108957765
GSS76 190310 140120939
GSS77 13117 7645415
GSS78 199135 126616367
GSS79 170370 111603100
GSS8 165782 88979718
GSS80 200718 131518447
GSS81 211575 85835271
GSS82 187842 98659368
GSS83 131802 92017231
GSS84 146986 118083551
GSS85 139587 116995322
GSS86 142817 114062378
GSS87 144008 119847686
GSS88 141842 115691442
GSS89 106718 88926972
GSS9 137999 67157765
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 53710 70400749
HTC11 81792 70394487
HTC12 4015 4516038
HTC13 66993 60073171
HTC14 68556 69499762
HTC15 21887 15013323
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 60867 78012683
HTG1 1318 188771164
HTG10 1298 186340737
HTG100 990 189440077
HTG101 996 189331054
HTG102 985 189419172
HTG103 1161 190585510
HTG104 30 4314892
HTG105 1087 189830459
HTG106 1045 189717260
HTG107 1388 191466263
HTG108 1299 190868648
HTG109 1619 191114596
HTG11 6 837687
HTG110 1360 191966709
HTG111 1299 192094007
HTG112 1304 190416994
HTG113 1077 188177466
HTG114 867 138707568
HTG115 1513 182381556
HTG116 992 192178028
HTG117 930 180556880
HTG118 1076 193695026
HTG119 1103 193020481
HTG12 1451 183826858
HTG120 221 41441967
HTG121 1029 189520679
HTG122 1054 192676832
HTG123 1164 192083957
HTG124 1083 192945775
HTG125 1083 192937725
HTG126 590 104030016
HTG127 1121 192542900
HTG128 1081 192449925
HTG129 1078 192374295
HTG13 875 191579912
HTG130 1167 191952071
HTG131 1556 191876222
HTG132 1069 192186265
HTG133 1069 192216080
HTG134 1129 191783557
HTG135 1425 188848158
HTG136 391 49344806
HTG14 753 192058598
HTG15 745 191952430
HTG16 786 192129268
HTG17 797 191629689
HTG18 775 192103394
HTG19 2069 170638342
HTG2 2470 186037380
HTG20 1096 187413748
HTG21 887 180042173
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190515178
HTG29 939 189959636
HTG3 2513 185208586
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189501635
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191702609
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2550 188439001
HTG40 1049 189067591
HTG41 1089 167537350
HTG42 1256 188119418
HTG43 1169 188010117
HTG44 1150 188080035
HTG45 1117 191232412
HTG46 1269 190634433
HTG47 1176 190820695
HTG48 1128 191224702
HTG49 1046 191244150
HTG5 1283 185453274
HTG50 1030 189619303
HTG51 1042 178756613
HTG52 968 190052338
HTG53 1105 190148899
HTG54 1046 190158403
HTG55 1014 189831932
HTG56 969 189170679
HTG57 81 14306584
HTG58 1010 189338312
HTG59 1031 189990377
HTG6 1273 185124562
HTG60 1078 187304761
HTG61 1125 188306505
HTG62 988 170992054
HTG63 1085 189487801
HTG64 1064 189415560
HTG65 1169 188798107
HTG66 1179 187545797
HTG67 1282 184397923
HTG68 94 12194080
HTG69 1221 185314622
HTG7 1276 185375030
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187688486
HTG73 1020 170303770
HTG74 1118 188293510
HTG75 1103 190775743
HTG76 1135 190789237
HTG77 1182 190871034
HTG78 1096 185997580
HTG79 1171 190202119
HTG8 1459 184608562
HTG80 1115 190063261
HTG81 1213 189874691
HTG82 1120 189645029
HTG83 959 164682536
HTG84 1229 188409093
HTG85 1250 187741728
HTG86 1141 189879061
HTG87 1144 189686641
HTG88 978 167870813
HTG89 1182 189961005
HTG9 1200 186916809
HTG90 1104 190233697
HTG91 1146 190217975
HTG92 1109 190471215
HTG93 962 159420591
HTG94 1056 190751235
HTG95 1160 190986098
HTG96 1031 189156227
HTG97 1071 189524206
HTG98 685 127675409
HTG99 1018 189641315
INV1 94059 48396887
INV10 83429 65436341
INV11 55199 43691852
INV12 84916 66264500
INV13 80903 66875305
INV14 78427 68092549
INV15 45593 41645518
INV16 33901 110026272
INV17 2719 147711644
INV18 47224 107252219
INV19 77671 55928467
INV2 18237 160904994
INV20 72705 61812950
INV21 32070 20923466
INV22 29034 130890642
INV23 6 133712559
INV24 53497 98450726
INV25 74974 49539047
INV26 72749 48614433
INV27 65391 45829720
INV28 72944 49473879
INV29 74216 50351117
INV3 1552 171465895
INV30 71767 51977441
INV31 72979 54328643
INV32 21284 62977950
INV4 18468 127200084
INV5 79321 72297813
INV6 53678 95054331
INV7 45660 80973767
INV8 80584 71781516
INV9 58779 86173585
MAM1 15747 161936438
MAM2 20070 157345397
MAM3 58725 83076406
MAM4 8463 183606104
MAM5 79465 74721673
MAM6 52693 120143430
MAM7 68665 58457634
PAT1 222542 70116699
PAT10 124452 102575971
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224730 34113420
PAT109 250080 15844360
PAT11 98645 64114703
PAT110 180680 63677151
PAT111 51648 26046194
PAT112 114184 110462046
PAT113 137702 83278366
PAT114 164163 99348600
PAT115 158877 103325984
PAT116 137417 114988187
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142065 62828791
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105888 59875034
PAT130 44618 171217879
PAT131 9167 47581637
PAT132 33645 178334734
PAT133 153558 109675196
PAT134 178705 90913377
PAT135 136049 115324159
PAT136 120392 123342367
PAT137 145328 106668228
PAT138 194528 83838395
PAT139 156835 54970078
PAT14 103642 50160321
PAT140 203662 47737230
PAT141 277828 9627968
PAT142 220409 46465135
PAT143 106719 2881142
PAT144 270386 21672571
PAT145 186751 61239638
PAT146 109799 106056597
PAT147 47518 9550821
PAT148 87299 88249520
PAT149 78465 95588128
PAT15 121148 53317075
PAT150 145200 77694852
PAT151 167499 71382671
PAT152 121465 92942668
PAT153 102978 85383928
PAT154 165566 46016231
PAT155 270022 5130418
PAT156 269978 5129582
PAT157 269978 5129582
PAT158 237888 4519872
PAT159 269396 5118524
PAT16 113137 61274458
PAT160 235480 25575098
PAT161 203734 47154417
PAT162 12033 422577
PAT163 165317 74871979
PAT164 91686 126656173
PAT165 172588 71662855
PAT166 137862 72260487
PAT167 9532 13982682
PAT168 93111 87244841
PAT169 91681 79829797
PAT17 39159 16235508
PAT170 83213 91467896
PAT171 109150 53717368
PAT172 153919 65291773
PAT173 86670 129668912
PAT174 159700 78661295
PAT175 210493 49060830
PAT176 80131 35859203
PAT18 146771 52594264
PAT19 153705 78039102
PAT2 194544 84644913
PAT20 104995 118172564
PAT21 133550 95503155
PAT22 84598 79322013
PAT23 123563 103405415
PAT24 119415 105656371
PAT25 145486 86670068
PAT26 175165 64299073
PAT27 71371 1784275
PAT28 102171 77387698
PAT29 93955 87644560
PAT3 171983 95894231
PAT30 119942 61673191
PAT31 96645 78968068
PAT32 128387 55025904
PAT33 92210 51123413
PAT34 111297 78150994
PAT35 138100 29119820
PAT36 158503 24081830
PAT37 114681 49019496
PAT38 44867 54579973
PAT39 95732 83191686
PAT4 153734 106065135
PAT40 100232 70984798
PAT41 136206 39303264
PAT42 143774 35446826
PAT43 123731 64736974
PAT44 104361 81207665
PAT45 93445 74211542
PAT46 113255 66591457
PAT47 65218 54831902
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57197 23951583
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92812 89404206
PAT59 106517 74781811
PAT6 170642 91909261
PAT60 122361 64031080
PAT61 67425 30297598
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154779 88234702
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131215 96912207
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94633 88060720
PAT83 93689 93464843
PAT84 34072 33980702
PAT85 83459 93185861
PAT86 15570 180450165
PAT87 164898 19209900
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129375 101133373
PAT90 175305 3330795
PAT91 101391 1926429
PAT92 169171 12412246
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140780 2674820
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6423 72279200
PLN1 59913 93482634
PLN10 37424 49321009
PLN11 40275 65683198
PLN12 22518 123856245
PLN13 21104 99666209
PLN14 17578 144865462
PLN15 17634 146278605
PLN16 17564 146392665
PLN17 24636 128667828
PLN18 6000 149205408
PLN19 1266 170315035
PLN2 41477 113964598
PLN20 14134 155912680
PLN21 7126 8366082
PLN22 67254 69760931
PLN23 29374 31573524
PLN24 76954 76377631
PLN25 65428 81394374
PLN26 44750 113980886
PLN27 42 85481108
PLN28 12 89108600
PLN29 1105 146780237
PLN3 1363 176476880
PLN30 26200 129369586
PLN31 53185 99023003
PLN32 74549 77756632
PLN33 96651 54014836
PLN34 80347 71710179
PLN35 77877 75898146
PLN36 79950 70552731
PLN37 82203 75710369
PLN38 57216 30693412
PLN39 101389 57277860
PLN4 1811 185565915
PLN40 80587 70203744
PLN41 46009 98091162
PLN42 28081 123989013
PLN43 25458 130491551
PLN44 55121 53297644
PLN45 81599 72165507
PLN46 61371 82117495
PLN47 54137 88921145
PLN48 85369 61781333
PLN49 93954 60202106
PLN5 1872 194225431
PLN50 72884 80658877
PLN51 72437 77353859
PLN52 68808 81075707
PLN53 26862 49877588
PLN6 1707 194445638
PLN7 24409 142342126
PLN8 74826 76023897
PLN9 73071 75871379
PRI1 23016 59646733
PRI10 1272 179275558
PRI11 775 94029396
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193666240
PRI18 1099 194310776
PRI19 1166 193657185
PRI2 18354 149253110
PRI20 1737 191816982
PRI21 2647 189802739
PRI22 17625 163586937
PRI23 3173 11984370
PRI24 31573 84616058
PRI25 61950 78204817
PRI26 31351 70630978
PRI27 8521 161801360
PRI28 2251 180645625
PRI29 1618 181509288
PRI3 1433 175278790
PRI30 2007 181705860
PRI31 1958 180727178
PRI32 13185 156524900
PRI33 1327 183635528
PRI34 41711 106642910
PRI35 22923 33121498
PRI36 32189 63608729
PRI37 20141 117697460
PRI38 18566 147144620
PRI39 66629 86847693
PRI4 1282 185555745
PRI40 49464 89700608
PRI41 40024 73768288
PRI42 47521 93835974
PRI43 67795 83513418
PRI44 4972 35397688
PRI5 1325 184390308
PRI6 1180 179907324
PRI7 1246 180917243
PRI8 1212 178442526
PRI9 1367 174647124
ROD1 32322 140559255
ROD10 987 181493125
ROD11 233 44199423
ROD12 1034 185475616
ROD13 940 182703335
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185811349
ROD18 1189 190476978
ROD19 16757 152103998
ROD2 915 175347589
ROD20 20349 148361192
ROD21 1132 182075942
ROD22 1079 168189648
ROD23 13589 162647066
ROD24 38849 69271355
ROD25 21814 104561488
ROD26 1508 187599166
ROD27 134649 36929314
ROD28 84568 70051573
ROD29 54095 59941994
ROD3 905 173367450
ROD4 901 173868951
ROD5 922 174254651
ROD6 966 178147126
ROD7 969 179628867
ROD8 979 181288926
ROD9 994 181786834
STS1 85282 36763268
STS10 57907 44420267
STS11 48910 37503235
STS12 57924 43637361
STS13 64284 42850769
STS14 93606 34184225
STS15 104286 26517062
STS16 10116 2741066
STS17 103611 27476228
STS18 86929 34448302
STS19 99733 33367597
STS2 84354 49850025
STS20 54905 20993492
STS3 66846 26362760
STS4 76989 36945836
STS5 8457 4958885
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55716 37767321
SYN1 42894 77043743
SYN2 49369 68197252
SYN3 11060 160003305
SYN4 4598 176515018
SYN5 4597 176510678
SYN6 4600 176564711
SYN7 4935 89358939
TSA1 120472 38235688
TSA10 110716 38093008
TSA11 93519 31664452
TSA12 49774 16702893
TSA13 86486 70566494
TSA14 121991 38853496
TSA15 134870 35826510
TSA16 61036 79698424
TSA17 39468 53516874
TSA18 70282 97466599
TSA19 100897 57123531
TSA2 113532 41666458
TSA20 110668 52338593
TSA21 102984 53513191
TSA22 103695 52518403
TSA23 100966 47107597
TSA24 10786 6455891
TSA25 66573 59369298
TSA26 90250 62317379
TSA27 90395 75445863
TSA28 81291 75040690
TSA29 113045 34907447
TSA3 110396 41019325
TSA30 105614 51695041
TSA31 43017 35545468
TSA32 94911 35699810
TSA33 83189 31995816
TSA34 110188 45124503
TSA35 114753 50951737
TSA36 103616 51971055
TSA37 100113 56421822
TSA38 94610 65146277
TSA39 94206 69996985
TSA4 110949 45737681
TSA40 7055 1920813
TSA41 91162 71943438
TSA42 97632 54700174
TSA43 63268 108247018
TSA44 90001 77844852
TSA45 89354 65966978
TSA46 86091 70560990
TSA47 76126 81240833
TSA48 27636 46693467
TSA49 89053 69490190
TSA5 43179 10927440
TSA50 75197 86012084
TSA51 73336 77189655
TSA52 88447 82170809
TSA53 64240 55971265
TSA54 88125 71940981
TSA55 90060 61508710
TSA56 78421 64921397
TSA57 108348 55434079
TSA58 92473 70373420
TSA59 94134 67718698
TSA6 112457 59449948
TSA60 55678 33925708
TSA7 95611 66253193
TSA8 105744 68773673
TSA9 105928 64845351
UNA1 238 125011
VRL1 67973 69334298
VRL10 61479 73561886
VRL11 25765 35681026
VRL12 62855 71152830
VRL13 57454 72787679
VRL14 63149 65193531
VRL15 57236 73370379
VRL16 57393 72403942
VRL17 57536 70967409
VRL18 58694 70357115
VRL19 61263 73409674
VRL2 73737 64144158
VRL20 10812 12554762
VRL3 69768 60851812
VRL4 68088 70040296
VRL5 48765 50727434
VRL6 48246 77523717
VRL7 47335 73299592
VRL8 62471 72329298
VRL9 69479 65994181
VRT1 40667 125390402
VRT10 1256 189144082
VRT11 8274 177844568
VRT12 3994 136790703
VRT13 13095 170781188
VRT14 5348 182619924
VRT15 3936 185905956
VRT16 37546 134661134
VRT17 79796 68486448
VRT18 78306 66439671
VRT19 30899 24950660
VRT2 3070 191484928
VRT20 70811 78359924
VRT21 47915 119146766
VRT22 77099 61957992
VRT23 76958 60744256
VRT24 80384 56136305
VRT25 44908 32599334
VRT3 70669 80189950
VRT4 8525 169594661
VRT5 31214 25805956
VRT6 73011 66719150
VRT7 31732 63525748
VRT8 30652 111958169
VRT9 1202 189984871
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 188.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
19582406 16002319789 Homo sapiens
9695748 9971977248 Mus musculus
2187673 6510998499 Rattus norvegicus
2200084 5384097980 Bos taurus
3932728 5060067429 Zea mays
3240128 4856506514 Sus scrofa
1712904 3123664987 Danio rerio
228318 1352992214 Strongylocentrotus purpuratus
1347700 1253704507 Oryza sativa Japonica Group
1774046 1197044510 Nicotiana tabacum
1424380 1147262471 Xenopus (Silurana) tropicalis
2322720 1141194178 Arabidopsis thaliana
1228416 1083707483 Drosophila melanogaster
216591 1008241510 Pan troglodytes
766599 998751743 Vitis vinifera
1455382 949215720 Canis lupus familiaris
1902683 906453528 Glycine max
814788 899129094 Gallus gallus
739316 841558162 Solanum lycopersicum
83784 830464032 Macaca mulatta
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 188.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
February 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 188.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
