Release Notes For GenBank Release 189

GBREL.TXT          Genetic Sequence Data Bank
                         April 15 2012

               NCBI-GenBank Flat File Release 189.0

                    Distribution Release Notes

 151824421 loci, 139266481398 bases, from 151824421 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 189.0
1.2 Cutoff Date
1.3 Important Changes in Release 189.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 189.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 189.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 189.0, incorporates data available to the collaborating
databases as of April 15, 2012 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 189.0

1.3.1 Extension of position syntax for /anticodon qualifiers

  Starting with the April 2012 GenBank Release 189.0, the format
of the /anticodon qualifier has been extended to allow the use
of join() and complement() for the location of a tRNA's anticodon.

  Currently, the qualifier supports only a simple continuous
basepair range. For example:

	 /anticodon=(pos:34..36,aa:Phe)

  But there are rare cases of intron-containing tRNAs, for which a
simple X..Y location will not suffice:

     tRNA            join(<1..5,495..544)
                     /gene="trnL"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /anticodon=(pos:join(5,495..496),aa:Leu)

  To support cases like these, the "pos" field is now allowed to make
use of the join() and complement() location operators. Anticodons are
usually three (sometimes four) bases in length, and this *remains*
true even though the join() operator could theoretically be (mis)used
to assert a much more complex/larger location than that.

1.3.2 New representation for Transcriptome Shotgun Assembly (TSA) records.

  The TSA division of GenBank (see http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genbank/tsa
for details) has grown much more quickly than expected. To accommodate the
increasing TSA submission volume, GenBank plans to use a WGS-like approach
for TSA sequencing projects. It is likely that we will start to provide
TSA project data in the new format *prior* to Release 190.0 in June 2012.

  TSA projects will be assigned a four-letter project code, starting with
the letter "G" (for example, GAAA). Individual mRNA sequences within a 
project will make use of the 4+2+6 accession number convention, familiar
to users of WGS data (for example, GAAA01000001). Unlike WGS, re-assembly
of the mRNAs for a TSA sequencing project is expected to be a very rare
occurrence, and we expect that the 2-digit assembly-version number will
almost always be "01" for TSA mRNAs. Similar to WGS, a TSA master record
will provide a convenient overview of a TSA project, with an 'all-zeroes'
accession number (eg: GAAA00000000) . 

  TSA projects that make use of this new representation will be provided
in a separate FTP directory at the NCBI FTP site: genbank/tsa . And like
WGS, the various data files for a TSA project will be grouped by the
4-letter project code, and they will be updated independently of the
GenBank release cycle.

  Plans aren't yet finalized for the 5.2 million TSA records currently
provided in the divisional gbtsa* files of a GenBank release. Ideally,
all would be converted to the new WGS-like representation, so that all 
TSA records in GenBank utilize a common approach. However, the resources
for such a conversion might not be readily available, in which case
older/legacy TSA records might remain as they are now.

  Further details about this new approach for handling TSA data will be
made available via these release notes and the GenBank newsgroup, as we
get closer to implementation. 

1.3.3 Organizational changes

The total number of sequence data files increased by 28 with this release:

  - the BCT division is now composed of  85 files (+3)
  - the CON division is now composed of 167 files (+1)
  - the ENV division is now composed of  53 files (+3)
  - the EST division is now composed of 461 files (+6)
  - the INV division is now composed of  30 files (-2)
  - the MAM division is now composed of   8 files (+1)
  - the PAT division is now composed of 178 files (+2)
  - the PLN division is now composed of  55 files (+2)
  - the PRI division is now composed of  45 files (+1)
  - the TSA division is now composed of  70 files (+10)
  - the VRT division is now composed of  26 files (+1)

The decrease in the number of INV-division files was a consequence of
the removal of approximately 340,000 BarCode sequence records that
lacked tentative taxonomic identification, and hence did not satisfy the
terms of the iBOL/GenBank early-release agreement.

The total number of 'index' files increased by 1 with this release:

  - the AUT (author name)  index is now composed of 97 files (+1)

1.3.4 Project DBLINKs transitioning to BioProject

  The Genome Project Database resource at the NCBI was redesigned in
recent months, culminating in the implementation of a new BioProject
resource:

        http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

An article that describes the goals of BioProject is available:

        http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54015/

BioProject is a collaborative effort of the International Nucleotide
Sequence Database Collaboration (INSDC), and project data are exchanged 
with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject
website is also available at DDBJ:

        http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml

BioProjects are uniquely identified by BioProject Accession Numbers,
which utilize this format:

        "PRJ"
        "E" or "N" or "D"
        one letter
        one or more digits

Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 .

With BioProject now in operation, we are preparing to implement links
from sequence records to the new resource. Previously, links to the
Genome Project Database were provided by numeric 'Project' DBLINKs .
Here's an example for a bacterial complete-genome record:

LOCUS       CP002497             1110245 bp    DNA     linear   PLN 14-NOV-2011
DEFINITION  Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
            sequence.
ACCESSION   CP002497
VERSION     CP002497.1  GI:356887709
DBLINK      Project: 60715

When this link is switched to a BioProject accession, the DBLINK line
will change slightly:

LOCUS       CP002497             1110245 bp    DNA     linear   PLN 14-NOV-2011
DEFINITION  Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
            sequence.
ACCESSION   CP002497
VERSION     CP002497.1  GI:356887709
DBLINK      BioProject: PRJNA60715

In the coming months, many millions of sequence records will gradually
be modified, to make use of the new BioProject DBLINK. These modifications
will not be distributed via daily GenBank and RefSeq incremental-update
products.

However, the new BioProject links are gradually appearing on newly
submitted sequence records, and were present in GenBank and RefSeq
release and incremental-update products starting in December 2011.
In addition, the new BioProject links are visible via NCBI's Entrez:Nucleotide
resource.

1.3.5 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.6 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 189.0. Consider gbgss153.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                           April 15 2012

                NCBI-GenBank Flat File Release 189.0

                           GSS Sequences (Part 1)

   87113 loci,    63992234 bases, from    87113 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "153" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.2 New /pseudogene qualifier; /pseudo will be deprecated

  A new controlled-vocabulary /pseudogene qualifier has been under
discussion within the INSDC since the last collaborative INSD meeting
in May 2011. The goal of the new qualifier is to use it for the annotation
of certain well-defined classes of pseudogenes. And at the same time,
to cease using the poorly-defined /pseudo qualifier, which has been
used for a variety of different situations by each INSDC member.

  Although a formal definition of /pseudogene is not yet available, we
do have a tentative list of the values for the new qualifier:

"processed" - the pseudogene has arisen by reverse
transcription of a mRNA into cDNA, followed by reintegration into the
genome. Therefore, it has lost any intron/exon structure, and it will
have a pseudo-polyA-tail (if a young pseudogene).

"unprocessed" - the pseudogene has arisen from a copy of
the parent gene by means other than reverse transcription. This covers
usually duplication (transposition [not retrotransposition] and perhaps
recombination) followed by accumulation of random mutation. The changes,
compared to their functional homolog, include insertion, deletions,
premature stop codons, frameshifts and a higher proportion of
non-synonymous versus synonymous substitutions.

"unitary" - the pseudogene has no parent. It is the
original gene, which is functional is some species but disrupted in some
way (indels, mutation, recombination) in another species or strain. In a
lot of cases, such changes would kill the organism, particularly with
house-keeping genes.

"allelic" - a (unitary) pseudogene that is stable in the
population but importantly it has a functional alternative allele also
in the population. i.e., one strain may have the gene, another strain
may have the pseudogene. MHC haplotypes have allelic pseudogenes.

"unknown" - would imply that the submitter does not know
the method of pseudogenisation

  If a final definition of /pseudogene can be arrived at within the
next few weeks, then the new qualifier would be legal as of GenBank
Release 190.0 in June of 2012. We will keep users posted about this
new qualifier via the GenBank newsgroup and these release notes.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1790 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbaut93.idx - Index of the entries according to author name, part 93.
97. gbaut94.idx - Index of the entries according to author name, part 94.
98. gbaut95.idx - Index of the entries according to author name, part 95.
99. gbaut96.idx - Index of the entries according to author name, part 96.
100. gbaut97.idx - Index of the entries according to author name, part 97.
101. gbbct1.seq - Bacterial sequence entries, part 1.
102. gbbct10.seq - Bacterial sequence entries, part 10.
103. gbbct11.seq - Bacterial sequence entries, part 11.
104. gbbct12.seq - Bacterial sequence entries, part 12.
105. gbbct13.seq - Bacterial sequence entries, part 13.
106. gbbct14.seq - Bacterial sequence entries, part 14.
107. gbbct15.seq - Bacterial sequence entries, part 15.
108. gbbct16.seq - Bacterial sequence entries, part 16.
109. gbbct17.seq - Bacterial sequence entries, part 17.
110. gbbct18.seq - Bacterial sequence entries, part 18.
111. gbbct19.seq - Bacterial sequence entries, part 19.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct21.seq - Bacterial sequence entries, part 21.
115. gbbct22.seq - Bacterial sequence entries, part 22.
116. gbbct23.seq - Bacterial sequence entries, part 23.
117. gbbct24.seq - Bacterial sequence entries, part 24.
118. gbbct25.seq - Bacterial sequence entries, part 25.
119. gbbct26.seq - Bacterial sequence entries, part 26.
120. gbbct27.seq - Bacterial sequence entries, part 27.
121. gbbct28.seq - Bacterial sequence entries, part 28.
122. gbbct29.seq - Bacterial sequence entries, part 29.
123. gbbct3.seq - Bacterial sequence entries, part 3.
124. gbbct30.seq - Bacterial sequence entries, part 30.
125. gbbct31.seq - Bacterial sequence entries, part 31.
126. gbbct32.seq - Bacterial sequence entries, part 32.
127. gbbct33.seq - Bacterial sequence entries, part 33.
128. gbbct34.seq - Bacterial sequence entries, part 34.
129. gbbct35.seq - Bacterial sequence entries, part 35.
130. gbbct36.seq - Bacterial sequence entries, part 36.
131. gbbct37.seq - Bacterial sequence entries, part 37.
132. gbbct38.seq - Bacterial sequence entries, part 38.
133. gbbct39.seq - Bacterial sequence entries, part 39.
134. gbbct4.seq - Bacterial sequence entries, part 4.
135. gbbct40.seq - Bacterial sequence entries, part 40.
136. gbbct41.seq - Bacterial sequence entries, part 41.
137. gbbct42.seq - Bacterial sequence entries, part 42.
138. gbbct43.seq - Bacterial sequence entries, part 43.
139. gbbct44.seq - Bacterial sequence entries, part 44.
140. gbbct45.seq - Bacterial sequence entries, part 45.
141. gbbct46.seq - Bacterial sequence entries, part 46.
142. gbbct47.seq - Bacterial sequence entries, part 47.
143. gbbct48.seq - Bacterial sequence entries, part 48.
144. gbbct49.seq - Bacterial sequence entries, part 49.
145. gbbct5.seq - Bacterial sequence entries, part 5.
146. gbbct50.seq - Bacterial sequence entries, part 50.
147. gbbct51.seq - Bacterial sequence entries, part 51.
148. gbbct52.seq - Bacterial sequence entries, part 52.
149. gbbct53.seq - Bacterial sequence entries, part 53.
150. gbbct54.seq - Bacterial sequence entries, part 54.
151. gbbct55.seq - Bacterial sequence entries, part 55.
152. gbbct56.seq - Bacterial sequence entries, part 56.
153. gbbct57.seq - Bacterial sequence entries, part 57.
154. gbbct58.seq - Bacterial sequence entries, part 58.
155. gbbct59.seq - Bacterial sequence entries, part 59.
156. gbbct6.seq - Bacterial sequence entries, part 6.
157. gbbct60.seq - Bacterial sequence entries, part 60.
158. gbbct61.seq - Bacterial sequence entries, part 61.
159. gbbct62.seq - Bacterial sequence entries, part 62.
160. gbbct63.seq - Bacterial sequence entries, part 63.
161. gbbct64.seq - Bacterial sequence entries, part 64.
162. gbbct65.seq - Bacterial sequence entries, part 65.
163. gbbct66.seq - Bacterial sequence entries, part 66.
164. gbbct67.seq - Bacterial sequence entries, part 67.
165. gbbct68.seq - Bacterial sequence entries, part 68.
166. gbbct69.seq - Bacterial sequence entries, part 69.
167. gbbct7.seq - Bacterial sequence entries, part 7.
168. gbbct70.seq - Bacterial sequence entries, part 70.
169. gbbct71.seq - Bacterial sequence entries, part 71.
170. gbbct72.seq - Bacterial sequence entries, part 72.
171. gbbct73.seq - Bacterial sequence entries, part 73.
172. gbbct74.seq - Bacterial sequence entries, part 74.
173. gbbct75.seq - Bacterial sequence entries, part 75.
174. gbbct76.seq - Bacterial sequence entries, part 76.
175. gbbct77.seq - Bacterial sequence entries, part 77.
176. gbbct78.seq - Bacterial sequence entries, part 78.
177. gbbct79.seq - Bacterial sequence entries, part 79.
178. gbbct8.seq - Bacterial sequence entries, part 8.
179. gbbct80.seq - Bacterial sequence entries, part 80.
180. gbbct81.seq - Bacterial sequence entries, part 81.
181. gbbct82.seq - Bacterial sequence entries, part 82.
182. gbbct83.seq - Bacterial sequence entries, part 83.
183. gbbct84.seq - Bacterial sequence entries, part 84.
184. gbbct85.seq - Bacterial sequence entries, part 85.
185. gbbct9.seq - Bacterial sequence entries, part 9.
186. gbchg.txt - Accession numbers of entries updated since the previous release.
187. gbcon1.seq - Constructed sequence entries, part 1.
188. gbcon10.seq - Constructed sequence entries, part 10.
189. gbcon100.seq - Constructed sequence entries, part 100.
190. gbcon101.seq - Constructed sequence entries, part 101.
191. gbcon102.seq - Constructed sequence entries, part 102.
192. gbcon103.seq - Constructed sequence entries, part 103.
193. gbcon104.seq - Constructed sequence entries, part 104.
194. gbcon105.seq - Constructed sequence entries, part 105.
195. gbcon106.seq - Constructed sequence entries, part 106.
196. gbcon107.seq - Constructed sequence entries, part 107.
197. gbcon108.seq - Constructed sequence entries, part 108.
198. gbcon109.seq - Constructed sequence entries, part 109.
199. gbcon11.seq - Constructed sequence entries, part 11.
200. gbcon110.seq - Constructed sequence entries, part 110.
201. gbcon111.seq - Constructed sequence entries, part 111.
202. gbcon112.seq - Constructed sequence entries, part 112.
203. gbcon113.seq - Constructed sequence entries, part 113.
204. gbcon114.seq - Constructed sequence entries, part 114.
205. gbcon115.seq - Constructed sequence entries, part 115.
206. gbcon116.seq - Constructed sequence entries, part 116.
207. gbcon117.seq - Constructed sequence entries, part 117.
208. gbcon118.seq - Constructed sequence entries, part 118.
209. gbcon119.seq - Constructed sequence entries, part 119.
210. gbcon12.seq - Constructed sequence entries, part 12.
211. gbcon120.seq - Constructed sequence entries, part 120.
212. gbcon121.seq - Constructed sequence entries, part 121.
213. gbcon122.seq - Constructed sequence entries, part 122.
214. gbcon123.seq - Constructed sequence entries, part 123.
215. gbcon124.seq - Constructed sequence entries, part 124.
216. gbcon125.seq - Constructed sequence entries, part 125.
217. gbcon126.seq - Constructed sequence entries, part 126.
218. gbcon127.seq - Constructed sequence entries, part 127.
219. gbcon128.seq - Constructed sequence entries, part 128.
220. gbcon129.seq - Constructed sequence entries, part 129.
221. gbcon13.seq - Constructed sequence entries, part 13.
222. gbcon130.seq - Constructed sequence entries, part 130.
223. gbcon131.seq - Constructed sequence entries, part 131.
224. gbcon132.seq - Constructed sequence entries, part 132.
225. gbcon133.seq - Constructed sequence entries, part 133.
226. gbcon134.seq - Constructed sequence entries, part 134.
227. gbcon135.seq - Constructed sequence entries, part 135.
228. gbcon136.seq - Constructed sequence entries, part 136.
229. gbcon137.seq - Constructed sequence entries, part 137.
230. gbcon138.seq - Constructed sequence entries, part 138.
231. gbcon139.seq - Constructed sequence entries, part 139.
232. gbcon14.seq - Constructed sequence entries, part 14.
233. gbcon140.seq - Constructed sequence entries, part 140.
234. gbcon141.seq - Constructed sequence entries, part 141.
235. gbcon142.seq - Constructed sequence entries, part 142.
236. gbcon143.seq - Constructed sequence entries, part 143.
237. gbcon144.seq - Constructed sequence entries, part 144.
238. gbcon145.seq - Constructed sequence entries, part 145.
239. gbcon146.seq - Constructed sequence entries, part 146.
240. gbcon147.seq - Constructed sequence entries, part 147.
241. gbcon148.seq - Constructed sequence entries, part 148.
242. gbcon149.seq - Constructed sequence entries, part 149.
243. gbcon15.seq - Constructed sequence entries, part 15.
244. gbcon150.seq - Constructed sequence entries, part 150.
245. gbcon151.seq - Constructed sequence entries, part 151.
246. gbcon152.seq - Constructed sequence entries, part 152.
247. gbcon153.seq - Constructed sequence entries, part 153.
248. gbcon154.seq - Constructed sequence entries, part 154.
249. gbcon155.seq - Constructed sequence entries, part 155.
250. gbcon156.seq - Constructed sequence entries, part 156.
251. gbcon157.seq - Constructed sequence entries, part 157.
252. gbcon158.seq - Constructed sequence entries, part 158.
253. gbcon159.seq - Constructed sequence entries, part 159.
254. gbcon16.seq - Constructed sequence entries, part 16.
255. gbcon160.seq - Constructed sequence entries, part 160.
256. gbcon161.seq - Constructed sequence entries, part 161.
257. gbcon162.seq - Constructed sequence entries, part 162.
258. gbcon163.seq - Constructed sequence entries, part 163.
259. gbcon164.seq - Constructed sequence entries, part 164.
260. gbcon165.seq - Constructed sequence entries, part 165.
261. gbcon166.seq - Constructed sequence entries, part 166.
262. gbcon167.seq - Constructed sequence entries, part 167.
263. gbcon17.seq - Constructed sequence entries, part 17.
264. gbcon18.seq - Constructed sequence entries, part 18.
265. gbcon19.seq - Constructed sequence entries, part 19.
266. gbcon2.seq - Constructed sequence entries, part 2.
267. gbcon20.seq - Constructed sequence entries, part 20.
268. gbcon21.seq - Constructed sequence entries, part 21.
269. gbcon22.seq - Constructed sequence entries, part 22.
270. gbcon23.seq - Constructed sequence entries, part 23.
271. gbcon24.seq - Constructed sequence entries, part 24.
272. gbcon25.seq - Constructed sequence entries, part 25.
273. gbcon26.seq - Constructed sequence entries, part 26.
274. gbcon27.seq - Constructed sequence entries, part 27.
275. gbcon28.seq - Constructed sequence entries, part 28.
276. gbcon29.seq - Constructed sequence entries, part 29.
277. gbcon3.seq - Constructed sequence entries, part 3.
278. gbcon30.seq - Constructed sequence entries, part 30.
279. gbcon31.seq - Constructed sequence entries, part 31.
280. gbcon32.seq - Constructed sequence entries, part 32.
281. gbcon33.seq - Constructed sequence entries, part 33.
282. gbcon34.seq - Constructed sequence entries, part 34.
283. gbcon35.seq - Constructed sequence entries, part 35.
284. gbcon36.seq - Constructed sequence entries, part 36.
285. gbcon37.seq - Constructed sequence entries, part 37.
286. gbcon38.seq - Constructed sequence entries, part 38.
287. gbcon39.seq - Constructed sequence entries, part 39.
288. gbcon4.seq - Constructed sequence entries, part 4.
289. gbcon40.seq - Constructed sequence entries, part 40.
290. gbcon41.seq - Constructed sequence entries, part 41.
291. gbcon42.seq - Constructed sequence entries, part 42.
292. gbcon43.seq - Constructed sequence entries, part 43.
293. gbcon44.seq - Constructed sequence entries, part 44.
294. gbcon45.seq - Constructed sequence entries, part 45.
295. gbcon46.seq - Constructed sequence entries, part 46.
296. gbcon47.seq - Constructed sequence entries, part 47.
297. gbcon48.seq - Constructed sequence entries, part 48.
298. gbcon49.seq - Constructed sequence entries, part 49.
299. gbcon5.seq - Constructed sequence entries, part 5.
300. gbcon50.seq - Constructed sequence entries, part 50.
301. gbcon51.seq - Constructed sequence entries, part 51.
302. gbcon52.seq - Constructed sequence entries, part 52.
303. gbcon53.seq - Constructed sequence entries, part 53.
304. gbcon54.seq - Constructed sequence entries, part 54.
305. gbcon55.seq - Constructed sequence entries, part 55.
306. gbcon56.seq - Constructed sequence entries, part 56.
307. gbcon57.seq - Constructed sequence entries, part 57.
308. gbcon58.seq - Constructed sequence entries, part 58.
309. gbcon59.seq - Constructed sequence entries, part 59.
310. gbcon6.seq - Constructed sequence entries, part 6.
311. gbcon60.seq - Constructed sequence entries, part 60.
312. gbcon61.seq - Constructed sequence entries, part 61.
313. gbcon62.seq - Constructed sequence entries, part 62.
314. gbcon63.seq - Constructed sequence entries, part 63.
315. gbcon64.seq - Constructed sequence entries, part 64.
316. gbcon65.seq - Constructed sequence entries, part 65.
317. gbcon66.seq - Constructed sequence entries, part 66.
318. gbcon67.seq - Constructed sequence entries, part 67.
319. gbcon68.seq - Constructed sequence entries, part 68.
320. gbcon69.seq - Constructed sequence entries, part 69.
321. gbcon7.seq - Constructed sequence entries, part 7.
322. gbcon70.seq - Constructed sequence entries, part 70.
323. gbcon71.seq - Constructed sequence entries, part 71.
324. gbcon72.seq - Constructed sequence entries, part 72.
325. gbcon73.seq - Constructed sequence entries, part 73.
326. gbcon74.seq - Constructed sequence entries, part 74.
327. gbcon75.seq - Constructed sequence entries, part 75.
328. gbcon76.seq - Constructed sequence entries, part 76.
329. gbcon77.seq - Constructed sequence entries, part 77.
330. gbcon78.seq - Constructed sequence entries, part 78.
331. gbcon79.seq - Constructed sequence entries, part 79.
332. gbcon8.seq - Constructed sequence entries, part 8.
333. gbcon80.seq - Constructed sequence entries, part 80.
334. gbcon81.seq - Constructed sequence entries, part 81.
335. gbcon82.seq - Constructed sequence entries, part 82.
336. gbcon83.seq - Constructed sequence entries, part 83.
337. gbcon84.seq - Constructed sequence entries, part 84.
338. gbcon85.seq - Constructed sequence entries, part 85.
339. gbcon86.seq - Constructed sequence entries, part 86.
340. gbcon87.seq - Constructed sequence entries, part 87.
341. gbcon88.seq - Constructed sequence entries, part 88.
342. gbcon89.seq - Constructed sequence entries, part 89.
343. gbcon9.seq - Constructed sequence entries, part 9.
344. gbcon90.seq - Constructed sequence entries, part 90.
345. gbcon91.seq - Constructed sequence entries, part 91.
346. gbcon92.seq - Constructed sequence entries, part 92.
347. gbcon93.seq - Constructed sequence entries, part 93.
348. gbcon94.seq - Constructed sequence entries, part 94.
349. gbcon95.seq - Constructed sequence entries, part 95.
350. gbcon96.seq - Constructed sequence entries, part 96.
351. gbcon97.seq - Constructed sequence entries, part 97.
352. gbcon98.seq - Constructed sequence entries, part 98.
353. gbcon99.seq - Constructed sequence entries, part 99.
354. gbdel.txt - Accession numbers of entries deleted since the previous release.
355. gbenv1.seq - Environmental sampling sequence entries, part 1.
356. gbenv10.seq - Environmental sampling sequence entries, part 10.
357. gbenv11.seq - Environmental sampling sequence entries, part 11.
358. gbenv12.seq - Environmental sampling sequence entries, part 12.
359. gbenv13.seq - Environmental sampling sequence entries, part 13.
360. gbenv14.seq - Environmental sampling sequence entries, part 14.
361. gbenv15.seq - Environmental sampling sequence entries, part 15.
362. gbenv16.seq - Environmental sampling sequence entries, part 16.
363. gbenv17.seq - Environmental sampling sequence entries, part 17.
364. gbenv18.seq - Environmental sampling sequence entries, part 18.
365. gbenv19.seq - Environmental sampling sequence entries, part 19.
366. gbenv2.seq - Environmental sampling sequence entries, part 2.
367. gbenv20.seq - Environmental sampling sequence entries, part 20.
368. gbenv21.seq - Environmental sampling sequence entries, part 21.
369. gbenv22.seq - Environmental sampling sequence entries, part 22.
370. gbenv23.seq - Environmental sampling sequence entries, part 23.
371. gbenv24.seq - Environmental sampling sequence entries, part 24.
372. gbenv25.seq - Environmental sampling sequence entries, part 25.
373. gbenv26.seq - Environmental sampling sequence entries, part 26.
374. gbenv27.seq - Environmental sampling sequence entries, part 27.
375. gbenv28.seq - Environmental sampling sequence entries, part 28.
376. gbenv29.seq - Environmental sampling sequence entries, part 29.
377. gbenv3.seq - Environmental sampling sequence entries, part 3.
378. gbenv30.seq - Environmental sampling sequence entries, part 30.
379. gbenv31.seq - Environmental sampling sequence entries, part 31.
380. gbenv32.seq - Environmental sampling sequence entries, part 32.
381. gbenv33.seq - Environmental sampling sequence entries, part 33.
382. gbenv34.seq - Environmental sampling sequence entries, part 34.
383. gbenv35.seq - Environmental sampling sequence entries, part 35.
384. gbenv36.seq - Environmental sampling sequence entries, part 36.
385. gbenv37.seq - Environmental sampling sequence entries, part 37.
386. gbenv38.seq - Environmental sampling sequence entries, part 38.
387. gbenv39.seq - Environmental sampling sequence entries, part 39.
388. gbenv4.seq - Environmental sampling sequence entries, part 4.
389. gbenv40.seq - Environmental sampling sequence entries, part 40.
390. gbenv41.seq - Environmental sampling sequence entries, part 41.
391. gbenv42.seq - Environmental sampling sequence entries, part 42.
392. gbenv43.seq - Environmental sampling sequence entries, part 43.
393. gbenv44.seq - Environmental sampling sequence entries, part 44.
394. gbenv45.seq - Environmental sampling sequence entries, part 45.
395. gbenv46.seq - Environmental sampling sequence entries, part 46.
396. gbenv47.seq - Environmental sampling sequence entries, part 47.
397. gbenv48.seq - Environmental sampling sequence entries, part 48.
398. gbenv49.seq - Environmental sampling sequence entries, part 49.
399. gbenv5.seq - Environmental sampling sequence entries, part 5.
400. gbenv50.seq - Environmental sampling sequence entries, part 50.
401. gbenv51.seq - Environmental sampling sequence entries, part 51.
402. gbenv52.seq - Environmental sampling sequence entries, part 52.
403. gbenv53.seq - Environmental sampling sequence entries, part 53.
404. gbenv6.seq - Environmental sampling sequence entries, part 6.
405. gbenv7.seq - Environmental sampling sequence entries, part 7.
406. gbenv8.seq - Environmental sampling sequence entries, part 8.
407. gbenv9.seq - Environmental sampling sequence entries, part 9.
408. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
409. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
410. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
411. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
412. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
413. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
414. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
415. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
416. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
417. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
418. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
419. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
420. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
421. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
422. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
423. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
424. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
425. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
426. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
427. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
428. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
429. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
430. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
431. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
432. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
433. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
434. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
435. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
436. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
437. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
438. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
439. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
440. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
441. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
442. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
443. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
444. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
445. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
446. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
447. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
448. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
449. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
450. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
451. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
452. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
453. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
454. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
455. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
456. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
457. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
458. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
459. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
460. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
461. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
462. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
463. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
464. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
465. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
466. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
467. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
468. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
469. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
470. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
471. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
472. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
473. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
474. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
475. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
476. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
477. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
478. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
479. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
480. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
481. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
482. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
483. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
484. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
485. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
486. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
487. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
488. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
489. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
490. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
491. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
492. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
493. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
494. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
495. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
496. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
497. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
498. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
499. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
500. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
501. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
502. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
503. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
504. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
505. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
506. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
507. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
508. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
509. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
510. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
511. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
512. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
513. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
514. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
515. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
516. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
517. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
518. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
519. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
520. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
521. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
522. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
523. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
524. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
525. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
526. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
527. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
528. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
529. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
530. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
531. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
532. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
533. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
534. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
535. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
536. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
537. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
538. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
539. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
540. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
541. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
542. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
543. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
544. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
545. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
546. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
547. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
548. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
549. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
550. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
551. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
552. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
553. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
554. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
555. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
556. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
557. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
558. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
559. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
560. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
561. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
562. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
563. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
564. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
565. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
566. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
567. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
568. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
569. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
570. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
571. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
572. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
573. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
574. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
575. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
576. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
577. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
578. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
579. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
580. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
581. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
582. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
583. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
584. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
585. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
586. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
587. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
588. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
589. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
590. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
591. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
592. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
593. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
594. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
595. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
596. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
597. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
598. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
599. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
600. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
601. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
602. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
603. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
604. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
605. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
606. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
607. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
608. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
609. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
610. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
611. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
612. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
613. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
614. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
615. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
616. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
617. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
618. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
619. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
620. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
621. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
622. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
623. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
624. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
625. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
626. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
627. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
628. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
629. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
630. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
631. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
632. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
633. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
634. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
635. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
636. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
637. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
638. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
639. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
640. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
641. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
642. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
643. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
644. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
645. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
646. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
647. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
648. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
649. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
650. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
651. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
652. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
653. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
654. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
655. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
656. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
657. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
658. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
659. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
660. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
661. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
662. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
663. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
664. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
665. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
666. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
667. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
668. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
669. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
670. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
671. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
672. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
673. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
674. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
675. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
676. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
677. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
678. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
679. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
680. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
681. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
682. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
683. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
684. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
685. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
686. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
687. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
688. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
689. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
690. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
691. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
692. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
693. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
694. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
695. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
696. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
697. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
698. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
699. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
700. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
701. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
702. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
703. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
704. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
705. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
706. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
707. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
708. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
709. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
710. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
711. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
712. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
713. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
714. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
715. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
716. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
717. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
718. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
719. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
720. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
721. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
722. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
723. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
724. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
725. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
726. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
727. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
728. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
729. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
730. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
731. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
732. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
733. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
734. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
735. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
736. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
737. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
738. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
739. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
740. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
741. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
742. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
743. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
744. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
745. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
746. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
747. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
748. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
749. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
750. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
751. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
752. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
753. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
754. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
755. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
756. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
757. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
758. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
759. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
760. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
761. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
762. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
763. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
764. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
765. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
766. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
767. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
768. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
769. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
770. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
771. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
772. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
773. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
774. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
775. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
776. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
777. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
778. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
779. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
780. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
781. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
782. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
783. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
784. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
785. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
786. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
787. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
788. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
789. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
790. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
791. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
792. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
793. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
794. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
795. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
796. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
797. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
798. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
799. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
800. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
801. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
802. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
803. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
804. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
805. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
806. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
807. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
808. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
809. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
810. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
811. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
812. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
813. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
814. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
815. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
816. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
817. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
818. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
819. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
820. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
821. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
822. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
823. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
824. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
825. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
826. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
827. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
828. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
829. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
830. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
831. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
832. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
833. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
834. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
835. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
836. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
837. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
838. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
839. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
840. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
841. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
842. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
843. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
844. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
845. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
846. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
847. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
848. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
849. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
850. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
851. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
852. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
853. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
854. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
855. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
856. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
857. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
858. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
859. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
860. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
861. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
862. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
863. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
864. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
865. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
866. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
867. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
868. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
869. gbgen.idx - Index of the entries according to gene symbols.
870. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
871. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
872. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
873. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
874. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
875. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
876. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
877. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
878. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
879. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
880. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
881. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
882. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
883. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
884. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
885. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
886. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
887. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
888. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
889. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
890. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
891. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
892. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
893. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
894. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
895. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
896. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
897. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
898. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
899. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
900. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
901. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
902. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
903. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
904. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
905. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
906. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
907. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
908. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
909. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
910. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
911. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
912. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
913. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
914. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
915. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
916. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
917. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
918. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
919. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
920. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
921. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
922. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
923. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
924. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
925. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
926. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
927. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
928. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
929. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
930. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
931. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
932. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
933. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
934. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
935. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
936. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
937. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
938. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
939. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
940. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
941. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
942. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
943. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
944. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
945. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
946. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
947. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
948. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
949. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
950. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
951. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
952. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
953. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
954. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
955. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
956. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
957. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
958. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
959. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
960. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
961. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
962. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
963. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
964. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
965. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
966. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
967. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
968. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
969. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
970. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
971. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
972. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
973. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
974. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
975. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
976. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
977. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
978. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
979. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
980. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
981. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
982. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
983. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
984. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
985. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
986. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
987. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
988. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
989. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
990. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
991. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
992. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
993. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
994. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
995. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
996. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
997. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
998. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
999. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1000. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1001. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1002. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1003. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1004. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1005. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1006. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1007. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1008. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1009. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1010. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1011. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1012. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1013. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1014. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1015. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1016. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1017. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1018. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1019. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1020. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1021. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1022. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1023. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1024. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1025. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1026. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1027. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1028. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1029. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1030. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1031. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1032. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1033. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1034. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1035. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1036. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1037. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1038. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1039. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1040. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1041. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1042. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1043. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1044. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1045. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1046. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1047. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1048. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1049. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1050. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1051. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1052. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1053. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1054. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1055. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1056. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1057. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1058. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1059. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1060. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1061. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1062. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1063. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1064. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1065. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1066. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1067. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1068. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1069. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1070. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1071. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1072. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1073. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1074. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1075. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1076. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1077. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1078. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1079. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1080. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1081. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1082. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1083. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1084. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1085. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1086. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1087. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1088. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1089. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1090. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1091. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1092. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1093. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1094. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1095. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1096. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1097. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1098. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1099. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1100. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1101. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1102. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1103. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1104. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1105. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1106. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1107. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1108. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1109. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1110. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1111. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1112. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1113. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1114. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1115. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1116. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1117. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1118. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1119. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1120. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1121. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1122. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1123. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1124. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1125. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1126. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1127. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1128. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1129. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1130. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1131. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1132. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1133. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1134. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1135. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1136. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1137. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1138. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1139. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1140. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1141. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1142. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1143. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1144. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1145. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1146. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1147. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1148. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1149. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1150. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1151. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1152. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1153. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1154. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1155. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1156. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1157. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1158. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1159. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1160. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1161. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1162. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1163. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1164. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1165. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1166. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1167. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1168. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1169. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1170. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1171. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1172. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1173. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1174. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1175. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1176. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1177. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1178. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1179. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1180. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1181. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1182. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1183. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1184. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1185. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1186. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1187. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1188. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1189. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1190. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1191. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1192. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1193. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1194. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1195. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1196. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1197. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1198. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1199. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1200. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1201. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1202. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1203. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1204. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1205. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1206. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1207. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1208. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1209. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1210. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1211. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1212. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1213. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1214. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1215. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1216. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1217. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1218. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1219. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1220. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1221. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1222. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1223. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1224. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1225. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1226. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1227. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1228. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1229. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1230. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1231. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1232. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1233. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1234. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1235. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1236. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1237. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1238. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1239. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1240. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1241. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1242. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1243. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1244. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1245. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1246. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1247. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1248. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1249. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1250. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1251. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1252. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1253. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1254. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1255. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1256. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1257. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1258. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1259. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1260. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1261. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1262. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1263. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1264. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1265. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1266. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1267. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1268. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1269. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1270. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1271. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1272. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1273. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1274. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1275. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1276. gbinv1.seq - Invertebrate sequence entries, part 1.
1277. gbinv10.seq - Invertebrate sequence entries, part 10.
1278. gbinv11.seq - Invertebrate sequence entries, part 11.
1279. gbinv12.seq - Invertebrate sequence entries, part 12.
1280. gbinv13.seq - Invertebrate sequence entries, part 13.
1281. gbinv14.seq - Invertebrate sequence entries, part 14.
1282. gbinv15.seq - Invertebrate sequence entries, part 15.
1283. gbinv16.seq - Invertebrate sequence entries, part 16.
1284. gbinv17.seq - Invertebrate sequence entries, part 17.
1285. gbinv18.seq - Invertebrate sequence entries, part 18.
1286. gbinv19.seq - Invertebrate sequence entries, part 19.
1287. gbinv2.seq - Invertebrate sequence entries, part 2.
1288. gbinv20.seq - Invertebrate sequence entries, part 20.
1289. gbinv21.seq - Invertebrate sequence entries, part 21.
1290. gbinv22.seq - Invertebrate sequence entries, part 22.
1291. gbinv23.seq - Invertebrate sequence entries, part 23.
1292. gbinv24.seq - Invertebrate sequence entries, part 24.
1293. gbinv25.seq - Invertebrate sequence entries, part 25.
1294. gbinv26.seq - Invertebrate sequence entries, part 26.
1295. gbinv27.seq - Invertebrate sequence entries, part 27.
1296. gbinv28.seq - Invertebrate sequence entries, part 28.
1297. gbinv29.seq - Invertebrate sequence entries, part 29.
1298. gbinv3.seq - Invertebrate sequence entries, part 3.
1299. gbinv30.seq - Invertebrate sequence entries, part 30.
1300. gbinv4.seq - Invertebrate sequence entries, part 4.
1301. gbinv5.seq - Invertebrate sequence entries, part 5.
1302. gbinv6.seq - Invertebrate sequence entries, part 6.
1303. gbinv7.seq - Invertebrate sequence entries, part 7.
1304. gbinv8.seq - Invertebrate sequence entries, part 8.
1305. gbinv9.seq - Invertebrate sequence entries, part 9.
1306. gbjou1.idx - Index of the entries according to journal citation, part 1.
1307. gbjou10.idx - Index of the entries according to journal citation, part 10.
1308. gbjou11.idx - Index of the entries according to journal citation, part 11.
1309. gbjou12.idx - Index of the entries according to journal citation, part 12.
1310. gbjou13.idx - Index of the entries according to journal citation, part 13.
1311. gbjou2.idx - Index of the entries according to journal citation, part 2.
1312. gbjou3.idx - Index of the entries according to journal citation, part 3.
1313. gbjou4.idx - Index of the entries according to journal citation, part 4.
1314. gbjou5.idx - Index of the entries according to journal citation, part 5.
1315. gbjou6.idx - Index of the entries according to journal citation, part 6.
1316. gbjou7.idx - Index of the entries according to journal citation, part 7.
1317. gbjou8.idx - Index of the entries according to journal citation, part 8.
1318. gbjou9.idx - Index of the entries according to journal citation, part 9.
1319. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1320. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1321. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1322. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1323. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1324. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1325. gbmam1.seq - Other mammalian sequence entries, part 1.
1326. gbmam2.seq - Other mammalian sequence entries, part 2.
1327. gbmam3.seq - Other mammalian sequence entries, part 3.
1328. gbmam4.seq - Other mammalian sequence entries, part 4.
1329. gbmam5.seq - Other mammalian sequence entries, part 5.
1330. gbmam6.seq - Other mammalian sequence entries, part 6.
1331. gbmam7.seq - Other mammalian sequence entries, part 7.
1332. gbmam8.seq - Other mammalian sequence entries, part 8.
1333. gbnew.txt - Accession numbers of entries new since the previous release.
1334. gbpat1.seq - Patent sequence entries, part 1.
1335. gbpat10.seq - Patent sequence entries, part 10.
1336. gbpat100.seq - Patent sequence entries, part 100.
1337. gbpat101.seq - Patent sequence entries, part 101.
1338. gbpat102.seq - Patent sequence entries, part 102.
1339. gbpat103.seq - Patent sequence entries, part 103.
1340. gbpat104.seq - Patent sequence entries, part 104.
1341. gbpat105.seq - Patent sequence entries, part 105.
1342. gbpat106.seq - Patent sequence entries, part 106.
1343. gbpat107.seq - Patent sequence entries, part 107.
1344. gbpat108.seq - Patent sequence entries, part 108.
1345. gbpat109.seq - Patent sequence entries, part 109.
1346. gbpat11.seq - Patent sequence entries, part 11.
1347. gbpat110.seq - Patent sequence entries, part 110.
1348. gbpat111.seq - Patent sequence entries, part 111.
1349. gbpat112.seq - Patent sequence entries, part 112.
1350. gbpat113.seq - Patent sequence entries, part 113.
1351. gbpat114.seq - Patent sequence entries, part 114.
1352. gbpat115.seq - Patent sequence entries, part 115.
1353. gbpat116.seq - Patent sequence entries, part 116.
1354. gbpat117.seq - Patent sequence entries, part 117.
1355. gbpat118.seq - Patent sequence entries, part 118.
1356. gbpat119.seq - Patent sequence entries, part 119.
1357. gbpat12.seq - Patent sequence entries, part 12.
1358. gbpat120.seq - Patent sequence entries, part 120.
1359. gbpat121.seq - Patent sequence entries, part 121.
1360. gbpat122.seq - Patent sequence entries, part 122.
1361. gbpat123.seq - Patent sequence entries, part 123.
1362. gbpat124.seq - Patent sequence entries, part 124.
1363. gbpat125.seq - Patent sequence entries, part 125.
1364. gbpat126.seq - Patent sequence entries, part 126.
1365. gbpat127.seq - Patent sequence entries, part 127.
1366. gbpat128.seq - Patent sequence entries, part 128.
1367. gbpat129.seq - Patent sequence entries, part 129.
1368. gbpat13.seq - Patent sequence entries, part 13.
1369. gbpat130.seq - Patent sequence entries, part 130.
1370. gbpat131.seq - Patent sequence entries, part 131.
1371. gbpat132.seq - Patent sequence entries, part 132.
1372. gbpat133.seq - Patent sequence entries, part 133.
1373. gbpat134.seq - Patent sequence entries, part 134.
1374. gbpat135.seq - Patent sequence entries, part 135.
1375. gbpat136.seq - Patent sequence entries, part 136.
1376. gbpat137.seq - Patent sequence entries, part 137.
1377. gbpat138.seq - Patent sequence entries, part 138.
1378. gbpat139.seq - Patent sequence entries, part 139.
1379. gbpat14.seq - Patent sequence entries, part 14.
1380. gbpat140.seq - Patent sequence entries, part 140.
1381. gbpat141.seq - Patent sequence entries, part 141.
1382. gbpat142.seq - Patent sequence entries, part 142.
1383. gbpat143.seq - Patent sequence entries, part 143.
1384. gbpat144.seq - Patent sequence entries, part 144.
1385. gbpat145.seq - Patent sequence entries, part 145.
1386. gbpat146.seq - Patent sequence entries, part 146.
1387. gbpat147.seq - Patent sequence entries, part 147.
1388. gbpat148.seq - Patent sequence entries, part 148.
1389. gbpat149.seq - Patent sequence entries, part 149.
1390. gbpat15.seq - Patent sequence entries, part 15.
1391. gbpat150.seq - Patent sequence entries, part 150.
1392. gbpat151.seq - Patent sequence entries, part 151.
1393. gbpat152.seq - Patent sequence entries, part 152.
1394. gbpat153.seq - Patent sequence entries, part 153.
1395. gbpat154.seq - Patent sequence entries, part 154.
1396. gbpat155.seq - Patent sequence entries, part 155.
1397. gbpat156.seq - Patent sequence entries, part 156.
1398. gbpat157.seq - Patent sequence entries, part 157.
1399. gbpat158.seq - Patent sequence entries, part 158.
1400. gbpat159.seq - Patent sequence entries, part 159.
1401. gbpat16.seq - Patent sequence entries, part 16.
1402. gbpat160.seq - Patent sequence entries, part 160.
1403. gbpat161.seq - Patent sequence entries, part 161.
1404. gbpat162.seq - Patent sequence entries, part 162.
1405. gbpat163.seq - Patent sequence entries, part 163.
1406. gbpat164.seq - Patent sequence entries, part 164.
1407. gbpat165.seq - Patent sequence entries, part 165.
1408. gbpat166.seq - Patent sequence entries, part 166.
1409. gbpat167.seq - Patent sequence entries, part 167.
1410. gbpat168.seq - Patent sequence entries, part 168.
1411. gbpat169.seq - Patent sequence entries, part 169.
1412. gbpat17.seq - Patent sequence entries, part 17.
1413. gbpat170.seq - Patent sequence entries, part 170.
1414. gbpat171.seq - Patent sequence entries, part 171.
1415. gbpat172.seq - Patent sequence entries, part 172.
1416. gbpat173.seq - Patent sequence entries, part 173.
1417. gbpat174.seq - Patent sequence entries, part 174.
1418. gbpat175.seq - Patent sequence entries, part 175.
1419. gbpat176.seq - Patent sequence entries, part 176.
1420. gbpat177.seq - Patent sequence entries, part 177.
1421. gbpat178.seq - Patent sequence entries, part 178.
1422. gbpat18.seq - Patent sequence entries, part 18.
1423. gbpat19.seq - Patent sequence entries, part 19.
1424. gbpat2.seq - Patent sequence entries, part 2.
1425. gbpat20.seq - Patent sequence entries, part 20.
1426. gbpat21.seq - Patent sequence entries, part 21.
1427. gbpat22.seq - Patent sequence entries, part 22.
1428. gbpat23.seq - Patent sequence entries, part 23.
1429. gbpat24.seq - Patent sequence entries, part 24.
1430. gbpat25.seq - Patent sequence entries, part 25.
1431. gbpat26.seq - Patent sequence entries, part 26.
1432. gbpat27.seq - Patent sequence entries, part 27.
1433. gbpat28.seq - Patent sequence entries, part 28.
1434. gbpat29.seq - Patent sequence entries, part 29.
1435. gbpat3.seq - Patent sequence entries, part 3.
1436. gbpat30.seq - Patent sequence entries, part 30.
1437. gbpat31.seq - Patent sequence entries, part 31.
1438. gbpat32.seq - Patent sequence entries, part 32.
1439. gbpat33.seq - Patent sequence entries, part 33.
1440. gbpat34.seq - Patent sequence entries, part 34.
1441. gbpat35.seq - Patent sequence entries, part 35.
1442. gbpat36.seq - Patent sequence entries, part 36.
1443. gbpat37.seq - Patent sequence entries, part 37.
1444. gbpat38.seq - Patent sequence entries, part 38.
1445. gbpat39.seq - Patent sequence entries, part 39.
1446. gbpat4.seq - Patent sequence entries, part 4.
1447. gbpat40.seq - Patent sequence entries, part 40.
1448. gbpat41.seq - Patent sequence entries, part 41.
1449. gbpat42.seq - Patent sequence entries, part 42.
1450. gbpat43.seq - Patent sequence entries, part 43.
1451. gbpat44.seq - Patent sequence entries, part 44.
1452. gbpat45.seq - Patent sequence entries, part 45.
1453. gbpat46.seq - Patent sequence entries, part 46.
1454. gbpat47.seq - Patent sequence entries, part 47.
1455. gbpat48.seq - Patent sequence entries, part 48.
1456. gbpat49.seq - Patent sequence entries, part 49.
1457. gbpat5.seq - Patent sequence entries, part 5.
1458. gbpat50.seq - Patent sequence entries, part 50.
1459. gbpat51.seq - Patent sequence entries, part 51.
1460. gbpat52.seq - Patent sequence entries, part 52.
1461. gbpat53.seq - Patent sequence entries, part 53.
1462. gbpat54.seq - Patent sequence entries, part 54.
1463. gbpat55.seq - Patent sequence entries, part 55.
1464. gbpat56.seq - Patent sequence entries, part 56.
1465. gbpat57.seq - Patent sequence entries, part 57.
1466. gbpat58.seq - Patent sequence entries, part 58.
1467. gbpat59.seq - Patent sequence entries, part 59.
1468. gbpat6.seq - Patent sequence entries, part 6.
1469. gbpat60.seq - Patent sequence entries, part 60.
1470. gbpat61.seq - Patent sequence entries, part 61.
1471. gbpat62.seq - Patent sequence entries, part 62.
1472. gbpat63.seq - Patent sequence entries, part 63.
1473. gbpat64.seq - Patent sequence entries, part 64.
1474. gbpat65.seq - Patent sequence entries, part 65.
1475. gbpat66.seq - Patent sequence entries, part 66.
1476. gbpat67.seq - Patent sequence entries, part 67.
1477. gbpat68.seq - Patent sequence entries, part 68.
1478. gbpat69.seq - Patent sequence entries, part 69.
1479. gbpat7.seq - Patent sequence entries, part 7.
1480. gbpat70.seq - Patent sequence entries, part 70.
1481. gbpat71.seq - Patent sequence entries, part 71.
1482. gbpat72.seq - Patent sequence entries, part 72.
1483. gbpat73.seq - Patent sequence entries, part 73.
1484. gbpat74.seq - Patent sequence entries, part 74.
1485. gbpat75.seq - Patent sequence entries, part 75.
1486. gbpat76.seq - Patent sequence entries, part 76.
1487. gbpat77.seq - Patent sequence entries, part 77.
1488. gbpat78.seq - Patent sequence entries, part 78.
1489. gbpat79.seq - Patent sequence entries, part 79.
1490. gbpat8.seq - Patent sequence entries, part 8.
1491. gbpat80.seq - Patent sequence entries, part 80.
1492. gbpat81.seq - Patent sequence entries, part 81.
1493. gbpat82.seq - Patent sequence entries, part 82.
1494. gbpat83.seq - Patent sequence entries, part 83.
1495. gbpat84.seq - Patent sequence entries, part 84.
1496. gbpat85.seq - Patent sequence entries, part 85.
1497. gbpat86.seq - Patent sequence entries, part 86.
1498. gbpat87.seq - Patent sequence entries, part 87.
1499. gbpat88.seq - Patent sequence entries, part 88.
1500. gbpat89.seq - Patent sequence entries, part 89.
1501. gbpat9.seq - Patent sequence entries, part 9.
1502. gbpat90.seq - Patent sequence entries, part 90.
1503. gbpat91.seq - Patent sequence entries, part 91.
1504. gbpat92.seq - Patent sequence entries, part 92.
1505. gbpat93.seq - Patent sequence entries, part 93.
1506. gbpat94.seq - Patent sequence entries, part 94.
1507. gbpat95.seq - Patent sequence entries, part 95.
1508. gbpat96.seq - Patent sequence entries, part 96.
1509. gbpat97.seq - Patent sequence entries, part 97.
1510. gbpat98.seq - Patent sequence entries, part 98.
1511. gbpat99.seq - Patent sequence entries, part 99.
1512. gbphg1.seq - Phage sequence entries, part 1.
1513. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1514. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1515. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1516. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1517. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1518. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1519. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1520. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1521. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1522. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1523. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1524. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1525. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1526. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1527. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1528. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1529. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1530. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1531. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1532. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1533. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1534. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1535. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1536. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1537. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1538. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1539. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1540. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1541. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1542. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1543. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1544. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1545. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1546. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1547. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1548. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1549. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1550. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1551. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1552. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1553. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1554. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1555. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1556. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1557. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1558. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1559. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1560. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1561. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1562. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1563. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1564. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1565. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1566. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1567. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1568. gbpri1.seq - Primate sequence entries, part 1.
1569. gbpri10.seq - Primate sequence entries, part 10.
1570. gbpri11.seq - Primate sequence entries, part 11.
1571. gbpri12.seq - Primate sequence entries, part 12.
1572. gbpri13.seq - Primate sequence entries, part 13.
1573. gbpri14.seq - Primate sequence entries, part 14.
1574. gbpri15.seq - Primate sequence entries, part 15.
1575. gbpri16.seq - Primate sequence entries, part 16.
1576. gbpri17.seq - Primate sequence entries, part 17.
1577. gbpri18.seq - Primate sequence entries, part 18.
1578. gbpri19.seq - Primate sequence entries, part 19.
1579. gbpri2.seq - Primate sequence entries, part 2.
1580. gbpri20.seq - Primate sequence entries, part 20.
1581. gbpri21.seq - Primate sequence entries, part 21.
1582. gbpri22.seq - Primate sequence entries, part 22.
1583. gbpri23.seq - Primate sequence entries, part 23.
1584. gbpri24.seq - Primate sequence entries, part 24.
1585. gbpri25.seq - Primate sequence entries, part 25.
1586. gbpri26.seq - Primate sequence entries, part 26.
1587. gbpri27.seq - Primate sequence entries, part 27.
1588. gbpri28.seq - Primate sequence entries, part 28.
1589. gbpri29.seq - Primate sequence entries, part 29.
1590. gbpri3.seq - Primate sequence entries, part 3.
1591. gbpri30.seq - Primate sequence entries, part 30.
1592. gbpri31.seq - Primate sequence entries, part 31.
1593. gbpri32.seq - Primate sequence entries, part 32.
1594. gbpri33.seq - Primate sequence entries, part 33.
1595. gbpri34.seq - Primate sequence entries, part 34.
1596. gbpri35.seq - Primate sequence entries, part 35.
1597. gbpri36.seq - Primate sequence entries, part 36.
1598. gbpri37.seq - Primate sequence entries, part 37.
1599. gbpri38.seq - Primate sequence entries, part 38.
1600. gbpri39.seq - Primate sequence entries, part 39.
1601. gbpri4.seq - Primate sequence entries, part 4.
1602. gbpri40.seq - Primate sequence entries, part 40.
1603. gbpri41.seq - Primate sequence entries, part 41.
1604. gbpri42.seq - Primate sequence entries, part 42.
1605. gbpri43.seq - Primate sequence entries, part 43.
1606. gbpri44.seq - Primate sequence entries, part 44.
1607. gbpri45.seq - Primate sequence entries, part 45.
1608. gbpri5.seq - Primate sequence entries, part 5.
1609. gbpri6.seq - Primate sequence entries, part 6.
1610. gbpri7.seq - Primate sequence entries, part 7.
1611. gbpri8.seq - Primate sequence entries, part 8.
1612. gbpri9.seq - Primate sequence entries, part 9.
1613. gbrel.txt - Release notes (this document).
1614. gbrod1.seq - Rodent sequence entries, part 1.
1615. gbrod10.seq - Rodent sequence entries, part 10.
1616. gbrod11.seq - Rodent sequence entries, part 11.
1617. gbrod12.seq - Rodent sequence entries, part 12.
1618. gbrod13.seq - Rodent sequence entries, part 13.
1619. gbrod14.seq - Rodent sequence entries, part 14.
1620. gbrod15.seq - Rodent sequence entries, part 15.
1621. gbrod16.seq - Rodent sequence entries, part 16.
1622. gbrod17.seq - Rodent sequence entries, part 17.
1623. gbrod18.seq - Rodent sequence entries, part 18.
1624. gbrod19.seq - Rodent sequence entries, part 19.
1625. gbrod2.seq - Rodent sequence entries, part 2.
1626. gbrod20.seq - Rodent sequence entries, part 20.
1627. gbrod21.seq - Rodent sequence entries, part 21.
1628. gbrod22.seq - Rodent sequence entries, part 22.
1629. gbrod23.seq - Rodent sequence entries, part 23.
1630. gbrod24.seq - Rodent sequence entries, part 24.
1631. gbrod25.seq - Rodent sequence entries, part 25.
1632. gbrod26.seq - Rodent sequence entries, part 26.
1633. gbrod27.seq - Rodent sequence entries, part 27.
1634. gbrod28.seq - Rodent sequence entries, part 28.
1635. gbrod29.seq - Rodent sequence entries, part 29.
1636. gbrod3.seq - Rodent sequence entries, part 3.
1637. gbrod4.seq - Rodent sequence entries, part 4.
1638. gbrod5.seq - Rodent sequence entries, part 5.
1639. gbrod6.seq - Rodent sequence entries, part 6.
1640. gbrod7.seq - Rodent sequence entries, part 7.
1641. gbrod8.seq - Rodent sequence entries, part 8.
1642. gbrod9.seq - Rodent sequence entries, part 9.
1643. gbsdr1.txt - Short directory of the data bank, part 1.
1644. gbsdr2.txt - Short directory of the data bank, part 2.
1645. gbsdr3.txt - Short directory of the data bank, part 3.
1646. gbsec.idx - Index of the entries according to secondary accession number.
1647. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1648. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1649. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1650. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1651. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1652. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1653. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1654. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1655. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1656. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1657. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1658. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1659. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1660. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1661. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1662. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1663. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1664. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1665. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1666. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1667. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1668. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1669. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1670. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1671. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1672. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1673. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1674. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1675. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1676. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1677. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1678. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1679. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1680. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1681. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1682. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1683. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1684. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1685. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1686. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1687. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1688. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1689. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1690. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1691. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1692. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1693. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1694. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1695. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1696. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1697. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1698. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1699. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1700. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1701. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1702. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1703. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1704. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1705. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1706. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1707. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1708. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1709. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1710. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1711. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1712. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1713. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1714. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1715. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1716. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1717. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1718. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1719. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1720. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1721. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1722. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1723. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1724. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1725. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1726. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1727. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1728. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1729. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1730. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1731. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1732. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1733. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1734. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1735. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1736. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1737. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1738. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1739. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1740. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1741. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1742. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1743. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1744. gbuna1.seq - Unannotated sequence entries, part 1.
1745. gbvrl1.seq - Viral sequence entries, part 1.
1746. gbvrl10.seq - Viral sequence entries, part 10.
1747. gbvrl11.seq - Viral sequence entries, part 11.
1748. gbvrl12.seq - Viral sequence entries, part 12.
1749. gbvrl13.seq - Viral sequence entries, part 13.
1750. gbvrl14.seq - Viral sequence entries, part 14.
1751. gbvrl15.seq - Viral sequence entries, part 15.
1752. gbvrl16.seq - Viral sequence entries, part 16.
1753. gbvrl17.seq - Viral sequence entries, part 17.
1754. gbvrl18.seq - Viral sequence entries, part 18.
1755. gbvrl19.seq - Viral sequence entries, part 19.
1756. gbvrl2.seq - Viral sequence entries, part 2.
1757. gbvrl20.seq - Viral sequence entries, part 20.
1758. gbvrl3.seq - Viral sequence entries, part 3.
1759. gbvrl4.seq - Viral sequence entries, part 4.
1760. gbvrl5.seq - Viral sequence entries, part 5.
1761. gbvrl6.seq - Viral sequence entries, part 6.
1762. gbvrl7.seq - Viral sequence entries, part 7.
1763. gbvrl8.seq - Viral sequence entries, part 8.
1764. gbvrl9.seq - Viral sequence entries, part 9.
1765. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1766. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1767. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1768. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1769. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1770. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1771. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1772. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1773. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1774. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1775. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1776. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1777. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1778. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1779. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1780. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1781. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1782. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1783. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1784. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1785. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1786. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1787. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1788. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1789. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1790. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 189.0 flatfiles require roughly 545 GB (sequence
files only) or 586 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1992103018     gbacc1.idx
2393141685     gbacc2.idx
 845916231     gbacc3.idx
 183987859     gbaut1.idx
 186090645     gbaut10.idx
 186060262     gbaut11.idx
 184271344     gbaut12.idx
 250584891     gbaut13.idx
 183902984     gbaut14.idx
 186755583     gbaut15.idx
 188375618     gbaut16.idx
 234847560     gbaut17.idx
 187030523     gbaut18.idx
 188907466     gbaut19.idx
 247761002     gbaut2.idx
 185023067     gbaut20.idx
 250122200     gbaut21.idx
 230209356     gbaut22.idx
 187695199     gbaut23.idx
 188782709     gbaut24.idx
 201508914     gbaut25.idx
 241060510     gbaut26.idx
 185843220     gbaut27.idx
 184606016     gbaut28.idx
 184077621     gbaut29.idx
 220840469     gbaut3.idx
 183955073     gbaut30.idx
 184001803     gbaut31.idx
 184524119     gbaut32.idx
 185845670     gbaut33.idx
 183800094     gbaut34.idx
 207855256     gbaut35.idx
 188655558     gbaut36.idx
 183938245     gbaut37.idx
 192847440     gbaut38.idx
 183970959     gbaut39.idx
 183950020     gbaut4.idx
 183893885     gbaut40.idx
 183948601     gbaut41.idx
 185960623     gbaut42.idx
 185541308     gbaut43.idx
 192412762     gbaut44.idx
 250820422     gbaut45.idx
 207504576     gbaut46.idx
 188755028     gbaut47.idx
 199158863     gbaut48.idx
 190385798     gbaut49.idx
 243347491     gbaut5.idx
 202993617     gbaut50.idx
 232486458     gbaut51.idx
 186869098     gbaut52.idx
 184287318     gbaut53.idx
 183898075     gbaut54.idx
 184025803     gbaut55.idx
 185823112     gbaut56.idx
 224055967     gbaut57.idx
 186047565     gbaut58.idx
 185212585     gbaut59.idx
 200283326     gbaut6.idx
 184042509     gbaut60.idx
 185688569     gbaut61.idx
 183860697     gbaut62.idx
 188071738     gbaut63.idx
 185804331     gbaut64.idx
 240069295     gbaut65.idx
 189901689     gbaut66.idx
 185254279     gbaut67.idx
 186019011     gbaut68.idx
 183940699     gbaut69.idx
 184148093     gbaut7.idx
 184788998     gbaut70.idx
 186493825     gbaut71.idx
 187137281     gbaut72.idx
 184694322     gbaut73.idx
 186255499     gbaut74.idx
 187741906     gbaut75.idx
 185954406     gbaut76.idx
 219719889     gbaut77.idx
 184673368     gbaut78.idx
 185346028     gbaut79.idx
 188537898     gbaut8.idx
 191861059     gbaut80.idx
 183904094     gbaut81.idx
 184524770     gbaut82.idx
 184294509     gbaut83.idx
 184509475     gbaut84.idx
 244979657     gbaut85.idx
 184956702     gbaut86.idx
 185149283     gbaut87.idx
 183788052     gbaut88.idx
 185617183     gbaut89.idx
 196458144     gbaut9.idx
 184412369     gbaut90.idx
 194570681     gbaut91.idx
 184651361     gbaut92.idx
 183863734     gbaut93.idx
 209997120     gbaut94.idx
 183952573     gbaut95.idx
 187119204     gbaut96.idx
  31809183     gbaut97.idx
 249999222     gbbct1.seq
 244870852     gbbct10.seq
 244613667     gbbct11.seq
 236598271     gbbct12.seq
 250000111     gbbct13.seq
  30699010     gbbct14.seq
 243165286     gbbct15.seq
 249783326     gbbct16.seq
 245551992     gbbct17.seq
 248628765     gbbct18.seq
 248242091     gbbct19.seq
 245372753     gbbct2.seq
 249281961     gbbct20.seq
 246198630     gbbct21.seq
 245693356     gbbct22.seq
 217806784     gbbct23.seq
 242803771     gbbct24.seq
 241840999     gbbct25.seq
 248677048     gbbct26.seq
 247875345     gbbct27.seq
 249388245     gbbct28.seq
 244185977     gbbct29.seq
 247570684     gbbct3.seq
 247336992     gbbct30.seq
 249996799     gbbct31.seq
 249761445     gbbct32.seq
 249790948     gbbct33.seq
 242886336     gbbct34.seq
 241625881     gbbct35.seq
 160068904     gbbct36.seq
 243880501     gbbct37.seq
 246111304     gbbct38.seq
 242768074     gbbct39.seq
 241184574     gbbct4.seq
 239636196     gbbct40.seq
 247210305     gbbct41.seq
 246790666     gbbct42.seq
 245870812     gbbct43.seq
 244913595     gbbct44.seq
 248036754     gbbct45.seq
 248281460     gbbct46.seq
 241195587     gbbct47.seq
 162003991     gbbct48.seq
 249923106     gbbct49.seq
 213978084     gbbct5.seq
 247105195     gbbct50.seq
 241662934     gbbct51.seq
 245557638     gbbct52.seq
 246292986     gbbct53.seq
 246413424     gbbct54.seq
 249774041     gbbct55.seq
 247796112     gbbct56.seq
 248838160     gbbct57.seq
 244464112     gbbct58.seq
 243118318     gbbct59.seq
 242133044     gbbct6.seq
 198928158     gbbct60.seq
 245006659     gbbct61.seq
 247398154     gbbct62.seq
 249964013     gbbct63.seq
 246718647     gbbct64.seq
 145949622     gbbct65.seq
   6887681     gbbct66.seq
  14096568     gbbct67.seq
  23201077     gbbct68.seq
  45100970     gbbct69.seq
 248056375     gbbct7.seq
  87782672     gbbct70.seq
 170071264     gbbct71.seq
 249999413     gbbct72.seq
 249998793     gbbct73.seq
 243633457     gbbct74.seq
 249784623     gbbct75.seq
 241414051     gbbct76.seq
 247359815     gbbct77.seq
 249997476     gbbct78.seq
 249773683     gbbct79.seq
 247183485     gbbct8.seq
  78703112     gbbct80.seq
 249769426     gbbct81.seq
 249999929     gbbct82.seq
 249997613     gbbct83.seq
 249995007     gbbct84.seq
 112611248     gbbct85.seq
 245011144     gbbct9.seq
  12439594     gbchg.txt
 249998437     gbcon1.seq
 249997306     gbcon10.seq
 249994223     gbcon100.seq
 249995660     gbcon101.seq
 249998605     gbcon102.seq
 249998936     gbcon103.seq
 250000223     gbcon104.seq
 156342446     gbcon105.seq
 249996812     gbcon106.seq
 249993767     gbcon107.seq
 249992301     gbcon108.seq
 249998322     gbcon109.seq
 249367269     gbcon11.seq
  71615782     gbcon110.seq
 212826019     gbcon111.seq
 250000256     gbcon112.seq
 250000098     gbcon113.seq
 249995503     gbcon114.seq
 249983740     gbcon115.seq
 109734089     gbcon116.seq
 249914315     gbcon117.seq
 249999105     gbcon118.seq
 180025678     gbcon119.seq
 248928386     gbcon12.seq
 249997285     gbcon120.seq
 250000198     gbcon121.seq
 249998745     gbcon122.seq
 222475340     gbcon123.seq
 248981147     gbcon124.seq
 249952905     gbcon125.seq
 249856157     gbcon126.seq
 249994853     gbcon127.seq
 249998775     gbcon128.seq
 249998332     gbcon129.seq
 249414427     gbcon13.seq
  26893749     gbcon130.seq
 249978699     gbcon131.seq
 249998490     gbcon132.seq
 249993348     gbcon133.seq
 249999880     gbcon134.seq
 249912502     gbcon135.seq
 249948624     gbcon136.seq
 249955490     gbcon137.seq
 233498612     gbcon138.seq
 246632492     gbcon139.seq
 249998181     gbcon14.seq
 247088480     gbcon140.seq
 249512645     gbcon141.seq
 249992268     gbcon142.seq
 108787033     gbcon143.seq
 249998195     gbcon144.seq
 249695087     gbcon145.seq
 249996033     gbcon146.seq
 249963114     gbcon147.seq
 250000246     gbcon148.seq
 249792074     gbcon149.seq
  46257922     gbcon15.seq
 249955090     gbcon150.seq
 249999017     gbcon151.seq
 199658550     gbcon152.seq
 249970974     gbcon153.seq
 249999146     gbcon154.seq
 249995739     gbcon155.seq
 249929876     gbcon156.seq
 249999580     gbcon157.seq
 130279337     gbcon158.seq
 250000007     gbcon159.seq
 247404331     gbcon16.seq
 249955167     gbcon160.seq
 249997423     gbcon161.seq
 249998688     gbcon162.seq
 250000092     gbcon163.seq
 249668804     gbcon164.seq
 249998963     gbcon165.seq
  95920969     gbcon166.seq
  18856115     gbcon167.seq
 249996913     gbcon17.seq
 249931945     gbcon18.seq
  45091689     gbcon19.seq
 249930528     gbcon2.seq
 249999960     gbcon20.seq
 249360219     gbcon21.seq
 116173132     gbcon22.seq
 249999462     gbcon23.seq
 120041874     gbcon24.seq
 249996870     gbcon25.seq
 249724019     gbcon26.seq
 249997572     gbcon27.seq
 249998238     gbcon28.seq
 186471574     gbcon29.seq
 248161967     gbcon3.seq
 249999756     gbcon30.seq
 249997224     gbcon31.seq
 249999813     gbcon32.seq
 249999952     gbcon33.seq
 247997550     gbcon34.seq
 232565070     gbcon35.seq
 249999237     gbcon36.seq
 249996869     gbcon37.seq
 249995921     gbcon38.seq
 249996351     gbcon39.seq
 248979371     gbcon4.seq
 249999450     gbcon40.seq
 249997210     gbcon41.seq
  61183731     gbcon42.seq
 249997486     gbcon43.seq
 249994070     gbcon44.seq
 249999391     gbcon45.seq
 249997743     gbcon46.seq
 249994859     gbcon47.seq
  43089049     gbcon48.seq
 249993995     gbcon49.seq
 249999843     gbcon5.seq
 249996310     gbcon50.seq
 249994442     gbcon51.seq
 249997248     gbcon52.seq
 250000078     gbcon53.seq
  36404971     gbcon54.seq
 249993185     gbcon55.seq
 249998119     gbcon56.seq
 249995170     gbcon57.seq
 249998154     gbcon58.seq
 249998078     gbcon59.seq
 249993449     gbcon6.seq
 152679523     gbcon60.seq
 249999955     gbcon61.seq
 249999066     gbcon62.seq
 249997558     gbcon63.seq
 249998625     gbcon64.seq
 183609322     gbcon65.seq
 249999870     gbcon66.seq
 249997967     gbcon67.seq
 249997138     gbcon68.seq
 249995207     gbcon69.seq
 231272949     gbcon7.seq
 245488804     gbcon70.seq
 250000182     gbcon71.seq
 249998695     gbcon72.seq
 249998372     gbcon73.seq
 249996966     gbcon74.seq
 250000007     gbcon75.seq
  96627683     gbcon76.seq
 249993448     gbcon77.seq
 249995119     gbcon78.seq
 249997383     gbcon79.seq
 249997708     gbcon8.seq
 249995948     gbcon80.seq
 249999042     gbcon81.seq
  62682749     gbcon82.seq
 249997771     gbcon83.seq
 249996653     gbcon84.seq
 249999445     gbcon85.seq
 249999590     gbcon86.seq
 249998149     gbcon87.seq
  21674116     gbcon88.seq
 249998140     gbcon89.seq
 249996514     gbcon9.seq
 249997503     gbcon90.seq
 249996940     gbcon91.seq
 249995720     gbcon92.seq
 197881888     gbcon93.seq
 249993974     gbcon94.seq
 249996060     gbcon95.seq
 249999726     gbcon96.seq
 249998645     gbcon97.seq
 249996901     gbcon98.seq
 133265984     gbcon99.seq
   5226689     gbdel.txt
 249998126     gbenv1.seq
 249999987     gbenv10.seq
  56473734     gbenv11.seq
 249999616     gbenv12.seq
 249999595     gbenv13.seq
 249997680     gbenv14.seq
 249999723     gbenv15.seq
 249998637     gbenv16.seq
 249999240     gbenv17.seq
 249996520     gbenv18.seq
 201131266     gbenv19.seq
 249999695     gbenv2.seq
 249997542     gbenv20.seq
 250000045     gbenv21.seq
 249998701     gbenv22.seq
 249999056     gbenv23.seq
 156286621     gbenv24.seq
 249998724     gbenv25.seq
 249965280     gbenv26.seq
 249999705     gbenv27.seq
 249999280     gbenv28.seq
 249999160     gbenv29.seq
 250000121     gbenv3.seq
 154215264     gbenv30.seq
 249998069     gbenv31.seq
 249997320     gbenv32.seq
 249998597     gbenv33.seq
 249999542     gbenv34.seq
 142451829     gbenv35.seq
 249999327     gbenv36.seq
 249999297     gbenv37.seq
 249999340     gbenv38.seq
 249998563     gbenv39.seq
 249997874     gbenv4.seq
 249998831     gbenv40.seq
 226946874     gbenv41.seq
 249999751     gbenv42.seq
 249998764     gbenv43.seq
 250000028     gbenv44.seq
 249999389     gbenv45.seq
  80801262     gbenv46.seq
 249996327     gbenv47.seq
 249996957     gbenv48.seq
 249997170     gbenv49.seq
 249999153     gbenv5.seq
 249997321     gbenv50.seq
 249999151     gbenv51.seq
 249998084     gbenv52.seq
  19654377     gbenv53.seq
 241051428     gbenv6.seq
 249998471     gbenv7.seq
 249999917     gbenv8.seq
 249998584     gbenv9.seq
 524292008     gbest1.seq
 524289016     gbest10.seq
 524291268     gbest100.seq
 524289437     gbest101.seq
 524290715     gbest102.seq
 524289086     gbest103.seq
 349471723     gbest104.seq
 524291148     gbest105.seq
 524289738     gbest106.seq
 524291194     gbest107.seq
 385839175     gbest108.seq
 389670817     gbest109.seq
 524290986     gbest11.seq
 383425467     gbest110.seq
 384188998     gbest111.seq
 381057139     gbest112.seq
 385305672     gbest113.seq
 390039961     gbest114.seq
 388178589     gbest115.seq
 387308759     gbest116.seq
 383862694     gbest117.seq
 407500455     gbest118.seq
 510284736     gbest119.seq
 524288931     gbest12.seq
 524288993     gbest120.seq
 524289609     gbest121.seq
 524290228     gbest122.seq
 524290198     gbest123.seq
 431202902     gbest124.seq
 524290226     gbest125.seq
 524292007     gbest126.seq
 524289559     gbest127.seq
 524289933     gbest128.seq
 524292165     gbest129.seq
 156583008     gbest13.seq
 524290205     gbest130.seq
 524288969     gbest131.seq
 524290499     gbest132.seq
 524289594     gbest133.seq
 524291657     gbest134.seq
 524289466     gbest135.seq
 524289777     gbest136.seq
 299948048     gbest137.seq
 524290906     gbest138.seq
 524291320     gbest139.seq
 524289786     gbest14.seq
 524292469     gbest140.seq
 524291268     gbest141.seq
 524292303     gbest142.seq
 524289908     gbest143.seq
 524289804     gbest144.seq
 524290725     gbest145.seq
 524289388     gbest146.seq
 524288942     gbest147.seq
 524289469     gbest148.seq
 524291987     gbest149.seq
 524291437     gbest15.seq
 524289983     gbest150.seq
 464599767     gbest151.seq
 524291621     gbest152.seq
 524289898     gbest153.seq
 524290313     gbest154.seq
 524291048     gbest155.seq
 524289615     gbest156.seq
 524288756     gbest157.seq
 524289333     gbest158.seq
 524292205     gbest159.seq
 524289246     gbest16.seq
 524289298     gbest160.seq
 524292946     gbest161.seq
 524288923     gbest162.seq
 524288941     gbest163.seq
 244792923     gbest164.seq
 524290553     gbest165.seq
 524290082     gbest166.seq
 524291149     gbest167.seq
 524291109     gbest168.seq
 524290549     gbest169.seq
 524289351     gbest17.seq
 524289746     gbest170.seq
 524290294     gbest171.seq
 524289737     gbest172.seq
 524289426     gbest173.seq
 524289043     gbest174.seq
 524290997     gbest175.seq
 524290710     gbest176.seq
 524289416     gbest177.seq
 112726770     gbest178.seq
 524289455     gbest179.seq
 524290027     gbest18.seq
 524290176     gbest180.seq
 524289972     gbest181.seq
 524291308     gbest182.seq
 524288814     gbest183.seq
 524290837     gbest184.seq
 524290819     gbest185.seq
 524289479     gbest186.seq
 524289157     gbest187.seq
 524291338     gbest188.seq
 524288746     gbest189.seq
 524291602     gbest19.seq
 524288754     gbest190.seq
 467977833     gbest191.seq
 524290972     gbest192.seq
 524290099     gbest193.seq
 524290680     gbest194.seq
 524292662     gbest195.seq
 524289242     gbest196.seq
 524289152     gbest197.seq
 524289984     gbest198.seq
 524290974     gbest199.seq
 524289694     gbest2.seq
 524289794     gbest20.seq
 524289613     gbest200.seq
 524289209     gbest201.seq
 524290559     gbest202.seq
 524289133     gbest203.seq
 524291398     gbest204.seq
  83759466     gbest205.seq
 524289587     gbest206.seq
 524288736     gbest207.seq
 524289118     gbest208.seq
 524289225     gbest209.seq
 524291555     gbest21.seq
 524291008     gbest210.seq
 524290107     gbest211.seq
 524291006     gbest212.seq
 524290702     gbest213.seq
 524288823     gbest214.seq
 524289838     gbest215.seq
 421982696     gbest216.seq
 524292573     gbest217.seq
 524291705     gbest218.seq
 524288981     gbest219.seq
 512090321     gbest22.seq
 524290993     gbest220.seq
 524291112     gbest221.seq
 524294808     gbest222.seq
 524289268     gbest223.seq
 524291819     gbest224.seq
 524290881     gbest225.seq
 524289350     gbest226.seq
 524290342     gbest227.seq
 524291126     gbest228.seq
 524291154     gbest229.seq
 500344147     gbest23.seq
 351153673     gbest230.seq
 524291828     gbest231.seq
 524290256     gbest232.seq
 524289759     gbest233.seq
 524293306     gbest234.seq
 524292254     gbest235.seq
 524290349     gbest236.seq
 524293292     gbest237.seq
 524290432     gbest238.seq
 524291590     gbest239.seq
 509304525     gbest24.seq
 524291065     gbest240.seq
 524290788     gbest241.seq
 524289177     gbest242.seq
 524290253     gbest243.seq
 524290415     gbest244.seq
  49001491     gbest245.seq
 524288751     gbest246.seq
 524289516     gbest247.seq
 524292105     gbest248.seq
 524288902     gbest249.seq
 319590070     gbest25.seq
 524290050     gbest250.seq
 524289119     gbest251.seq
 524289777     gbest252.seq
 524291413     gbest253.seq
 524289460     gbest254.seq
 524289663     gbest255.seq
 524291724     gbest256.seq
 260104720     gbest257.seq
 524289994     gbest258.seq
 524290112     gbest259.seq
 524288828     gbest26.seq
 524289510     gbest260.seq
 524290027     gbest261.seq
 524289945     gbest262.seq
 524290744     gbest263.seq
 524288967     gbest264.seq
 524290443     gbest265.seq
 524290316     gbest266.seq
 524290430     gbest267.seq
 297070339     gbest268.seq
 524288751     gbest269.seq
 524290412     gbest27.seq
 524288830     gbest270.seq
 524289356     gbest271.seq
 524291720     gbest272.seq
 524289115     gbest273.seq
 524289389     gbest274.seq
 524288772     gbest275.seq
 524290550     gbest276.seq
 524289620     gbest277.seq
 524289992     gbest278.seq
 524289409     gbest279.seq
 524288758     gbest28.seq
 302513707     gbest280.seq
 524293416     gbest281.seq
 524290544     gbest282.seq
 524289704     gbest283.seq
 524290519     gbest284.seq
 524289514     gbest285.seq
 524289433     gbest286.seq
 524289863     gbest287.seq
 524290574     gbest288.seq
 524292530     gbest289.seq
 524290753     gbest29.seq
 524289853     gbest290.seq
 524288759     gbest291.seq
 230059846     gbest292.seq
 524290964     gbest293.seq
 524290663     gbest294.seq
 524289307     gbest295.seq
 524291130     gbest296.seq
 524291216     gbest297.seq
 524288935     gbest298.seq
 524290523     gbest299.seq
 497701912     gbest3.seq
 524290738     gbest30.seq
 524288772     gbest300.seq
 477427193     gbest301.seq
 485390008     gbest302.seq
 487642595     gbest303.seq
 320271085     gbest304.seq
 524290048     gbest305.seq
 524289871     gbest306.seq
 524289378     gbest307.seq
 524289530     gbest308.seq
 524290042     gbest309.seq
 524290199     gbest31.seq
 524290258     gbest310.seq
 524290274     gbest311.seq
 524290889     gbest312.seq
 524291644     gbest313.seq
 524289301     gbest314.seq
 524288916     gbest315.seq
 524291749     gbest316.seq
 497575917     gbest317.seq
 524289299     gbest318.seq
 524290548     gbest319.seq
 524291145     gbest32.seq
 524290184     gbest320.seq
 524289957     gbest321.seq
 524292539     gbest322.seq
 524289872     gbest323.seq
 524288956     gbest324.seq
 524290991     gbest325.seq
 524290627     gbest326.seq
 524118653     gbest327.seq
 524289685     gbest328.seq
 524291318     gbest329.seq
 524289323     gbest33.seq
 524290569     gbest330.seq
 250338987     gbest331.seq
 524290455     gbest332.seq
 524289770     gbest333.seq
 524290662     gbest334.seq
 524293472     gbest335.seq
 501685245     gbest336.seq
 524292606     gbest337.seq
 524290450     gbest338.seq
 524291819     gbest339.seq
 519566956     gbest34.seq
 524289116     gbest340.seq
 524289345     gbest341.seq
 524292325     gbest342.seq
 524289433     gbest343.seq
 524289249     gbest344.seq
 342088864     gbest345.seq
 524292213     gbest346.seq
 524290831     gbest347.seq
 524289370     gbest348.seq
 524290335     gbest349.seq
 492730500     gbest35.seq
 524290773     gbest350.seq
 524290880     gbest351.seq
 524290558     gbest352.seq
 524288833     gbest353.seq
 524292507     gbest354.seq
 524289430     gbest355.seq
 524289104     gbest356.seq
 524288900     gbest357.seq
 524291932     gbest358.seq
 524290462     gbest359.seq
 494451765     gbest36.seq
  16502264     gbest360.seq
 524290373     gbest361.seq
 524289513     gbest362.seq
 524291941     gbest363.seq
 524292678     gbest364.seq
 524290541     gbest365.seq
 524290060     gbest366.seq
 524289377     gbest367.seq
 524289351     gbest368.seq
 524291276     gbest369.seq
 493340572     gbest37.seq
 524289106     gbest370.seq
 386240288     gbest371.seq
 524289612     gbest372.seq
 524289110     gbest373.seq
 524289755     gbest374.seq
 505509793     gbest375.seq
 524289509     gbest376.seq
 524291315     gbest377.seq
 524291404     gbest378.seq
 524291214     gbest379.seq
 488000483     gbest38.seq
 524289505     gbest380.seq
 524291322     gbest381.seq
 524290565     gbest382.seq
 354341025     gbest383.seq
 524291127     gbest384.seq
 524289482     gbest385.seq
 524289915     gbest386.seq
 524291218     gbest387.seq
 524290453     gbest388.seq
 524292363     gbest389.seq
 493252495     gbest39.seq
 524288764     gbest390.seq
 524290144     gbest391.seq
 524290932     gbest392.seq
 524289330     gbest393.seq
 524290342     gbest394.seq
 185097263     gbest395.seq
 524292162     gbest396.seq
 524291056     gbest397.seq
 524288912     gbest398.seq
 524290219     gbest399.seq
 524288944     gbest4.seq
 111460427     gbest40.seq
 524290838     gbest400.seq
 524292071     gbest401.seq
 524288841     gbest402.seq
 524289363     gbest403.seq
 524291329     gbest404.seq
 524291661     gbest405.seq
 524291155     gbest406.seq
 524289864     gbest407.seq
 485613512     gbest408.seq
 524290761     gbest409.seq
 524294013     gbest41.seq
 524289578     gbest410.seq
 524289089     gbest411.seq
 524289797     gbest412.seq
 524288959     gbest413.seq
 524290418     gbest414.seq
 524290592     gbest415.seq
 524289240     gbest416.seq
 524290163     gbest417.seq
 524291589     gbest418.seq
 524289635     gbest419.seq
 524292378     gbest42.seq
 524290071     gbest420.seq
 524291541     gbest421.seq
  19587268     gbest422.seq
 524290635     gbest423.seq
 524290812     gbest424.seq
 524291282     gbest425.seq
 524290169     gbest426.seq
 524292260     gbest427.seq
 524290775     gbest428.seq
 524290919     gbest429.seq
 524291152     gbest43.seq
 524290073     gbest430.seq
 524290231     gbest431.seq
 524290589     gbest432.seq
 524290117     gbest433.seq
 524290183     gbest434.seq
 524288838     gbest435.seq
 524290267     gbest436.seq
  25342560     gbest437.seq
 524290097     gbest438.seq
 524289139     gbest439.seq
 524291994     gbest44.seq
 524289291     gbest440.seq
 524290687     gbest441.seq
 524291641     gbest442.seq
 524292107     gbest443.seq
 524289173     gbest444.seq
 524291054     gbest445.seq
 524290278     gbest446.seq
 524290005     gbest447.seq
 524290827     gbest448.seq
 357942556     gbest449.seq
 524289744     gbest45.seq
 524289991     gbest450.seq
 524289686     gbest451.seq
 524290075     gbest452.seq
 524290204     gbest453.seq
 524290572     gbest454.seq
 524289962     gbest455.seq
 524289235     gbest456.seq
 524292356     gbest457.seq
 524290358     gbest458.seq
 524289760     gbest459.seq
 524290536     gbest46.seq
 524289164     gbest460.seq
 135655340     gbest461.seq
 524290443     gbest47.seq
 524289407     gbest48.seq
 524288743     gbest49.seq
 524289625     gbest5.seq
 524289597     gbest50.seq
 524290850     gbest51.seq
 524290902     gbest52.seq
 524291426     gbest53.seq
 253754987     gbest54.seq
 524289855     gbest55.seq
 524292065     gbest56.seq
 524288912     gbest57.seq
 524289072     gbest58.seq
 524289254     gbest59.seq
 524288762     gbest6.seq
 524290970     gbest60.seq
 524291770     gbest61.seq
 524291036     gbest62.seq
 524290524     gbest63.seq
 524290125     gbest64.seq
 524291456     gbest65.seq
 524289317     gbest66.seq
 463063233     gbest67.seq
 524293061     gbest68.seq
 524289120     gbest69.seq
 524290014     gbest7.seq
 524290220     gbest70.seq
 524288927     gbest71.seq
 524291051     gbest72.seq
 524292401     gbest73.seq
 524290703     gbest74.seq
 524289284     gbest75.seq
 524288986     gbest76.seq
 524291000     gbest77.seq
 524290955     gbest78.seq
 524291491     gbest79.seq
 524290628     gbest8.seq
 190810938     gbest80.seq
 524290100     gbest81.seq
 524289613     gbest82.seq
 524289693     gbest83.seq
 524288728     gbest84.seq
 524289166     gbest85.seq
 524292117     gbest86.seq
 524291563     gbest87.seq
 524291075     gbest88.seq
 524290998     gbest89.seq
 524289667     gbest9.seq
 524290258     gbest90.seq
 524290235     gbest91.seq
 462469660     gbest92.seq
 524291760     gbest93.seq
 524292054     gbest94.seq
 524291571     gbest95.seq
 524289444     gbest96.seq
 524290291     gbest97.seq
 524292097     gbest98.seq
 524290031     gbest99.seq
 182899103     gbgen.idx
 524290352     gbgss1.seq
 524292173     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524290642     gbgss103.seq
 418354153     gbgss104.seq
 524290801     gbgss105.seq
 524290070     gbgss106.seq
 524290718     gbgss107.seq
 524288733     gbgss108.seq
 524288767     gbgss109.seq
 524291375     gbgss11.seq
 524289084     gbgss110.seq
 524290809     gbgss111.seq
 524289971     gbgss112.seq
 524291028     gbgss113.seq
 524291069     gbgss114.seq
 524289142     gbgss115.seq
  55578194     gbgss116.seq
 524289697     gbgss117.seq
 524288912     gbgss118.seq
 524289210     gbgss119.seq
 524290109     gbgss12.seq
 524289140     gbgss120.seq
 524290583     gbgss121.seq
 524289663     gbgss122.seq
 524289754     gbgss123.seq
 524289869     gbgss124.seq
 524290826     gbgss125.seq
 524289574     gbgss126.seq
 524289664     gbgss127.seq
 524289492     gbgss128.seq
 212391980     gbgss129.seq
 524289051     gbgss13.seq
 524289179     gbgss130.seq
 524289525     gbgss131.seq
 524289495     gbgss132.seq
 524291043     gbgss133.seq
 524288845     gbgss134.seq
 524291036     gbgss135.seq
 524292513     gbgss136.seq
 524288848     gbgss137.seq
 524289263     gbgss138.seq
 515991481     gbgss139.seq
 524289106     gbgss14.seq
 516018273     gbgss140.seq
 112014629     gbgss141.seq
 524289872     gbgss142.seq
 524291315     gbgss143.seq
 524290675     gbgss144.seq
 524290093     gbgss145.seq
 524290136     gbgss146.seq
 524291253     gbgss147.seq
 524290973     gbgss148.seq
 524290456     gbgss149.seq
 524290836     gbgss15.seq
 524289948     gbgss150.seq
 524289018     gbgss151.seq
 205352039     gbgss152.seq
 249997495     gbgss153.seq
 249999691     gbgss154.seq
 249999296     gbgss155.seq
 249999790     gbgss156.seq
  28694264     gbgss157.seq
 249997137     gbgss158.seq
 250000033     gbgss159.seq
 524290486     gbgss16.seq
 249998542     gbgss160.seq
 249998333     gbgss161.seq
 224919493     gbgss162.seq
 249998415     gbgss163.seq
 249998761     gbgss164.seq
 249998880     gbgss165.seq
 249998175     gbgss166.seq
 190065974     gbgss167.seq
 249999433     gbgss168.seq
 249998390     gbgss169.seq
 524288946     gbgss17.seq
 249999267     gbgss170.seq
 249997904     gbgss171.seq
 249996974     gbgss172.seq
  76835987     gbgss173.seq
 249998100     gbgss174.seq
   2079852     gbgss175.seq
  79542394     gbgss176.seq
 249999009     gbgss177.seq
 250000259     gbgss178.seq
  87380505     gbgss179.seq
 524291200     gbgss18.seq
 249999685     gbgss180.seq
 249998355     gbgss181.seq
 249998984     gbgss182.seq
 202719103     gbgss183.seq
 249999232     gbgss184.seq
 249999013     gbgss185.seq
 249998851     gbgss186.seq
 246250899     gbgss187.seq
 249999268     gbgss188.seq
 249997406     gbgss189.seq
 314849258     gbgss19.seq
 249999279     gbgss190.seq
 243520281     gbgss191.seq
 249999336     gbgss192.seq
 249997150     gbgss193.seq
 249998209     gbgss194.seq
 249998771     gbgss195.seq
 122182588     gbgss196.seq
 249998013     gbgss197.seq
 250000031     gbgss198.seq
 249999974     gbgss199.seq
 524289034     gbgss2.seq
 524288952     gbgss20.seq
 249998152     gbgss200.seq
  94058788     gbgss201.seq
 249998892     gbgss202.seq
 249999850     gbgss203.seq
 249998239     gbgss204.seq
 249999582     gbgss205.seq
 180308144     gbgss206.seq
 249999236     gbgss207.seq
 249997993     gbgss208.seq
 249998006     gbgss209.seq
 524289034     gbgss21.seq
 249999353     gbgss210.seq
  95926739     gbgss211.seq
 249999461     gbgss212.seq
 249999350     gbgss213.seq
 249998406     gbgss214.seq
 249998619     gbgss215.seq
 249999398     gbgss216.seq
 249999995     gbgss217.seq
  17245248     gbgss218.seq
 249999424     gbgss219.seq
 524291398     gbgss22.seq
 249999963     gbgss220.seq
 249997369     gbgss221.seq
  43648880     gbgss222.seq
  52862187     gbgss223.seq
 249999126     gbgss224.seq
 249999236     gbgss225.seq
 249997873     gbgss226.seq
 249998364     gbgss227.seq
  30976250     gbgss228.seq
 249997670     gbgss229.seq
 524291152     gbgss23.seq
 249997588     gbgss230.seq
 249999018     gbgss231.seq
 250000000     gbgss232.seq
  28042636     gbgss233.seq
 249997661     gbgss234.seq
 249998578     gbgss235.seq
 249999047     gbgss236.seq
 249997348     gbgss237.seq
 249999380     gbgss238.seq
 250000153     gbgss239.seq
 524291392     gbgss24.seq
 178837789     gbgss240.seq
 249999812     gbgss241.seq
 249998926     gbgss242.seq
 249999095     gbgss243.seq
 220154622     gbgss244.seq
 250000034     gbgss245.seq
 249997956     gbgss246.seq
 250000074     gbgss247.seq
 249998729     gbgss248.seq
 195288113     gbgss249.seq
 524290581     gbgss25.seq
 249999561     gbgss250.seq
 249998751     gbgss251.seq
 249999600     gbgss252.seq
 249999029     gbgss253.seq
 249999913     gbgss254.seq
  25748608     gbgss255.seq
 524290713     gbgss26.seq
 524289900     gbgss27.seq
 524288854     gbgss28.seq
 524289528     gbgss29.seq
 524289102     gbgss3.seq
 524290730     gbgss30.seq
  38753639     gbgss31.seq
 524289097     gbgss32.seq
 524290723     gbgss33.seq
 524288828     gbgss34.seq
 524289728     gbgss35.seq
 524289696     gbgss36.seq
 524289533     gbgss37.seq
 524290149     gbgss38.seq
 509095937     gbgss39.seq
 524290615     gbgss4.seq
 524291541     gbgss40.seq
 524289016     gbgss41.seq
 524291234     gbgss42.seq
  28742152     gbgss43.seq
 524288946     gbgss44.seq
 524291118     gbgss45.seq
 524291184     gbgss46.seq
 524290985     gbgss47.seq
 209346767     gbgss48.seq
 524291863     gbgss49.seq
 168350020     gbgss5.seq
 524291582     gbgss50.seq
 524290401     gbgss51.seq
 524290464     gbgss52.seq
 524290548     gbgss53.seq
 524290885     gbgss54.seq
 524289963     gbgss55.seq
 524289945     gbgss56.seq
 524290892     gbgss57.seq
 524290809     gbgss58.seq
 524290855     gbgss59.seq
 524290951     gbgss6.seq
   5859198     gbgss60.seq
 524289023     gbgss61.seq
 524290882     gbgss62.seq
 524290246     gbgss63.seq
 457238462     gbgss64.seq
 524291294     gbgss65.seq
 524291022     gbgss66.seq
 524290625     gbgss67.seq
 524289509     gbgss68.seq
 524291296     gbgss69.seq
 524289102     gbgss7.seq
 524290162     gbgss70.seq
 524290176     gbgss71.seq
 524290850     gbgss72.seq
 524289394     gbgss73.seq
 524291500     gbgss74.seq
 524290572     gbgss75.seq
 524290538     gbgss76.seq
  32490242     gbgss77.seq
 524289537     gbgss78.seq
 524291931     gbgss79.seq
 524291704     gbgss8.seq
 524289482     gbgss80.seq
 524290727     gbgss81.seq
 524289703     gbgss82.seq
 524289751     gbgss83.seq
 524289336     gbgss84.seq
 524290248     gbgss85.seq
 524289011     gbgss86.seq
 524292247     gbgss87.seq
 524290044     gbgss88.seq
 376569727     gbgss89.seq
 524290120     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249992912     gbhtc1.seq
 249998418     gbhtc10.seq
 249997449     gbhtc11.seq
  19305626     gbhtc12.seq
 249997534     gbhtc13.seq
 249996320     gbhtc14.seq
  64316003     gbhtc15.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  83873876     gbhtc8.seq
 249996616     gbhtc9.seq
 249904748     gbhtg1.seq
 249868447     gbhtg10.seq
 249917503     gbhtg100.seq
 249844944     gbhtg101.seq
 249902534     gbhtg102.seq
 249987029     gbhtg103.seq
   5671243     gbhtg104.seq
 249895732     gbhtg105.seq
 249878049     gbhtg106.seq
 249900433     gbhtg107.seq
 249915790     gbhtg108.seq
 249836851     gbhtg109.seq
   1107147     gbhtg11.seq
 249976359     gbhtg110.seq
 249780420     gbhtg111.seq
 249873742     gbhtg112.seq
 249970078     gbhtg113.seq
 167814795     gbhtg114.seq
 249997695     gbhtg115.seq
 249533556     gbhtg116.seq
 249988332     gbhtg117.seq
 249895879     gbhtg118.seq
 249822759     gbhtg119.seq
 249888470     gbhtg12.seq
  54512760     gbhtg120.seq
 249935891     gbhtg121.seq
 249834856     gbhtg122.seq
 249931131     gbhtg123.seq
 249875691     gbhtg124.seq
 249782400     gbhtg125.seq
 134760056     gbhtg126.seq
 249831507     gbhtg127.seq
 249847301     gbhtg128.seq
 249819096     gbhtg129.seq
 249970424     gbhtg13.seq
 249939383     gbhtg130.seq
 249998279     gbhtg131.seq
 249828527     gbhtg132.seq
 249872447     gbhtg133.seq
 249867339     gbhtg134.seq
 249854169     gbhtg135.seq
  76420905     gbhtg136.seq
 249587437     gbhtg14.seq
 249775919     gbhtg15.seq
 249742391     gbhtg16.seq
 249169910     gbhtg17.seq
 249983662     gbhtg18.seq
 249677291     gbhtg19.seq
 249994630     gbhtg2.seq
 249988730     gbhtg20.seq
 237145184     gbhtg21.seq
 249760624     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761207     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249841969     gbhtg29.seq
 249950135     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249920767     gbhtg33.seq
 249929437     gbhtg34.seq
 249919058     gbhtg35.seq
 249858205     gbhtg36.seq
 249814604     gbhtg37.seq
 249767419     gbhtg38.seq
 249627604     gbhtg39.seq
 249984089     gbhtg4.seq
 249839726     gbhtg40.seq
 224363115     gbhtg41.seq
 249889211     gbhtg42.seq
 249786793     gbhtg43.seq
 249972417     gbhtg44.seq
 249775813     gbhtg45.seq
 249913172     gbhtg46.seq
 249598316     gbhtg47.seq
 249865084     gbhtg48.seq
 249793045     gbhtg49.seq
 249882044     gbhtg5.seq
 249922715     gbhtg50.seq
 235040956     gbhtg51.seq
 249732687     gbhtg52.seq
 249918496     gbhtg53.seq
 249773162     gbhtg54.seq
 249971361     gbhtg55.seq
 249962512     gbhtg56.seq
  18795863     gbhtg57.seq
 249861195     gbhtg58.seq
 249939539     gbhtg59.seq
 249898460     gbhtg6.seq
 249990521     gbhtg60.seq
 249920304     gbhtg61.seq
 225327613     gbhtg62.seq
 249854005     gbhtg63.seq
 249787648     gbhtg64.seq
 249883720     gbhtg65.seq
 249980764     gbhtg66.seq
 249833261     gbhtg67.seq
  16614633     gbhtg68.seq
 249960711     gbhtg69.seq
 249933725     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249976832     gbhtg72.seq
 225068425     gbhtg73.seq
 249811217     gbhtg74.seq
 249874983     gbhtg75.seq
 249800230     gbhtg76.seq
 249959810     gbhtg77.seq
 244236211     gbhtg78.seq
 249883527     gbhtg79.seq
 249933567     gbhtg8.seq
 249989775     gbhtg80.seq
 249839558     gbhtg81.seq
 249838461     gbhtg82.seq
 216751380     gbhtg83.seq
 249966974     gbhtg84.seq
 249803194     gbhtg85.seq
 249757813     gbhtg86.seq
 249850131     gbhtg87.seq
 220831145     gbhtg88.seq
 249970053     gbhtg89.seq
 249923766     gbhtg9.seq
 249954204     gbhtg90.seq
 249999447     gbhtg91.seq
 249963669     gbhtg92.seq
 208918917     gbhtg93.seq
 249866049     gbhtg94.seq
 249911674     gbhtg95.seq
 249904005     gbhtg96.seq
 249769960     gbhtg97.seq
 167889754     gbhtg98.seq
 249744688     gbhtg99.seq
 249999729     gbinv1.seq
 249999464     gbinv10.seq
 249999214     gbinv11.seq
 167143988     gbinv12.seq
 249995378     gbinv13.seq
 249997995     gbinv14.seq
 249995483     gbinv15.seq
 150828588     gbinv16.seq
 249999928     gbinv17.seq
 248995288     gbinv18.seq
 249998320     gbinv19.seq
 249870004     gbinv2.seq
 249998808     gbinv20.seq
 238112954     gbinv21.seq
 220615455     gbinv22.seq
 175506919     gbinv23.seq
 249997791     gbinv24.seq
 249998477     gbinv25.seq
  80884318     gbinv26.seq
 249999550     gbinv27.seq
 249999259     gbinv28.seq
 249997711     gbinv29.seq
 212085004     gbinv3.seq
 184359498     gbinv30.seq
 249998496     gbinv4.seq
 249999334     gbinv5.seq
 249998974     gbinv6.seq
 249999025     gbinv7.seq
  16559478     gbinv8.seq
 249998289     gbinv9.seq
 144177333     gbjou1.idx
 300941919     gbjou10.idx
 261524780     gbjou11.idx
 247989182     gbjou12.idx
  47871838     gbjou13.idx
 140721978     gbjou2.idx
 172375994     gbjou3.idx
 184093434     gbjou4.idx
 269819877     gbjou5.idx
 278658578     gbjou6.idx
 281568666     gbjou7.idx
 280680781     gbjou8.idx
 305240627     gbjou9.idx
 340242625     gbkey1.idx
 180077814     gbkey2.idx
 180145860     gbkey3.idx
 184381414     gbkey4.idx
 301030822     gbkey5.idx
 137104095     gbkey6.idx
 249863224     gbmam1.seq
 249997261     gbmam2.seq
 249915148     gbmam3.seq
 249999577     gbmam4.seq
 250000224     gbmam5.seq
 250000032     gbmam6.seq
 249996816     gbmam7.seq
   3386287     gbmam8.seq
  36401723     gbnew.txt
 249999772     gbpat1.seq
 249999613     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192934428     gbpat107.seq
 249999496     gbpat108.seq
 249999625     gbpat109.seq
 179557952     gbpat11.seq
 249996328     gbpat110.seq
  80124329     gbpat111.seq
 249999327     gbpat112.seq
 250000261     gbpat113.seq
 249988052     gbpat114.seq
 249999878     gbpat115.seq
 249849703     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 250000152     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 249995214     gbpat13.seq
 249997452     gbpat130.seq
  66832984     gbpat131.seq
 249992315     gbpat132.seq
 249999867     gbpat133.seq
 250000197     gbpat134.seq
 249999821     gbpat135.seq
 249998337     gbpat136.seq
  18437114     gbpat137.seq
 249999655     gbpat138.seq
 249998828     gbpat139.seq
 249999071     gbpat14.seq
 249999803     gbpat140.seq
 220985436     gbpat141.seq
 249998039     gbpat142.seq
 250000068     gbpat143.seq
 250000015     gbpat144.seq
  86028783     gbpat145.seq
 249999922     gbpat146.seq
 249998356     gbpat147.seq
 249999124     gbpat148.seq
  63537091     gbpat149.seq
 249999991     gbpat15.seq
 249996936     gbpat150.seq
 249999968     gbpat151.seq
 249999470     gbpat152.seq
 249999961     gbpat153.seq
 250000095     gbpat154.seq
 249998310     gbpat155.seq
 222137448     gbpat156.seq
 250000249     gbpat157.seq
 249999893     gbpat158.seq
 249999893     gbpat159.seq
 249999915     gbpat16.seq
 220539897     gbpat160.seq
 249999753     gbpat161.seq
 249998599     gbpat162.seq
 249999673     gbpat163.seq
  12381933     gbpat164.seq
 249997013     gbpat165.seq
 249998113     gbpat166.seq
 249999975     gbpat167.seq
 249999201     gbpat168.seq
  35343603     gbpat169.seq
  65896429     gbpat17.seq
 249998580     gbpat170.seq
 249998996     gbpat171.seq
 249998092     gbpat172.seq
 250000010     gbpat173.seq
 249999842     gbpat174.seq
 249999544     gbpat175.seq
 249993849     gbpat176.seq
 249999604     gbpat177.seq
 165992988     gbpat178.seq
 250000027     gbpat18.seq
 249999801     gbpat19.seq
 249998573     gbpat2.seq
 249999076     gbpat20.seq
 249996990     gbpat21.seq
 185825051     gbpat22.seq
 249998934     gbpat23.seq
 249858647     gbpat24.seq
 249999397     gbpat25.seq
 249999337     gbpat26.seq
  71191909     gbpat27.seq
 249986100     gbpat28.seq
 249998620     gbpat29.seq
 249999135     gbpat3.seq
 249997666     gbpat30.seq
 249999841     gbpat31.seq
 250000175     gbpat32.seq
 180194091     gbpat33.seq
 249997878     gbpat34.seq
 249999688     gbpat35.seq
 249999436     gbpat36.seq
 250000186     gbpat37.seq
 130533969     gbpat38.seq
 249996407     gbpat39.seq
 249997195     gbpat4.seq
 249993739     gbpat40.seq
 249999063     gbpat41.seq
 249999040     gbpat42.seq
 249997287     gbpat43.seq
 249845172     gbpat44.seq
 249999190     gbpat45.seq
 250000090     gbpat46.seq
 171467978     gbpat47.seq
 249999830     gbpat48.seq
 249998527     gbpat49.seq
  71727149     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164989556     gbpat56.seq
 249883080     gbpat57.seq
 249996731     gbpat58.seq
 250000139     gbpat59.seq
 249999527     gbpat6.seq
 249998980     gbpat60.seq
 134927252     gbpat61.seq
 249998969     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999505     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249998882     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244403359     gbpat72.seq
 248969066     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999901     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249992125     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 250000008     gbpat82.seq
 249998696     gbpat83.seq
  93332873     gbpat84.seq
 249155886     gbpat85.seq
 249999519     gbpat86.seq
 249999665     gbpat87.seq
 249999359     gbpat88.seq
 249999368     gbpat89.seq
 249999906     gbpat9.seq
 250000155     gbpat90.seq
 145293161     gbpat91.seq
 249999199     gbpat92.seq
 249998980     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196964910     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 185841667     gbphg1.seq
 249997631     gbpln1.seq
 249999556     gbpln10.seq
 249994685     gbpln11.seq
 249999246     gbpln12.seq
 249769731     gbpln13.seq
 214812798     gbpln14.seq
 249998215     gbpln15.seq
 249985349     gbpln16.seq
 249996352     gbpln17.seq
 249709069     gbpln18.seq
 249989832     gbpln19.seq
 249938758     gbpln2.seq
 249606536     gbpln20.seq
 249997642     gbpln21.seq
  33449513     gbpln22.seq
 249992320     gbpln23.seq
  97645141     gbpln24.seq
 249998136     gbpln25.seq
 249998874     gbpln26.seq
 249472852     gbpln27.seq
 221100868     gbpln28.seq
 241343526     gbpln29.seq
 249948110     gbpln3.seq
 249951013     gbpln30.seq
 246853724     gbpln31.seq
 249999150     gbpln32.seq
 249999324     gbpln33.seq
 245668851     gbpln34.seq
 249995400     gbpln35.seq
 249998588     gbpln36.seq
 249998532     gbpln37.seq
 250000234     gbpln38.seq
 142563490     gbpln39.seq
 249894700     gbpln4.seq
 249826526     gbpln40.seq
 249853383     gbpln41.seq
 249997520     gbpln42.seq
 249999982     gbpln43.seq
 249999187     gbpln44.seq
 189394474     gbpln45.seq
 249999237     gbpln46.seq
 248399690     gbpln47.seq
 249998824     gbpln48.seq
 249997630     gbpln49.seq
 249867158     gbpln5.seq
 249998257     gbpln50.seq
 249998650     gbpln51.seq
 249912401     gbpln52.seq
 249996918     gbpln53.seq
 249998794     gbpln54.seq
  57105586     gbpln55.seq
 249895931     gbpln6.seq
 249859070     gbpln7.seq
 249998883     gbpln8.seq
  33062871     gbpln9.seq
 148952874     gbpri1.seq
 249783195     gbpri10.seq
 129741660     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902483     gbpri16.seq
 249876241     gbpri17.seq
 249991978     gbpri18.seq
 249903004     gbpri19.seq
 249951019     gbpri2.seq
 249948092     gbpri20.seq
 249949220     gbpri21.seq
 249999774     gbpri22.seq
  30697664     gbpri23.seq
 177481322     gbpri24.seq
 249998934     gbpri25.seq
 211358086     gbpri26.seq
 249987118     gbpri27.seq
 249988725     gbpri28.seq
 249948820     gbpri29.seq
 250000076     gbpri3.seq
 249935405     gbpri30.seq
 249945956     gbpri31.seq
 249974525     gbpri32.seq
 249821502     gbpri33.seq
 250000227     gbpri34.seq
  95881809     gbpri35.seq
 249993971     gbpri36.seq
 249998020     gbpri37.seq
 249997182     gbpri38.seq
 249995558     gbpri39.seq
 249968482     gbpri4.seq
 249998324     gbpri40.seq
 181996994     gbpri41.seq
 249998670     gbpri42.seq
 249998835     gbpri43.seq
 249821421     gbpri44.seq
   2823579     gbpri45.seq
 249956957     gbpri5.seq
 249788332     gbpri6.seq
 249806906     gbpri7.seq
 249867498     gbpri8.seq
 249957345     gbpri9.seq
    327109     gbrel.txt
 249731024     gbrod1.seq
 249752589     gbrod10.seq
  62793496     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249824125     gbrod18.seq
 244529626     gbrod19.seq
 249935265     gbrod2.seq
 249768065     gbrod20.seq
 249924095     gbrod21.seq
 230194968     gbrod22.seq
 249997417     gbrod23.seq
 249998350     gbrod24.seq
 249980494     gbrod25.seq
 249698931     gbrod26.seq
 249999786     gbrod27.seq
 249997389     gbrod28.seq
 205380887     gbrod29.seq
 249991951     gbrod3.seq
 249987556     gbrod4.seq
 249882212     gbrod5.seq
 249882945     gbrod6.seq
 249748846     gbrod7.seq
 249881291     gbrod8.seq
 249819838     gbrod9.seq
4175287636     gbsdr1.txt
5811623920     gbsdr2.txt
2713719078     gbsdr3.txt
 158159680     gbsec.idx
 249999192     gbsts1.seq
 249997720     gbsts10.seq
 210919464     gbsts11.seq
 249996524     gbsts12.seq
 249999349     gbsts13.seq
 249999266     gbsts14.seq
 249999572     gbsts15.seq
  24470469     gbsts16.seq
 249999107     gbsts17.seq
 249997897     gbsts18.seq
 249999071     gbsts19.seq
 249998220     gbsts2.seq
 148702344     gbsts20.seq
 249999008     gbsts3.seq
 249998277     gbsts4.seq
  39162150     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998706     gbsts9.seq
 249999701     gbsyn1.seq
 249999343     gbsyn2.seq
 249947975     gbsyn3.seq
 249993942     gbsyn4.seq
 249973892     gbsyn5.seq
 249963517     gbsyn6.seq
 135898060     gbsyn7.seq
 249999888     gbtsa1.seq
 249996639     gbtsa10.seq
 249999168     gbtsa11.seq
 127105887     gbtsa12.seq
 249997835     gbtsa13.seq
 249999221     gbtsa14.seq
 249998017     gbtsa15.seq
 249997884     gbtsa16.seq
 167500778     gbtsa17.seq
 249998217     gbtsa18.seq
 250000150     gbtsa19.seq
 249997963     gbtsa2.seq
 249998775     gbtsa20.seq
 249998636     gbtsa21.seq
 249998457     gbtsa22.seq
 249998315     gbtsa23.seq
  30034786     gbtsa24.seq
 249998710     gbtsa25.seq
 249998636     gbtsa26.seq
 249991951     gbtsa27.seq
 249997904     gbtsa28.seq
 250000251     gbtsa29.seq
 249998332     gbtsa3.seq
 249999084     gbtsa30.seq
 204335460     gbtsa31.seq
 249998534     gbtsa32.seq
 249999961     gbtsa33.seq
 249999936     gbtsa34.seq
 249997768     gbtsa35.seq
 249999157     gbtsa36.seq
 249998098     gbtsa37.seq
 249998715     gbtsa38.seq
 249999115     gbtsa39.seq
 250000057     gbtsa4.seq
  15553749     gbtsa40.seq
 249998020     gbtsa41.seq
 249998684     gbtsa42.seq
 249999831     gbtsa43.seq
 249998532     gbtsa44.seq
 249997114     gbtsa45.seq
 249998215     gbtsa46.seq
 249997456     gbtsa47.seq
 155688166     gbtsa48.seq
 249997344     gbtsa49.seq
  83183501     gbtsa5.seq
 249997941     gbtsa50.seq
 249996156     gbtsa51.seq
 249999083     gbtsa52.seq
 249998677     gbtsa53.seq
 172935945     gbtsa54.seq
 250000247     gbtsa55.seq
 249999708     gbtsa56.seq
 249999356     gbtsa57.seq
 249999756     gbtsa58.seq
 250000031     gbtsa59.seq
 249999109     gbtsa6.seq
 249999361     gbtsa60.seq
  22687922     gbtsa61.seq
 249997173     gbtsa62.seq
 249999729     gbtsa63.seq
 250000141     gbtsa64.seq
 249998385     gbtsa65.seq
 249996693     gbtsa66.seq
 249999173     gbtsa67.seq
 249999990     gbtsa68.seq
 249996036     gbtsa69.seq
 249996202     gbtsa7.seq
 128381210     gbtsa70.seq
 249998532     gbtsa8.seq
 249999947     gbtsa9.seq
    486108     gbuna1.seq
 249998427     gbvrl1.seq
 249999520     gbvrl10.seq
 165621259     gbvrl11.seq
 249993743     gbvrl12.seq
 249997548     gbvrl13.seq
 249996976     gbvrl14.seq
 249991350     gbvrl15.seq
 249993971     gbvrl16.seq
 249844634     gbvrl17.seq
 249999266     gbvrl18.seq
 249993875     gbvrl19.seq
 249999513     gbvrl2.seq
 148266556     gbvrl20.seq
 249997872     gbvrl3.seq
 249997214     gbvrl4.seq
 191368692     gbvrl5.seq
 249999338     gbvrl6.seq
 249998887     gbvrl7.seq
 249998197     gbvrl8.seq
 249999975     gbvrl9.seq
 249938560     gbvrt1.seq
 249762539     gbvrt10.seq
 249940020     gbvrt11.seq
 185678776     gbvrt12.seq
 249995062     gbvrt13.seq
 249964366     gbvrt14.seq
 249996404     gbvrt15.seq
 249998282     gbvrt16.seq
 249998297     gbvrt17.seq
 250000127     gbvrt18.seq
  98577409     gbvrt19.seq
 249995736     gbvrt2.seq
 249995733     gbvrt20.seq
 249997104     gbvrt21.seq
 249979155     gbvrt22.seq
 249999872     gbvrt23.seq
 249999859     gbvrt24.seq
 249999045     gbvrt25.seq
  83838791     gbvrt26.seq
 249934937     gbvrt3.seq
 249768425     gbvrt4.seq
 100497394     gbvrt5.seq
 249996380     gbvrt6.seq
 249995207     gbvrt7.seq
 249833417     gbvrt8.seq
 249951536     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64162      86080328
BCT10        64         115520696
BCT11        93         115223175
BCT12        93         109185533
BCT13        7793       113444113
BCT14        8338       10075530
BCT15        53933      85390803
BCT16        93         110189094
BCT17        151        93915681
BCT18        61         112455059
BCT19        52         112042350
BCT2         4948       109068556
BCT20        46         114233015
BCT21        58         114931588
BCT22        67         111284815
BCT23        36         96325907
BCT24        40         106881287
BCT25        58         105533856
BCT26        74         111675186
BCT27        55         110045255
BCT28        63         106845575
BCT29        55         109391288
BCT3         52         112655257
BCT30        53         108650404
BCT31        46         110496749
BCT32        95         109522868
BCT33        59         110966729
BCT34        67         108616570
BCT35        124        106350090
BCT36        36         69419425
BCT37        202        109105429
BCT38        51         109861512
BCT39        40         106911174
BCT4         55         106656794
BCT40        54         104252121
BCT41        58         107350200
BCT42        44         110960713
BCT43        80         107599606
BCT44        52         108571742
BCT45        46         107138318
BCT46        63         108219635
BCT47        79         107098072
BCT48        62         73603411
BCT49        68         110616305
BCT5         38315      81647768
BCT50        66         105738712
BCT51        49         103628191
BCT52        53         107838942
BCT53        54         107298795
BCT54        66         110212402
BCT55        63         106817738
BCT56        51         108471276
BCT57        60         113686383
BCT58        68         109914717
BCT59        48         109532317
BCT6         39042      82648391
BCT60        61         90279038
BCT61        40         109701549
BCT62        52         113982100
BCT63        83         116758809
BCT64        220        98340538
BCT65        389        55259308
BCT66        1589       2511877
BCT67        3179       5215895
BCT68        6347       7901828
BCT69        12648      15076979
BCT7         5522       96143938
BCT70        25628      27748204
BCT71        50523      53996220
BCT72        76351      77609712
BCT73        71503      77181395
BCT74        9524       94049884
BCT75        5590       104225809
BCT76        3050       104489120
BCT77        65         115712583
BCT78        4225       110939141
BCT79        21695      99799637
BCT8         13867      90150583
BCT80        22504      23359041
BCT81        68103      85895421
BCT82        31596      111221264
BCT83        76398      79491548
BCT84        64653      85585361
BCT85        21105      40373993
BCT9         6748       96304913
ENV1         94213      70705785
ENV10        83201      87256788
ENV11        20310      17512135
ENV12        84823      80873858
ENV13        120494     43465331
ENV14        88806      78124204
ENV15        96617      67733009
ENV16        96143      63502826
ENV17        112423     66792917
ENV18        112950     70114238
ENV19        51886      70059059
ENV2         91585      69030501
ENV20        68113      87692396
ENV21        91170      74656692
ENV22        128361     34412396
ENV23        123053     29095263
ENV24        77642      17797356
ENV25        123134     49867851
ENV26        97603      67837218
ENV27        115950     56102521
ENV28        136476     52688249
ENV29        110004     58709432
ENV3         85163      75461795
ENV30        56068      46860816
ENV31        71058      96548027
ENV32        95504      69634320
ENV33        105832     43038437
ENV34        90015      65250644
ENV35        58832      38488756
ENV36        111420     47249247
ENV37        102063     61145968
ENV38        107479     64238692
ENV39        66718      95281124
ENV4         81850      84109517
ENV40        76838      85407221
ENV41        63898      86835521
ENV42        80136      85233862
ENV43        109372     47853380
ENV44        113829     56804287
ENV45        104169     61243608
ENV46        29564      22854086
ENV47        98105      43605859
ENV48        42795      53982085
ENV49        42416      55310678
ENV5         87667      86739492
ENV50        62894      61534026
ENV51        103562     56109276
ENV52        95970      67690424
ENV53        6211       6259708
ENV6         99659      61449435
ENV7         131779     31253773
ENV8         86336      70531906
ENV9         93292      72987644
EST1         158932     61578479
EST10        167384     72121450
EST100       232216     141229287
EST101       239049     125498755
EST102       191374     104203328
EST103       183073     101721433
EST104       100126     70188276
EST105       160250     119698853
EST106       172068     105366985
EST107       134990     84867353
EST108       64419      24043353
EST109       63773      22429095
EST11        169596     74019620
EST110       64301      23297395
EST111       64313      27058057
EST112       64822      23116602
EST113       65042      24777934
EST114       63924      27190827
EST115       64306      26428083
EST116       64500      27441777
EST117       64330      25261011
EST118       61689      34861993
EST119       142728     68764528
EST12        166774     70072448
EST120       160952     85082333
EST121       177247     92936236
EST122       149335     96411791
EST123       156344     91876388
EST124       120667     78448680
EST125       189547     90842635
EST126       156020     83044793
EST127       157432     84537112
EST128       156646     84683208
EST129       151526     85005646
EST13        72698      34849615
EST130       173194     92948381
EST131       183307     116945010
EST132       202644     102517014
EST133       159215     87090253
EST134       162949     82933097
EST135       142152     83534492
EST136       144874     89606793
EST137       100368     53537057
EST138       173661     98097819
EST139       245088     113014563
EST14        217838     109343769
EST140       154481     83530524
EST141       167281     92280675
EST142       150583     88021841
EST143       133673     81794901
EST144       154305     96690704
EST145       156263     85815443
EST146       124519     63480525
EST147       121486     65239362
EST148       128033     57985231
EST149       127406     51289631
EST15        168614     105338224
EST150       128746     51310533
EST151       114469     42656777
EST152       163868     82710511
EST153       176184     73808792
EST154       162268     110248270
EST155       200071     122703022
EST156       214234     121749827
EST157       175555     97199900
EST158       154925     108273694
EST159       141883     95228538
EST16        178896     112376702
EST160       154957     96144529
EST161       157570     82600116
EST162       139422     78454384
EST163       167646     93244672
EST164       71350      44389422
EST165       149811     91582172
EST166       191842     110270364
EST167       145792     83952102
EST168       142903     72445668
EST169       149074     87099616
EST17        195365     112888403
EST170       190815     104735686
EST171       156517     95970823
EST172       168611     82506591
EST173       125253     86481925
EST174       170276     99777392
EST175       173366     100656755
EST176       122297     68060030
EST177       156951     90277178
EST178       36435      21155183
EST179       169618     102489444
EST18        190600     121507798
EST180       180469     118990336
EST181       143358     116905604
EST182       196491     100136090
EST183       153069     103373147
EST184       154688     101408291
EST185       141172     81675743
EST186       176164     71359078
EST187       150729     84635825
EST188       157698     99727963
EST189       156026     96178675
EST19        159450     114180730
EST190       139836     83260089
EST191       162580     98242763
EST192       145211     92961851
EST193       128726     90041346
EST194       144593     88309627
EST195       135536     88230552
EST196       129452     92543992
EST197       162243     86661813
EST198       173907     95675577
EST199       173405     96487211
EST2         161860     61550624
EST20        186883     99412580
EST200       171644     95246748
EST201       168922     95195497
EST202       171337     95774906
EST203       173197     95031021
EST204       173938     95718287
EST205       27882      15128157
EST206       188685     105126478
EST207       204877     104651788
EST208       172463     102202121
EST209       180099     101691680
EST21        217103     106393398
EST210       200705     122501280
EST211       194157     112118853
EST212       193510     123876517
EST213       157228     103960657
EST214       218812     141916539
EST215       236736     114648394
EST216       145565     103218147
EST217       162226     109301975
EST218       147330     94845693
EST219       177610     98529905
EST22        198877     65990714
EST220       189865     118167864
EST221       111651     87750757
EST222       134717     121226788
EST223       160155     93104966
EST224       148125     95196766
EST225       195149     107691572
EST226       166256     104042756
EST227       134210     92480729
EST228       142126     105317535
EST229       120942     87056348
EST23        141018     40099130
EST230       89638      60475626
EST231       144652     89900997
EST232       132134     93891419
EST233       142317     101310212
EST234       120118     86587828
EST235       125365     84225893
EST236       155510     107959167
EST237       159403     115443099
EST238       119508     122109899
EST239       147901     88896939
EST24        103790     28102413
EST240       184180     119214969
EST241       151711     92267105
EST242       170272     107791482
EST243       168054     121398572
EST244       145113     107989812
EST245       12971      9678788
EST246       155326     99989843
EST247       211413     97479907
EST248       187717     111530409
EST249       152176     86808506
EST25        121275     50794232
EST250       220342     27649171
EST251       221258     90060306
EST252       163443     120935271
EST253       174677     102290813
EST254       161984     107654996
EST255       175937     115401707
EST256       156199     114473783
EST257       99499      53922294
EST258       185660     97472528
EST259       177331     104386043
EST26        213566     97094574
EST260       166017     119646227
EST261       213482     102960447
EST262       271899     118992630
EST263       210078     121329321
EST264       182172     40491392
EST265       244678     112790883
EST266       168758     97452125
EST267       168109     105525988
EST268       91815      57379176
EST269       165531     113935582
EST27        219263     110239962
EST270       198830     103245559
EST271       155624     106032716
EST272       195444     114980818
EST273       197340     49946108
EST274       208517     42424059
EST275       181446     103176132
EST276       169950     114892587
EST277       185717     115670542
EST278       181695     109078782
EST279       156905     101673582
EST28        190467     88601230
EST280       107841     37344621
EST281       143437     86877223
EST282       119164     79296267
EST283       155950     106083791
EST284       247076     37086158
EST285       263884     24185103
EST286       168415     90796834
EST287       167479     109886923
EST288       160595     103952503
EST289       147149     91760601
EST29        158040     68888392
EST290       263043     38157658
EST291       175731     96471944
EST292       66520      50120975
EST293       194329     110878674
EST294       143252     78825666
EST295       183170     119136871
EST296       183197     112461528
EST297       153683     111903121
EST298       192137     107429859
EST299       177874     99893228
EST3         153644     54437600
EST30        171553     69641748
EST300       174773     110155639
EST301       188995     63437396
EST302       187078     69016528
EST303       187611     72818786
EST304       125214     45373251
EST305       191230     89846078
EST306       181275     127352574
EST307       158963     92977616
EST308       155334     90429819
EST309       127297     99048519
EST31        148836     63210737
EST310       148700     98828921
EST311       165608     100460210
EST312       164646     92448828
EST313       171502     102942707
EST314       150258     99210294
EST315       150184     101493034
EST316       164803     107898001
EST317       149771     103689492
EST318       180085     152161556
EST319       173044     113514303
EST32        168367     76122216
EST320       141883     76119370
EST321       143240     97613552
EST322       144927     99502657
EST323       132590     89349450
EST324       149633     99767529
EST325       150477     102011689
EST326       177873     111144016
EST327       151506     83743122
EST328       150733     86371983
EST329       151967     107655438
EST33        173906     66567681
EST330       156361     97008880
EST331       75681      45956729
EST332       142968     90532883
EST333       142929     89593066
EST334       209440     112527130
EST335       130092     71832987
EST336       92275      55615610
EST337       131689     87120460
EST338       137935     87525775
EST339       124440     79213874
EST34        122965     43326123
EST340       167383     85570246
EST341       212777     84744392
EST342       166953     88179181
EST343       175088     104703910
EST344       161773     96782545
EST345       83522      55747465
EST346       133360     88905721
EST347       136677     89442710
EST348       190452     121408611
EST349       157008     96398834
EST35        97391      29892325
EST350       162320     81745164
EST351       185155     130451837
EST352       109805     74759981
EST353       73473      43625440
EST354       142284     79069193
EST355       130779     78156939
EST356       150483     53762921
EST357       158498     32718808
EST358       158573     32533413
EST359       184296     113495154
EST36        97797      30582586
EST360       5944       4240922
EST361       229390     116859858
EST362       250944     114663016
EST363       197334     103799271
EST364       146743     94472859
EST365       136180     87024305
EST366       147045     87147523
EST367       184176     114018990
EST368       226122     77353113
EST369       186892     101073109
EST37        96710      29348028
EST370       218905     121337885
EST371       151563     82314691
EST372       142507     68433019
EST373       199233     122171561
EST374       157519     99832226
EST375       170798     130274295
EST376       182956     145228897
EST377       156546     92572171
EST378       164006     104988610
EST379       187202     110523212
EST38        98629      29837400
EST380       204906     111409963
EST381       194291     108828240
EST382       194308     119343915
EST383       125727     85044258
EST384       198427     131830846
EST385       217600     135159191
EST386       205354     145904795
EST387       212892     163640002
EST388       183880     102530994
EST389       197353     112297908
EST39        99434      31229774
EST390       171286     27391125
EST391       161919     13428167
EST392       156606     22685352
EST393       158379     32997219
EST394       159072     31337631
EST395       55864      11768444
EST396       148102     86461114
EST397       182280     108234299
EST398       163132     112984807
EST399       167467     97716955
EST4         170812     67108330
EST40        23076      5878878
EST400       153312     105825247
EST401       140402     97828221
EST402       144760     95397091
EST403       169649     115356572
EST404       144020     100951684
EST405       174765     103245347
EST406       172427     39945743
EST407       165924     54733358
EST408       145525     101972834
EST409       161718     102245438
EST41        101025     52987591
EST410       166833     108337388
EST411       146842     87896829
EST412       196333     118509890
EST413       148879     102218512
EST414       133043     91209877
EST415       148050     92560237
EST416       157439     94648882
EST417       172254     93463866
EST418       165951     97433605
EST419       160408     95293501
EST42        119533     50861384
EST420       173374     106250071
EST421       140211     88340943
EST422       3222       2352708
EST423       100982     72232372
EST424       79364      60984652
EST425       106713     70193438
EST426       157348     86185580
EST427       126609     77274050
EST428       138419     90773398
EST429       141557     83185898
EST43        165833     91749823
EST430       166222     97085662
EST431       157058     87718862
EST432       195619     116483683
EST433       128248     85149841
EST434       184319     95268657
EST435       182259     89097858
EST436       158984     88820755
EST437       6764       4158502
EST438       169306     98874762
EST439       218749     127919676
EST44        170254     72255064
EST440       162392     110852156
EST441       167018     102578121
EST442       139959     90695380
EST443       136087     92151576
EST444       179446     79397611
EST445       189617     80345705
EST446       205876     86982162
EST447       201312     81493580
EST448       185050     104291938
EST449       124260     72424615
EST45        167198     84830922
EST450       206089     117628498
EST451       182198     112973501
EST452       178651     105126404
EST453       204660     124535646
EST454       137220     96354805
EST455       171931     106093648
EST456       176670     90431009
EST457       152926     86853240
EST458       165186     81815547
EST459       163132     58562700
EST46        168551     86869652
EST460       165424     62323855
EST461       45229      16088356
EST47        163230     87813268
EST48        162128     83269409
EST49        160116     91087098
EST5         168996     66194437
EST50        161625     88116218
EST51        157094     98901838
EST52        159519     69790594
EST53        145842     81630665
EST54        78052      50559365
EST55        167014     69863326
EST56        164649     74766409
EST57        164313     90712748
EST58        159162     97164593
EST59        156445     101474952
EST6         171504     66930687
EST60        164599     98904437
EST61        160080     107988987
EST62        171064     81471700
EST63        173205     92438726
EST64        155564     84205658
EST65        148960     81892229
EST66        158939     98557318
EST67        136005     77105049
EST68        149391     91669478
EST69        194646     107924049
EST7         169836     72796204
EST70        180856     95084462
EST71        221056     121160612
EST72        185403     110480451
EST73        204179     121541284
EST74        163378     90078078
EST75        133985     61439025
EST76        139684     68748140
EST77        154630     93999495
EST78        157915     100353546
EST79        141961     78477477
EST8         179388     72855972
EST80        52901      24643225
EST81        164341     100577778
EST82        212015     114868978
EST83        223666     123667556
EST84        200284     94211847
EST85        211020     93283331
EST86        162181     92865248
EST87        144102     86825952
EST88        164167     81090941
EST89        158119     79855149
EST9         168560     69305073
EST90        152928     102062112
EST91        152072     88946380
EST92        135050     87111324
EST93        156082     113065452
EST94        142345     104168873
EST95        143183     102383840
EST96        141176     97543929
EST97        147010     80970712
EST98        178650     111235772
EST99        225716     136688083
GSS1         200062     87617305
GSS10        132040     60283336
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167238     128921102
GSS104       149783     82569304
GSS105       191527     120854119
GSS106       167747     112125081
GSS107       197328     115524481
GSS108       204975     134770173
GSS109       209812     138225285
GSS11        137026     73963213
GSS110       207577     140849031
GSS111       206236     142443188
GSS112       205251     143737895
GSS113       205176     143937947
GSS114       202120     146641028
GSS115       182321     139890075
GSS116       18414      10874742
GSS117       132848     84052151
GSS118       169611     80019194
GSS119       184271     79450634
GSS12        147892     75892246
GSS120       170296     148327490
GSS121       177223     120247442
GSS122       184849     149514379
GSS123       192486     124724450
GSS124       187593     137833036
GSS125       192178     126797998
GSS126       190607     95460230
GSS127       166251     152986683
GSS128       164115     115658040
GSS129       66249      42508121
GSS13        145394     68606713
GSS130       171037     155489454
GSS131       172571     154290391
GSS132       172231     155358474
GSS133       173848     154157454
GSS134       172390     153324435
GSS135       184233     143887127
GSS136       182583     147198604
GSS137       163082     115404420
GSS138       206481     88587184
GSS139       265738     40933031
GSS14        169809     84775223
GSS140       265732     40962041
GSS141       57710      8854914
GSS142       256185     58367796
GSS143       253136     60903252
GSS144       193384     82083564
GSS145       194899     73133724
GSS146       185020     152902506
GSS147       179265     156889003
GSS148       172604     159200600
GSS149       193906     127560270
GSS15        161099     97662972
GSS150       245528     58765606
GSS151       210577     101885451
GSS152       92169      20153568
GSS153       87113      63992234
GSS154       83556      62806277
GSS155       103676     48621279
GSS156       68586      58475820
GSS157       7685       7033032
GSS158       68591      57924394
GSS159       69224      56650935
GSS16        172836     87033449
GSS160       69460      56187403
GSS161       71202      55998401
GSS162       68561      51865315
GSS163       75915      58209304
GSS164       87237      74898207
GSS165       81830      44609896
GSS166       92262      44834024
GSS167       63624      47799159
GSS168       77435      61351403
GSS169       69655      58699293
GSS17        183522     113500748
GSS170       67711      62706526
GSS171       61946      53348157
GSS172       95612      42935517
GSS173       21104      4920928
GSS174       112937     70876701
GSS175       823        560132
GSS176       23226      28867035
GSS177       109043     70652585
GSS178       84533      34668223
GSS179       35815      22222733
GSS18        192358     114306485
GSS180       103304     62490220
GSS181       102329     63761256
GSS182       104268     67656826
GSS183       82099      41276456
GSS184       83102      54651503
GSS185       95673      61335435
GSS186       107323     78547443
GSS187       106375     76684757
GSS188       106058     79947480
GSS189       103996     80016519
GSS19        114078     52104778
GSS190       76374      51039123
GSS191       104572     63292187
GSS192       109868     66415305
GSS193       106205     59313311
GSS194       68379      37446344
GSS195       69573      38736929
GSS196       37145      17774305
GSS197       85481      46023427
GSS198       97119      55907586
GSS199       94982      49597190
GSS2         182294     92190593
GSS20        181789     101771260
GSS200       96286      55922591
GSS201       42132      23615490
GSS202       114638     43642267
GSS203       117085     39368203
GSS204       108676     55514545
GSS205       101471     78372335
GSS206       71604      45899517
GSS207       95891      36542252
GSS208       95417      37268709
GSS209       96671      35161518
GSS21        166208     114173594
GSS210       94285      39167432
GSS211       37736      17626556
GSS212       103939     66277823
GSS213       94551      61190929
GSS214       95128      60357048
GSS215       94773      60868501
GSS216       75675      70017159
GSS217       75117      74330280
GSS218       4473       7127270
GSS219       83736      28233267
GSS22        169506     97609042
GSS220       84219      27346468
GSS221       84926      25909272
GSS222       14851      4422302
GSS223       16547      7508221
GSS224       92377      59458826
GSS225       84657      52502700
GSS226       94076      50770605
GSS227       88581      48350254
GSS228       10980      5983348
GSS229       90648      56882510
GSS23        187251     126687349
GSS230       89662      61882079
GSS231       88553      63641206
GSS232       89283      62505584
GSS233       9890       7129098
GSS234       87995      63795538
GSS235       90217      62488977
GSS236       94643      59915214
GSS237       74331      63055090
GSS238       84246      78879440
GSS239       83027      80589521
GSS24        194057     130219707
GSS240       70483      52650376
GSS241       117650     64297121
GSS242       108874     55446727
GSS243       107533     52125503
GSS244       96658      43251344
GSS245       109801     49060015
GSS246       98194      46325477
GSS247       73059      72225597
GSS248       76682      71142435
GSS249       72980      46435649
GSS25        177481     105207105
GSS250       94787      57200301
GSS251       93517      59081345
GSS252       93900      58510429
GSS253       94714      57307691
GSS254       94197      58070562
GSS255       10381      4888399
GSS26        185918     107808246
GSS27        170600     151419573
GSS28        190494     146229226
GSS29        151147     106441309
GSS3         174946     87827370
GSS30        192451     132131298
GSS31        13629      8773195
GSS32        196044     127318947
GSS33        216659     116231837
GSS34        218573     113602417
GSS35        219720     112025390
GSS36        213958     121897898
GSS37        198560     156434224
GSS38        194984     146797396
GSS39        197244     73372753
GSS4         167155     85101061
GSS40        185067     97681159
GSS41        189782     125958599
GSS42        170343     158770231
GSS43        9057       5889153
GSS44        183999     100320381
GSS45        173032     121667203
GSS46        185089     124655109
GSS47        190835     122398633
GSS48        70733      62564650
GSS49        171799     101963548
GSS5         53445      31617730
GSS50        167647     103037030
GSS51        167798     102616122
GSS52        184194     121477291
GSS53        184774     116632196
GSS54        181686     122485290
GSS55        187531     113994336
GSS56        189392     134519036
GSS57        178947     104938173
GSS58        195714     120562148
GSS59        179925     133347010
GSS6         161617     84471320
GSS60        1899       1719195
GSS61        172844     138948397
GSS62        161635     111553347
GSS63        161673     111572480
GSS64        158827     107592995
GSS65        156768     129062324
GSS66        170185     142553826
GSS67        179844     117096102
GSS68        204911     127968663
GSS69        193332     110756601
GSS7         165322     79361222
GSS70        243921     125965583
GSS71        160206     106329772
GSS72        159349     119781671
GSS73        162663     124539163
GSS74        162629     124600831
GSS75        175106     108958250
GSS76        190310     140120691
GSS77        13118      7645896
GSS78        199135     126616367
GSS79        170370     111603100
GSS8         165782     88979718
GSS80        200718     131518447
GSS81        211575     85835271
GSS82        187842     98659368
GSS83        131802     92017231
GSS84        146986     118083551
GSS85        139587     116995322
GSS86        142817     114062378
GSS87        144008     119847686
GSS88        141842     115691442
GSS89        106718     88926972
GSS9         137999     67157765
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        54086      70649526
HTC11        81570      70440536
HTC12        4578       5328118
HTC13        66993      60073171
HTC14        68556      69499762
HTC15        23915      16110324
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         60867      78012683
HTG1         1318       188771164
HTG10        1298       186340737
HTG100       990        189440077
HTG101       996        189331054
HTG102       985        189419172
HTG103       1161       190585510
HTG104       30         4314892
HTG105       1087       189830459
HTG106       1045       189717260
HTG107       1388       191466263
HTG108       1297       190889828
HTG109       1631       191092465
HTG11        6          837687
HTG110       1345       192062486
HTG111       1298       191976235
HTG112       1307       190136719
HTG113       1057       186193849
HTG114       787        126039234
HTG115       1507       182670439
HTG116       1000       191646810
HTG117       928        180615941
HTG118       1077       193771910
HTG119       1103       193021003
HTG12        1452       184004673
HTG120       225        42236728
HTG121       1029       189520679
HTG122       1054       192676832
HTG123       1164       192084660
HTG124       1083       192945775
HTG125       1083       192937725
HTG126       590        104030016
HTG127       1122       192568597
HTG128       1080       192404608
HTG129       1078       192329473
HTG13        875        191786413
HTG130       1167       192001881
HTG131       1561       191903933
HTG132       1069       192200929
HTG133       1070       192324820
HTG134       1129       191775935
HTG135       1434       188074063
HTG136       410        54193644
HTG14        753        191921309
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2470       186037380
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185208586
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2550       188439001
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190634433
HTG47        1176       190820695
HTG48        1128       191224702
HTG49        1046       191244150
HTG5         1283       185453274
HTG50        1030       189619303
HTG51        1042       178756613
HTG52        968        190052338
HTG53        1105       190148899
HTG54        1046       190158403
HTG55        1014       189831932
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1031       189990377
HTG6         1273       185124562
HTG60        1078       187304761
HTG61        1125       188306505
HTG62        988        170992054
HTG63        1085       189487801
HTG64        1064       189415560
HTG65        1169       188798107
HTG66        1179       187545797
HTG67        1282       184397923
HTG68        94         12194080
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187688486
HTG73        1019       170126516
HTG74        1118       188293510
HTG75        1103       190775743
HTG76        1135       190789237
HTG77        1182       190871034
HTG78        1096       185997580
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190063261
HTG81        1213       189874691
HTG82        1120       189645029
HTG83        959        164682536
HTG84        1229       188409093
HTG85        1250       187741728
HTG86        1141       189879061
HTG87        1144       189686641
HTG88        978        167870813
HTG89        1182       189961005
HTG9         1200       186916809
HTG90        1104       190233697
HTG91        1146       190217975
HTG92        1109       190471215
HTG93        962        159420591
HTG94        1056       190751235
HTG95        1160       190986098
HTG96        1031       189156227
HTG97        1071       189497493
HTG98        684        127508859
HTG99        1018       189641315
INV1         94030      48425184
INV10        58410      86358231
INV11        83450      65367671
INV12        55761      44093490
INV13        84914      66260819
INV14        80842      66937694
INV15        78403      68066612
INV16        45955      42207642
INV17        33789      109968824
INV18        2848       147829211
INV19        47139      107525912
INV2         20175      157140059
INV20        77367      55604224
INV21        69166      59605112
INV22        20263      125328512
INV23        6          133712559
INV24        53996      99286268
INV25        79019      53690720
INV26        24490      18580231
INV27        79338      56093644
INV28        78405      61339525
INV29        71848      45444078
INV3         1591       157167189
INV30        30770      73804443
INV4         3882       133970248
INV5         78846      73618689
INV6         55455      96067466
INV7         53617      88152477
INV8         5327       4862617
INV9         80576      71773092
MAM1         15788      161831171
MAM2         20030      157499285
MAM3         58763      82886123
MAM4         8181       184063878
MAM5         79439      74704525
MAM6         52115      121062132
MAM7         72484      64821841
MAM8         982        1010908
PAT1         222552     70120341
PAT10        124455     102575240
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224730     34113420
PAT109       250080     15844360
PAT11        98617      64109656
PAT110       180680     63677151
PAT111       51648      26046194
PAT112       114183     110462028
PAT113       137705     83279098
PAT114       164161     99347886
PAT115       158877     103325984
PAT116       137417     114988187
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142065     62828791
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105888     59875034
PAT130       44618      171217879
PAT131       9167       47581637
PAT132       33645      178334734
PAT133       153558     109675196
PAT134       178705     90913377
PAT135       136049     115324159
PAT136       120392     123342367
PAT137       8527       8992390
PAT138       155429     101473147
PAT139       184764     88815933
PAT14        103642     50160321
PAT140       182409     85292093
PAT141       158459     76051815
PAT142       203662     47737230
PAT143       277828     9627968
PAT144       220409     46465135
PAT145       106719     2881142
PAT146       270386     21672571
PAT147       186751     61239638
PAT148       109801     106056999
PAT149       47516      9550419
PAT15        121148     53317075
PAT150       87299      88249520
PAT151       78465      95588128
PAT152       145199     77694828
PAT153       167500     71382695
PAT154       121465     92942668
PAT155       102978     85383928
PAT156       165566     46016231
PAT157       270022     5130418
PAT158       269978     5129582
PAT159       269978     5129582
PAT16        113137     61274458
PAT160       237888     4519872
PAT161       269396     5118524
PAT162       235480     25575098
PAT163       203734     47154417
PAT164       12033      422577
PAT165       165317     74871979
PAT166       91686      126656173
PAT167       172589     71662882
PAT168       137861     72260460
PAT169       9532       13982682
PAT17        39159      16235508
PAT170       93111      87244841
PAT171       91681      79829797
PAT172       83213      91467896
PAT173       109151     53717404
PAT174       137256     66884705
PAT175       91439      135332665
PAT176       160046     76731776
PAT177       219126     42906029
PAT178       107286     49462344
PAT18        146771     52594264
PAT19        153705     78039102
PAT2         194525     84650653
PAT20        104995     118172564
PAT21        133550     95503155
PAT22        84598      79322013
PAT23        123563     103405415
PAT24        119415     105656371
PAT25        145486     86670068
PAT26        175165     64299073
PAT27        71371      1784275
PAT28        102171     77387698
PAT29        93955      87644560
PAT3         171981     95897120
PAT30        119942     61673191
PAT31        96645      78968068
PAT32        128387     55025904
PAT33        92210      51123413
PAT34        111297     78150994
PAT35        138100     29119820
PAT36        158503     24081830
PAT37        114681     49019496
PAT38        44867      54579973
PAT39        95732      83191686
PAT4         153748     106056406
PAT40        100232     70984798
PAT41        136206     39303264
PAT42        143774     35446826
PAT43        123731     64736974
PAT44        104361     81207665
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57146      23927792
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92811      89402778
PAT59        106516     74782837
PAT6         170642     91909261
PAT60        122361     64031080
PAT61        67427      30298000
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154777     88234848
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131210     96916575
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        93689      93464843
PAT84        34072      33980702
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164898     19209900
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129384     101126296
PAT90        175305     3330795
PAT91        101391     1926429
PAT92        169171     12412246
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140780     2674820
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6491       76133941
PLN1         59913      93484134
PLN10        73070      75870744
PLN11        37424      49319698
PLN12        40274      65682533
PLN13        22520      123858969
PLN14        21104      99666209
PLN15        17578      144865462
PLN16        17634      146278605
PLN17        17564      146392665
PLN18        24636      128667828
PLN19        6000       149205408
PLN2         43093      112069053
PLN20        1266       170315035
PLN21        14133      155912002
PLN22        7127       8366760
PLN23        67254      69760900
PLN24        29374      31573527
PLN25        76952      76375515
PLN26        65428      81393596
PLN27        44752      113983780
PLN28        42         85481108
PLN29        12         89108600
PLN3         1365       175807729
PLN30        1105       146780237
PLN31        26200      129369586
PLN32        53176      99017179
PLN33        74531      77751661
PLN34        96678      54025462
PLN35        80386      71664752
PLN36        77898      75915989
PLN37        80012      70526751
PLN38        82166      75440715
PLN39        57726      31573435
PLN4         1806       185612416
PLN40        98608      55062825
PLN41        81868      69076883
PLN42        46045      98458875
PLN43        26654      123344127
PLN44        24992      131748389
PLN45        59373      56637024
PLN46        81582      72158051
PLN47        62521      82550375
PLN48        46248      95940195
PLN49        84620      62791229
PLN5         1873       193897887
PLN50        93467      60393156
PLN51        76116      76755699
PLN52        67885      81583272
PLN53        75729      72787010
PLN54        65638      82828990
PLN55        10004      21876904
PLN6         1694       194475169
PLN7         14096      158201938
PLN8         75669      79697544
PLN9         9723       10086297
PRI1         23017      59647552
PRI10        1272       179275558
PRI11        775        94029396
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193666240
PRI18        1099       194310776
PRI19        1166       193657185
PRI2         18386      149285375
PRI20        1737       191818169
PRI21        2646       189791628
PRI22        16648      165526679
PRI23        4197       16004489
PRI24        31573      84616058
PRI25        61951      78207697
PRI26        31350      70628098
PRI27        8521       161801360
PRI28        2251       180645625
PRI29        1618       181509288
PRI3         1433       175278790
PRI30        2007       181705860
PRI31        1958       180727178
PRI32        13185      156524900
PRI33        1327       183635528
PRI34        41712      106643745
PRI35        22922      33120663
PRI36        32189      63608729
PRI37        20141      117697460
PRI38        18567      147180178
PRI39        66637      86857087
PRI4         1282       185555745
PRI40        49476      89674633
PRI41        40090      73818007
PRI42        45895      95119257
PRI43        21236      107095517
PRI44        60645      97495867
PRI45        95         1849462
PRI5         1325       184390308
PRI6         1180       179907324
PRI7         1246       180917243
PRI8         1212       178442526
PRI9         1367       174647124
ROD1         32911      139685926
ROD10        988        181377551
ROD11        239        45370799
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1189       190476978
ROD19        16761      153123318
ROD2         916        175508672
ROD20        20349      148361192
ROD21        1132       182075942
ROD22        1079       168189648
ROD23        13589      162647066
ROD24        38849      69272202
ROD25        21814      104561488
ROD26        1508       187599166
ROD27        134648     36929290
ROD28        84665      70585729
ROD29        56078      61772543
ROD3         906        173439055
ROD4         901        173910839
ROD5         921        174293473
ROD6         966        178089033
ROD7         969        179528121
ROD8         978        181261578
ROD9         993        181732614
STS1         85283      36763581
STS10        57907      44420267
STS11        48910      37503235
STS12        57924      43637361
STS13        64284      42850769
STS14        93606      34184225
STS15        104286     26517062
STS16        10116      2741066
STS17        103611     27476228
STS18        86929      34448302
STS19        99733      33367597
STS2         84354      49850025
STS20        54946      21015272
STS3         66846      26362760
STS4         76989      36945836
STS5         8457       4958885
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55716      37767321
SYN1         42774      77230624
SYN2         49398      68092607
SYN3         11297      159509957
SYN4         4599       176558803
SYN5         4596       176481519
SYN6         4600       176574698
SYN7         5730       91406667
TSA1         120472     38235688
TSA10        108480     37671630
TSA11        82649      29706806
TSA12        63000      19185998
TSA13        86486      70566494
TSA14        121991     38853496
TSA15        134870     35826510
TSA16        61036      79698424
TSA17        39468      53516874
TSA18        70282      97466599
TSA19        100897     57123531
TSA2         113532     41666458
TSA20        110668     52338593
TSA21        102984     53513191
TSA22        103695     52518403
TSA23        100966     47107597
TSA24        10786      6455891
TSA25        66573      59369298
TSA26        93236      68475106
TSA27        91230      65647744
TSA28        81583      80063334
TSA29        106309     44169463
TSA3         110396     41019325
TSA30        111906     40187704
TSA31        74352      59868448
TSA32        94911      35699810
TSA33        83189      31995816
TSA34        110188     45124503
TSA35        114753     50951737
TSA36        103616     51971055
TSA37        100207     56361687
TSA38        94449      65161201
TSA39        94183      70028525
TSA4         110949     45737681
TSA40        7555       2060048
TSA41        90902      71737996
TSA42        97659      54669853
TSA43        63227      108203943
TSA44        89918      77978879
TSA45        87807      65963439
TSA46        86501      67914552
TSA47        77483      79677214
TSA48        40419      62590589
TSA49        90931      66884444
TSA5         43179      10927440
TSA50        76043      84732155
TSA51        71912      78529712
TSA52        87476      82320347
TSA53        85577      88524564
TSA54        52282      74036179
TSA55        83432      74232816
TSA56        92894      50247879
TSA57        99796      54211962
TSA58        75921      66574803
TSA59        100099     60680015
TSA6         112457     59449948
TSA60        101952     51211507
TSA61        10383      4882421
TSA62        99281      63957845
TSA63        88688      72428374
TSA64        94761      54801841
TSA65        64452      76231537
TSA66        63187      106522299
TSA67        97306      76738816
TSA68        119366     49283699
TSA69        64143      75536862
TSA7         95611      66253193
TSA70        26123      41424160
TSA8         105744     68773673
TSA9         105928     64845351
UNA1         239        125812
VRL1         68000      69111339
VRL10        63739      70922566
VRL11        35161      49335789
VRL12        62840      71114135
VRL13        57409      72810185
VRL14        63333      65144477
VRL15        56981      73339527
VRL16        58036      71828142
VRL17        57087      71440499
VRL18        56541      72565031
VRL19        54703      74372382
VRL2         73436      64286574
VRL20        42809      41838740
VRL3         69820      60872960
VRL4         68448      69802524
VRL5         49830      52120412
VRL6         48193      77586401
VRL7         47199      72783245
VRL8         59487      73393468
VRL9         69158      66834206
VRT1         41751      123661295
VRT10        1256       189144082
VRT11        8274       177844568
VRT12        3994       136790703
VRT13        13095      170781188
VRT14        5348       182619924
VRT15        3936       186026494
VRT16        37596      134587584
VRT17        79811      68470121
VRT18        78293      66432750
VRT19        30908      24954989
VRT2         1924       193292342
VRT20        71345      77340392
VRT21        47242      120548901
VRT22        77529      63451720
VRT23        79408      61820374
VRT24        82261      56136815
VRT25        103632     65082902
VRT26        24107      23908914
VRT3         71806      78786905
VRT4         8447       170157397
VRT5         31318      27682745
VRT6         73011      66719150
VRT7         31732      63525748
VRT8         30652      111958169
VRT9         1202       189984871

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 189.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

19592636 16097851246   Homo sapiens
9696453   9972466215   Mus musculus
2187786   6514195133   Rattus norvegicus
2200303   5384282799   Bos taurus
3932778   5060128699   Zea mays
3285539   4884132947   Sus scrofa
1712969   3123157778   Danio rerio
257393    1435010041   Strongylocentrotus purpuratus
1348170   1254391972   Oryza sativa Japonica Group
1774072   1197076779   Nicotiana tabacum
1424382   1147263423   Xenopus (Silurana) tropicalis
2329477   1143557236   Arabidopsis thaliana
1229441   1084849933   Drosophila melanogaster
216600    1008269679   Pan troglodytes
766620     998781168   Vitis vinifera
1455547    950994954   Canis lupus familiaris
142432     926878984   Macaca mulatta
1902736    906521373   Glycine max
814914     899255531   Gallus gallus
1426357    896790717   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 189.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         April 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 189.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
	Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Ilya Dondoshansky, WonHee Jang, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Jim Ostell, Denis Sinyakov, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center