Release Notes For GenBank Release 190

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2012

               NCBI-GenBank Flat File Release 190.0

                    Distribution Release Notes

 154130210 loci, 141343240755 bases, from 154130210 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 190.0
1.2 Cutoff Date
1.3 Important Changes in Release 190.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 190.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 190.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 190.0, incorporates data available to the collaborating
databases as of June 15, 2012 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 190.0

1.3.1 New /pseudogene qualifier

  A new controlled-vocabulary /pseudogene qualifier which had been under
discussion within the INSDC since the May 2011 collaborative INSD meeting
is now supported as of the June 2012 GenBank release. The goal of the new
qualifier is to use it for the annotation of certain well-defined classes
of pseudogenes. The new qualifier's definition is as follows:

Qualifier       /pseudogene=
Definition      indicates that this feature is a pseudogene of the element
                named by the feature key
Value format    "TYPE"
                where TYPE is one of the following:
                processed, unprocessed, unitary, allelic, unknown

Example         /pseudogene="processed"
                /pseudogene="unprocessed"
                /pseudogene="unitary"
                /pseudogene="allelic"
                /pseudogene="unknown"

Comment         TYPE is a term taken from the INSDC controlled vocabulary for 
                pseudogenes:

                processed: the pseudogene has arisen by reverse transcription
                of a mRNA into cDNA, followed by reintegration into the genome. 
                Therefore, it has lost any intron/exon structure, and it might
                have a pseudo-polyA-tail.

                unprocessed: the pseudogene has arisen from a copy of the parent 
                gene by duplication followed by accumulation of random mutations. 
                The changes, compared to their functional homolog, include 
                insertions, deletions, premature stop codons, frameshifts and a 
                higher proportion of non-synonymous versus synonymous 
                substitutions.

                unitary: the pseudogene has no parent. It is the original gene, 
                which is functional is some species but disrupted in some way 
                (indels, mutation, recombination) in another species or strain.

                allelic: a (unitary) pseudogene that is stable in the population 
                but importantly it has a functional alternative allele also in
                the population. i.e., one strain may have the gene, another
                strain may have the pseudogene. MHC haplotypes have allelic
                pseudogenes.

                unknown: the submitter does not know the method of
                pseudogenisation.

1.3.2 Legacy /pseudo qualifier likely to remain in use

  In the Upcoming Changes announcement for the April 2012 GenBank 189.0
release, mention was made that the /pseudo qualifier would be deprecated,
given that a new /pseudogene qualifier would be available. However, in 
subsequent discussions during the June 2012 INSDC meeting, it was decided
that a mechanism is still needed to flag certain Gene and CDS features as
non-functional or problematic. Since agreement could not be reached for the
name of a qualifier, it was suggested that /pseudo should be preserved,
with an update to its definition in the Feature Table document.

  Although this is not a "change" in the normal sense, the fact that /pseudo
will be retained, and its usage clarified, seem important enough to 
warrant mention here.

1.3.3 New representation for Transcriptome Shotgun Assembly (TSA) records.

  As announced in the GenBank 189.0 release notes, the very first TSA
(Transcriptome Shotgun Assembly) project processed using a WGS-like
approach was made available by FTP between 189.0 and 190.0 . In the 
genbank/tsa directory of the NCBI FTP site you will now find these files:

-rw-r--r--  1 gbupdate gbproces       95 May 16 01:54 stats.tsa.GAAA
-rw-r--r--  1 gbupdate gbproces 18479033 May 16 01:53 tsa.GAAA.1.fsa_nt.gz
-rw-r--r--  1 gbupdate gbproces 31652938 May 16 01:53 tsa.GAAA.1.gbff.gz
-rw-r--r--  1 gbupdate gbproces     1057 May 16 01:53 tsa.GAAA.mstr.gbff.gz
-rw-r--r--  1 gbupdate gbproces       12 May 16 01:54 tsa.proj_list.2012.0516

And the ASN.1 version can be found in the ncbi-asn1/tsa FTP directory:

-rw-r--r-- 1 gbupdate gbproces       95 May 16 01:54 stats.tsa.GAAA
-rw-r--r-- 1 gbupdate gbproces 15773347 May 16 01:53 tsa.GAAA.1.bbs.gz
-rw-r--r-- 1 gbupdate gbproces     1081 May 16 01:53 tsa.GAAA.mstr.bse.gz
-rw-r--r-- 1 gbupdate gbproces       12 May 16 01:54 tsa.proj_list.2012.0516

  TSA projects are assigned a four-letter project code starting with
the letter "G" (for example, GAAA). Individual mRNA sequences within a 
project make use of the 4+2+6 accession number convention, familiar
to users of WGS data (for example, GAAA01000001). Unlike WGS, re-assembly
of the mRNAs for a TSA sequencing project is expected to be a very rare
occurrence, and we expect that the 2-digit assembly-version number will
almost always be "01" for TSA mRNAs. Similar to WGS, a TSA master record
provides a convenient overview of a TSA project, with an 'all-zeroes'
accession number (eg: GAAA00000000) . 

1.3.4 Organizational changes

The total number of sequence data files increased by 32 with this release:

  - the BCT division is now composed of  88 files (+3)
  - the CON division is now composed of 169 files (+2)
  - the ENV division is now composed of  54 files (+1)
  - the EST division is now composed of 464 files (+3)
  - the INV division is now composed of  31 files (+1)
  - the PAT division is now composed of 180 files (+2)
  - the PLN division is now composed of  57 files (+2)
  - the PRI division is now composed of  45 files (+1)
  - the TSA division is now composed of  86 files (+16)
  - the VRL division is now composed of  21 files (+1)

The total number of 'index' files increased by 2 with this release:

  - the AUT (author name) index is now composed of 99 files (+2)

1.3.5 Project DBLINKs transitioning to BioProject

  The Genome Project Database resource at the NCBI was redesigned in
recent months, culminating in the implementation of a new BioProject
resource:

        http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

An article that describes the goals of BioProject is available:

        http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54015/

BioProject is a collaborative effort of the International Nucleotide
Sequence Database Collaboration (INSDC), and project data are exchanged 
with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject
website is also available at DDBJ:

        http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml

BioProjects are uniquely identified by BioProject Accession Numbers,
which utilize this format:

        "PRJ"
        "E" or "N" or "D"
        one letter
        one or more digits

Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 .

With BioProject now in operation, we are implementing links from
sequence records to this new resource. Previously, links to the
Genome Project Database were provided by numeric 'Project' DBLINKs .
Here's an example for a bacterial complete-genome record:

LOCUS       CP002497             1110245 bp    DNA     linear   PLN 14-NOV-2011
DEFINITION  Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
            sequence.
ACCESSION   CP002497
VERSION     CP002497.1  GI:356887709
DBLINK      Project: 60715

As records like this are switched to BioProject accessions, the DBLINK
line will change slightly:

LOCUS       CP002497             1110245 bp    DNA     linear   PLN 14-NOV-2011
DEFINITION  Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
            sequence.
ACCESSION   CP002497
VERSION     CP002497.1  GI:356887709
DBLINK      BioProject: PRJNA60715

In the coming months, many millions of sequence records will gradually
be modified, to make use of the new BioProject DBLINK. These modifications
will not be distributed via daily GenBank and RefSeq incremental-update
products.

The new BioProject links are also appearing on newly-submitted sequence
records, and have been present in GenBank and RefSeq release and
incremental-update products since December 2011.

1.3.6 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.7 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 190.0. Consider gbgss154.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                            June 15 2012

                NCBI-GenBank Flat File Release 190.0

                           GSS Sequences (Part 1)

   87112 loci,    63991594 bases, from    87112 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "154" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

  There are no upcoming changes for GenBank flatfile format or content
currently scheduled.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1824 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbaut93.idx - Index of the entries according to author name, part 93.
97. gbaut94.idx - Index of the entries according to author name, part 94.
98. gbaut95.idx - Index of the entries according to author name, part 95.
99. gbaut96.idx - Index of the entries according to author name, part 96.
100. gbaut97.idx - Index of the entries according to author name, part 97.
101. gbaut98.idx - Index of the entries according to author name, part 98.
102. gbaut99.idx - Index of the entries according to author name, part 99.
103. gbbct1.seq - Bacterial sequence entries, part 1.
104. gbbct10.seq - Bacterial sequence entries, part 10.
105. gbbct11.seq - Bacterial sequence entries, part 11.
106. gbbct12.seq - Bacterial sequence entries, part 12.
107. gbbct13.seq - Bacterial sequence entries, part 13.
108. gbbct14.seq - Bacterial sequence entries, part 14.
109. gbbct15.seq - Bacterial sequence entries, part 15.
110. gbbct16.seq - Bacterial sequence entries, part 16.
111. gbbct17.seq - Bacterial sequence entries, part 17.
112. gbbct18.seq - Bacterial sequence entries, part 18.
113. gbbct19.seq - Bacterial sequence entries, part 19.
114. gbbct2.seq - Bacterial sequence entries, part 2.
115. gbbct20.seq - Bacterial sequence entries, part 20.
116. gbbct21.seq - Bacterial sequence entries, part 21.
117. gbbct22.seq - Bacterial sequence entries, part 22.
118. gbbct23.seq - Bacterial sequence entries, part 23.
119. gbbct24.seq - Bacterial sequence entries, part 24.
120. gbbct25.seq - Bacterial sequence entries, part 25.
121. gbbct26.seq - Bacterial sequence entries, part 26.
122. gbbct27.seq - Bacterial sequence entries, part 27.
123. gbbct28.seq - Bacterial sequence entries, part 28.
124. gbbct29.seq - Bacterial sequence entries, part 29.
125. gbbct3.seq - Bacterial sequence entries, part 3.
126. gbbct30.seq - Bacterial sequence entries, part 30.
127. gbbct31.seq - Bacterial sequence entries, part 31.
128. gbbct32.seq - Bacterial sequence entries, part 32.
129. gbbct33.seq - Bacterial sequence entries, part 33.
130. gbbct34.seq - Bacterial sequence entries, part 34.
131. gbbct35.seq - Bacterial sequence entries, part 35.
132. gbbct36.seq - Bacterial sequence entries, part 36.
133. gbbct37.seq - Bacterial sequence entries, part 37.
134. gbbct38.seq - Bacterial sequence entries, part 38.
135. gbbct39.seq - Bacterial sequence entries, part 39.
136. gbbct4.seq - Bacterial sequence entries, part 4.
137. gbbct40.seq - Bacterial sequence entries, part 40.
138. gbbct41.seq - Bacterial sequence entries, part 41.
139. gbbct42.seq - Bacterial sequence entries, part 42.
140. gbbct43.seq - Bacterial sequence entries, part 43.
141. gbbct44.seq - Bacterial sequence entries, part 44.
142. gbbct45.seq - Bacterial sequence entries, part 45.
143. gbbct46.seq - Bacterial sequence entries, part 46.
144. gbbct47.seq - Bacterial sequence entries, part 47.
145. gbbct48.seq - Bacterial sequence entries, part 48.
146. gbbct49.seq - Bacterial sequence entries, part 49.
147. gbbct5.seq - Bacterial sequence entries, part 5.
148. gbbct50.seq - Bacterial sequence entries, part 50.
149. gbbct51.seq - Bacterial sequence entries, part 51.
150. gbbct52.seq - Bacterial sequence entries, part 52.
151. gbbct53.seq - Bacterial sequence entries, part 53.
152. gbbct54.seq - Bacterial sequence entries, part 54.
153. gbbct55.seq - Bacterial sequence entries, part 55.
154. gbbct56.seq - Bacterial sequence entries, part 56.
155. gbbct57.seq - Bacterial sequence entries, part 57.
156. gbbct58.seq - Bacterial sequence entries, part 58.
157. gbbct59.seq - Bacterial sequence entries, part 59.
158. gbbct6.seq - Bacterial sequence entries, part 6.
159. gbbct60.seq - Bacterial sequence entries, part 60.
160. gbbct61.seq - Bacterial sequence entries, part 61.
161. gbbct62.seq - Bacterial sequence entries, part 62.
162. gbbct63.seq - Bacterial sequence entries, part 63.
163. gbbct64.seq - Bacterial sequence entries, part 64.
164. gbbct65.seq - Bacterial sequence entries, part 65.
165. gbbct66.seq - Bacterial sequence entries, part 66.
166. gbbct67.seq - Bacterial sequence entries, part 67.
167. gbbct68.seq - Bacterial sequence entries, part 68.
168. gbbct69.seq - Bacterial sequence entries, part 69.
169. gbbct7.seq - Bacterial sequence entries, part 7.
170. gbbct70.seq - Bacterial sequence entries, part 70.
171. gbbct71.seq - Bacterial sequence entries, part 71.
172. gbbct72.seq - Bacterial sequence entries, part 72.
173. gbbct73.seq - Bacterial sequence entries, part 73.
174. gbbct74.seq - Bacterial sequence entries, part 74.
175. gbbct75.seq - Bacterial sequence entries, part 75.
176. gbbct76.seq - Bacterial sequence entries, part 76.
177. gbbct77.seq - Bacterial sequence entries, part 77.
178. gbbct78.seq - Bacterial sequence entries, part 78.
179. gbbct79.seq - Bacterial sequence entries, part 79.
180. gbbct8.seq - Bacterial sequence entries, part 8.
181. gbbct80.seq - Bacterial sequence entries, part 80.
182. gbbct81.seq - Bacterial sequence entries, part 81.
183. gbbct82.seq - Bacterial sequence entries, part 82.
184. gbbct83.seq - Bacterial sequence entries, part 83.
185. gbbct84.seq - Bacterial sequence entries, part 84.
186. gbbct85.seq - Bacterial sequence entries, part 85.
187. gbbct86.seq - Bacterial sequence entries, part 86.
188. gbbct87.seq - Bacterial sequence entries, part 87.
189. gbbct88.seq - Bacterial sequence entries, part 88.
190. gbbct9.seq - Bacterial sequence entries, part 9.
191. gbchg.txt - Accession numbers of entries updated since the previous release.
192. gbcon1.seq - Constructed sequence entries, part 1.
193. gbcon10.seq - Constructed sequence entries, part 10.
194. gbcon100.seq - Constructed sequence entries, part 100.
195. gbcon101.seq - Constructed sequence entries, part 101.
196. gbcon102.seq - Constructed sequence entries, part 102.
197. gbcon103.seq - Constructed sequence entries, part 103.
198. gbcon104.seq - Constructed sequence entries, part 104.
199. gbcon105.seq - Constructed sequence entries, part 105.
200. gbcon106.seq - Constructed sequence entries, part 106.
201. gbcon107.seq - Constructed sequence entries, part 107.
202. gbcon108.seq - Constructed sequence entries, part 108.
203. gbcon109.seq - Constructed sequence entries, part 109.
204. gbcon11.seq - Constructed sequence entries, part 11.
205. gbcon110.seq - Constructed sequence entries, part 110.
206. gbcon111.seq - Constructed sequence entries, part 111.
207. gbcon112.seq - Constructed sequence entries, part 112.
208. gbcon113.seq - Constructed sequence entries, part 113.
209. gbcon114.seq - Constructed sequence entries, part 114.
210. gbcon115.seq - Constructed sequence entries, part 115.
211. gbcon116.seq - Constructed sequence entries, part 116.
212. gbcon117.seq - Constructed sequence entries, part 117.
213. gbcon118.seq - Constructed sequence entries, part 118.
214. gbcon119.seq - Constructed sequence entries, part 119.
215. gbcon12.seq - Constructed sequence entries, part 12.
216. gbcon120.seq - Constructed sequence entries, part 120.
217. gbcon121.seq - Constructed sequence entries, part 121.
218. gbcon122.seq - Constructed sequence entries, part 122.
219. gbcon123.seq - Constructed sequence entries, part 123.
220. gbcon124.seq - Constructed sequence entries, part 124.
221. gbcon125.seq - Constructed sequence entries, part 125.
222. gbcon126.seq - Constructed sequence entries, part 126.
223. gbcon127.seq - Constructed sequence entries, part 127.
224. gbcon128.seq - Constructed sequence entries, part 128.
225. gbcon129.seq - Constructed sequence entries, part 129.
226. gbcon13.seq - Constructed sequence entries, part 13.
227. gbcon130.seq - Constructed sequence entries, part 130.
228. gbcon131.seq - Constructed sequence entries, part 131.
229. gbcon132.seq - Constructed sequence entries, part 132.
230. gbcon133.seq - Constructed sequence entries, part 133.
231. gbcon134.seq - Constructed sequence entries, part 134.
232. gbcon135.seq - Constructed sequence entries, part 135.
233. gbcon136.seq - Constructed sequence entries, part 136.
234. gbcon137.seq - Constructed sequence entries, part 137.
235. gbcon138.seq - Constructed sequence entries, part 138.
236. gbcon139.seq - Constructed sequence entries, part 139.
237. gbcon14.seq - Constructed sequence entries, part 14.
238. gbcon140.seq - Constructed sequence entries, part 140.
239. gbcon141.seq - Constructed sequence entries, part 141.
240. gbcon142.seq - Constructed sequence entries, part 142.
241. gbcon143.seq - Constructed sequence entries, part 143.
242. gbcon144.seq - Constructed sequence entries, part 144.
243. gbcon145.seq - Constructed sequence entries, part 145.
244. gbcon146.seq - Constructed sequence entries, part 146.
245. gbcon147.seq - Constructed sequence entries, part 147.
246. gbcon148.seq - Constructed sequence entries, part 148.
247. gbcon149.seq - Constructed sequence entries, part 149.
248. gbcon15.seq - Constructed sequence entries, part 15.
249. gbcon150.seq - Constructed sequence entries, part 150.
250. gbcon151.seq - Constructed sequence entries, part 151.
251. gbcon152.seq - Constructed sequence entries, part 152.
252. gbcon153.seq - Constructed sequence entries, part 153.
253. gbcon154.seq - Constructed sequence entries, part 154.
254. gbcon155.seq - Constructed sequence entries, part 155.
255. gbcon156.seq - Constructed sequence entries, part 156.
256. gbcon157.seq - Constructed sequence entries, part 157.
257. gbcon158.seq - Constructed sequence entries, part 158.
258. gbcon159.seq - Constructed sequence entries, part 159.
259. gbcon16.seq - Constructed sequence entries, part 16.
260. gbcon160.seq - Constructed sequence entries, part 160.
261. gbcon161.seq - Constructed sequence entries, part 161.
262. gbcon162.seq - Constructed sequence entries, part 162.
263. gbcon163.seq - Constructed sequence entries, part 163.
264. gbcon164.seq - Constructed sequence entries, part 164.
265. gbcon165.seq - Constructed sequence entries, part 165.
266. gbcon166.seq - Constructed sequence entries, part 166.
267. gbcon167.seq - Constructed sequence entries, part 167.
268. gbcon168.seq - Constructed sequence entries, part 168.
269. gbcon169.seq - Constructed sequence entries, part 169.
270. gbcon17.seq - Constructed sequence entries, part 17.
271. gbcon18.seq - Constructed sequence entries, part 18.
272. gbcon19.seq - Constructed sequence entries, part 19.
273. gbcon2.seq - Constructed sequence entries, part 2.
274. gbcon20.seq - Constructed sequence entries, part 20.
275. gbcon21.seq - Constructed sequence entries, part 21.
276. gbcon22.seq - Constructed sequence entries, part 22.
277. gbcon23.seq - Constructed sequence entries, part 23.
278. gbcon24.seq - Constructed sequence entries, part 24.
279. gbcon25.seq - Constructed sequence entries, part 25.
280. gbcon26.seq - Constructed sequence entries, part 26.
281. gbcon27.seq - Constructed sequence entries, part 27.
282. gbcon28.seq - Constructed sequence entries, part 28.
283. gbcon29.seq - Constructed sequence entries, part 29.
284. gbcon3.seq - Constructed sequence entries, part 3.
285. gbcon30.seq - Constructed sequence entries, part 30.
286. gbcon31.seq - Constructed sequence entries, part 31.
287. gbcon32.seq - Constructed sequence entries, part 32.
288. gbcon33.seq - Constructed sequence entries, part 33.
289. gbcon34.seq - Constructed sequence entries, part 34.
290. gbcon35.seq - Constructed sequence entries, part 35.
291. gbcon36.seq - Constructed sequence entries, part 36.
292. gbcon37.seq - Constructed sequence entries, part 37.
293. gbcon38.seq - Constructed sequence entries, part 38.
294. gbcon39.seq - Constructed sequence entries, part 39.
295. gbcon4.seq - Constructed sequence entries, part 4.
296. gbcon40.seq - Constructed sequence entries, part 40.
297. gbcon41.seq - Constructed sequence entries, part 41.
298. gbcon42.seq - Constructed sequence entries, part 42.
299. gbcon43.seq - Constructed sequence entries, part 43.
300. gbcon44.seq - Constructed sequence entries, part 44.
301. gbcon45.seq - Constructed sequence entries, part 45.
302. gbcon46.seq - Constructed sequence entries, part 46.
303. gbcon47.seq - Constructed sequence entries, part 47.
304. gbcon48.seq - Constructed sequence entries, part 48.
305. gbcon49.seq - Constructed sequence entries, part 49.
306. gbcon5.seq - Constructed sequence entries, part 5.
307. gbcon50.seq - Constructed sequence entries, part 50.
308. gbcon51.seq - Constructed sequence entries, part 51.
309. gbcon52.seq - Constructed sequence entries, part 52.
310. gbcon53.seq - Constructed sequence entries, part 53.
311. gbcon54.seq - Constructed sequence entries, part 54.
312. gbcon55.seq - Constructed sequence entries, part 55.
313. gbcon56.seq - Constructed sequence entries, part 56.
314. gbcon57.seq - Constructed sequence entries, part 57.
315. gbcon58.seq - Constructed sequence entries, part 58.
316. gbcon59.seq - Constructed sequence entries, part 59.
317. gbcon6.seq - Constructed sequence entries, part 6.
318. gbcon60.seq - Constructed sequence entries, part 60.
319. gbcon61.seq - Constructed sequence entries, part 61.
320. gbcon62.seq - Constructed sequence entries, part 62.
321. gbcon63.seq - Constructed sequence entries, part 63.
322. gbcon64.seq - Constructed sequence entries, part 64.
323. gbcon65.seq - Constructed sequence entries, part 65.
324. gbcon66.seq - Constructed sequence entries, part 66.
325. gbcon67.seq - Constructed sequence entries, part 67.
326. gbcon68.seq - Constructed sequence entries, part 68.
327. gbcon69.seq - Constructed sequence entries, part 69.
328. gbcon7.seq - Constructed sequence entries, part 7.
329. gbcon70.seq - Constructed sequence entries, part 70.
330. gbcon71.seq - Constructed sequence entries, part 71.
331. gbcon72.seq - Constructed sequence entries, part 72.
332. gbcon73.seq - Constructed sequence entries, part 73.
333. gbcon74.seq - Constructed sequence entries, part 74.
334. gbcon75.seq - Constructed sequence entries, part 75.
335. gbcon76.seq - Constructed sequence entries, part 76.
336. gbcon77.seq - Constructed sequence entries, part 77.
337. gbcon78.seq - Constructed sequence entries, part 78.
338. gbcon79.seq - Constructed sequence entries, part 79.
339. gbcon8.seq - Constructed sequence entries, part 8.
340. gbcon80.seq - Constructed sequence entries, part 80.
341. gbcon81.seq - Constructed sequence entries, part 81.
342. gbcon82.seq - Constructed sequence entries, part 82.
343. gbcon83.seq - Constructed sequence entries, part 83.
344. gbcon84.seq - Constructed sequence entries, part 84.
345. gbcon85.seq - Constructed sequence entries, part 85.
346. gbcon86.seq - Constructed sequence entries, part 86.
347. gbcon87.seq - Constructed sequence entries, part 87.
348. gbcon88.seq - Constructed sequence entries, part 88.
349. gbcon89.seq - Constructed sequence entries, part 89.
350. gbcon9.seq - Constructed sequence entries, part 9.
351. gbcon90.seq - Constructed sequence entries, part 90.
352. gbcon91.seq - Constructed sequence entries, part 91.
353. gbcon92.seq - Constructed sequence entries, part 92.
354. gbcon93.seq - Constructed sequence entries, part 93.
355. gbcon94.seq - Constructed sequence entries, part 94.
356. gbcon95.seq - Constructed sequence entries, part 95.
357. gbcon96.seq - Constructed sequence entries, part 96.
358. gbcon97.seq - Constructed sequence entries, part 97.
359. gbcon98.seq - Constructed sequence entries, part 98.
360. gbcon99.seq - Constructed sequence entries, part 99.
361. gbdel.txt - Accession numbers of entries deleted since the previous release.
362. gbenv1.seq - Environmental sampling sequence entries, part 1.
363. gbenv10.seq - Environmental sampling sequence entries, part 10.
364. gbenv11.seq - Environmental sampling sequence entries, part 11.
365. gbenv12.seq - Environmental sampling sequence entries, part 12.
366. gbenv13.seq - Environmental sampling sequence entries, part 13.
367. gbenv14.seq - Environmental sampling sequence entries, part 14.
368. gbenv15.seq - Environmental sampling sequence entries, part 15.
369. gbenv16.seq - Environmental sampling sequence entries, part 16.
370. gbenv17.seq - Environmental sampling sequence entries, part 17.
371. gbenv18.seq - Environmental sampling sequence entries, part 18.
372. gbenv19.seq - Environmental sampling sequence entries, part 19.
373. gbenv2.seq - Environmental sampling sequence entries, part 2.
374. gbenv20.seq - Environmental sampling sequence entries, part 20.
375. gbenv21.seq - Environmental sampling sequence entries, part 21.
376. gbenv22.seq - Environmental sampling sequence entries, part 22.
377. gbenv23.seq - Environmental sampling sequence entries, part 23.
378. gbenv24.seq - Environmental sampling sequence entries, part 24.
379. gbenv25.seq - Environmental sampling sequence entries, part 25.
380. gbenv26.seq - Environmental sampling sequence entries, part 26.
381. gbenv27.seq - Environmental sampling sequence entries, part 27.
382. gbenv28.seq - Environmental sampling sequence entries, part 28.
383. gbenv29.seq - Environmental sampling sequence entries, part 29.
384. gbenv3.seq - Environmental sampling sequence entries, part 3.
385. gbenv30.seq - Environmental sampling sequence entries, part 30.
386. gbenv31.seq - Environmental sampling sequence entries, part 31.
387. gbenv32.seq - Environmental sampling sequence entries, part 32.
388. gbenv33.seq - Environmental sampling sequence entries, part 33.
389. gbenv34.seq - Environmental sampling sequence entries, part 34.
390. gbenv35.seq - Environmental sampling sequence entries, part 35.
391. gbenv36.seq - Environmental sampling sequence entries, part 36.
392. gbenv37.seq - Environmental sampling sequence entries, part 37.
393. gbenv38.seq - Environmental sampling sequence entries, part 38.
394. gbenv39.seq - Environmental sampling sequence entries, part 39.
395. gbenv4.seq - Environmental sampling sequence entries, part 4.
396. gbenv40.seq - Environmental sampling sequence entries, part 40.
397. gbenv41.seq - Environmental sampling sequence entries, part 41.
398. gbenv42.seq - Environmental sampling sequence entries, part 42.
399. gbenv43.seq - Environmental sampling sequence entries, part 43.
400. gbenv44.seq - Environmental sampling sequence entries, part 44.
401. gbenv45.seq - Environmental sampling sequence entries, part 45.
402. gbenv46.seq - Environmental sampling sequence entries, part 46.
403. gbenv47.seq - Environmental sampling sequence entries, part 47.
404. gbenv48.seq - Environmental sampling sequence entries, part 48.
405. gbenv49.seq - Environmental sampling sequence entries, part 49.
406. gbenv5.seq - Environmental sampling sequence entries, part 5.
407. gbenv50.seq - Environmental sampling sequence entries, part 50.
408. gbenv51.seq - Environmental sampling sequence entries, part 51.
409. gbenv52.seq - Environmental sampling sequence entries, part 52.
410. gbenv53.seq - Environmental sampling sequence entries, part 53.
411. gbenv54.seq - Environmental sampling sequence entries, part 54.
412. gbenv6.seq - Environmental sampling sequence entries, part 6.
413. gbenv7.seq - Environmental sampling sequence entries, part 7.
414. gbenv8.seq - Environmental sampling sequence entries, part 8.
415. gbenv9.seq - Environmental sampling sequence entries, part 9.
416. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
417. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
418. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
419. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
420. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
421. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
422. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
423. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
424. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
425. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
426. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
427. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
428. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
429. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
430. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
431. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
432. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
433. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
434. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
435. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
436. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
437. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
438. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
439. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
440. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
441. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
442. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
443. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
444. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
445. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
446. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
447. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
448. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
449. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
450. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
451. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
452. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
453. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
454. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
455. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
456. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
457. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
458. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
459. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
460. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
461. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
462. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
463. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
464. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
465. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
466. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
467. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
468. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
469. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
470. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
471. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
472. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
473. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
474. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
475. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
476. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
477. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
478. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
479. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
480. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
481. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
482. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
483. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
484. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
485. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
486. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
487. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
488. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
489. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
490. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
491. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
492. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
493. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
494. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
495. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
496. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
497. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
498. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
499. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
500. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
501. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
502. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
503. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
504. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
505. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
506. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
507. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
508. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
509. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
510. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
511. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
512. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
513. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
514. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
515. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
516. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
517. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
518. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
519. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
520. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
521. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
522. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
523. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
524. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
525. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
526. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
527. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
528. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
529. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
530. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
531. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
532. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
533. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
534. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
535. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
536. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
537. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
538. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
539. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
540. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
541. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
542. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
543. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
544. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
545. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
546. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
547. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
548. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
549. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
550. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
551. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
552. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
553. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
554. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
555. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
556. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
557. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
558. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
559. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
560. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
561. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
562. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
563. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
564. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
565. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
566. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
567. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
568. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
569. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
570. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
571. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
572. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
573. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
574. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
575. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
576. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
577. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
578. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
579. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
580. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
581. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
582. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
583. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
584. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
585. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
586. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
587. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
588. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
589. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
590. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
591. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
592. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
593. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
594. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
595. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
596. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
597. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
598. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
599. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
600. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
601. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
602. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
603. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
604. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
605. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
606. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
607. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
608. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
609. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
610. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
611. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
612. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
613. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
614. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
615. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
616. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
617. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
618. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
619. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
620. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
621. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
622. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
623. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
624. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
625. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
626. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
627. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
628. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
629. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
630. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
631. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
632. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
633. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
634. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
635. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
636. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
637. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
638. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
639. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
640. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
641. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
642. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
643. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
644. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
645. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
646. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
647. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
648. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
649. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
650. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
651. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
652. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
653. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
654. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
655. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
656. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
657. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
658. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
659. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
660. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
661. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
662. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
663. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
664. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
665. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
666. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
667. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
668. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
669. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
670. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
671. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
672. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
673. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
674. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
675. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
676. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
677. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
678. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
679. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
680. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
681. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
682. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
683. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
684. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
685. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
686. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
687. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
688. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
689. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
690. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
691. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
692. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
693. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
694. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
695. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
696. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
697. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
698. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
699. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
700. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
701. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
702. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
703. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
704. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
705. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
706. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
707. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
708. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
709. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
710. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
711. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
712. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
713. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
714. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
715. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
716. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
717. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
718. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
719. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
720. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
721. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
722. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
723. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
724. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
725. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
726. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
727. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
728. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
729. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
730. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
731. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
732. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
733. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
734. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
735. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
736. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
737. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
738. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
739. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
740. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
741. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
742. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
743. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
744. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
745. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
746. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
747. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
748. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
749. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
750. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
751. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
752. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
753. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
754. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
755. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
756. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
757. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
758. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
759. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
760. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
761. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
762. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
763. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
764. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
765. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
766. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
767. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
768. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
769. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
770. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
771. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
772. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
773. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
774. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
775. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
776. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
777. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
778. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
779. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
780. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
781. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
782. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
783. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
784. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
785. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
786. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
787. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
788. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
789. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
790. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
791. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
792. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
793. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
794. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
795. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
796. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
797. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
798. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
799. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
800. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
801. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
802. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
803. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
804. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
805. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
806. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
807. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
808. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
809. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
810. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
811. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
812. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
813. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
814. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
815. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
816. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
817. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
818. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
819. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
820. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
821. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
822. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
823. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
824. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
825. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
826. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
827. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
828. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
829. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
830. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
831. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
832. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
833. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
834. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
835. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
836. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
837. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
838. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
839. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
840. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
841. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
842. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
843. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
844. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
845. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
846. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
847. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
848. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
849. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
850. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
851. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
852. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
853. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
854. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
855. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
856. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
857. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
858. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
859. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
860. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
861. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
862. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
863. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
864. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
865. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
866. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
867. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
868. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
869. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
870. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
871. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
872. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
873. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
874. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
875. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
876. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
877. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
878. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
879. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
880. gbgen.idx - Index of the entries according to gene symbols.
881. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
882. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
883. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
884. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
885. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
886. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
887. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
888. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
889. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
890. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
891. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
892. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
893. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
894. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
895. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
896. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
897. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
898. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
899. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
900. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
901. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
902. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
903. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
904. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
905. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
906. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
907. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
908. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
909. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
910. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
911. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
912. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
913. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
914. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
915. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
916. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
917. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
918. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
919. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
920. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
921. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
922. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
923. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
924. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
925. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
926. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
927. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
928. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
929. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
930. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
931. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
932. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
933. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
934. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
935. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
936. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
937. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
938. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
939. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
940. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
941. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
942. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
943. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
944. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
945. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
946. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
947. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
948. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
949. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
950. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
951. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
952. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
953. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
954. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
955. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
956. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
957. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
958. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
959. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
960. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
961. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
962. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
963. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
964. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
965. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
966. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
967. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
968. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
969. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
970. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
971. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
972. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
973. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
974. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
975. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
976. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
977. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
978. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
979. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
980. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
981. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
982. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
983. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
984. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
985. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
986. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
987. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
988. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
989. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
990. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
991. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
992. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
993. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
994. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
995. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
996. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
997. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
998. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
999. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1000. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1001. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1002. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1003. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1004. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1005. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1006. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1007. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1008. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1009. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1010. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1011. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1012. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1013. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1014. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1015. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1016. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1017. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1018. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1019. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1020. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1021. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1022. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1023. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1024. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1025. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1026. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1027. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1028. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1029. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1030. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1031. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1032. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1033. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1034. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1035. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1036. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1037. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1038. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1039. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1040. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1041. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1042. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1043. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1044. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1045. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1046. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1047. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1048. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1049. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1050. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1051. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1052. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1053. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1054. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1055. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1056. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1057. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1058. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1059. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1060. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1061. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1062. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1063. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1064. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1065. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1066. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1067. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1068. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1069. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1070. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1071. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1072. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1073. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1074. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1075. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1076. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1077. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1078. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1079. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1080. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1081. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1082. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1083. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1084. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1085. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1086. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1087. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1088. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1089. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1090. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1091. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1092. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1093. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1094. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1095. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1096. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1097. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1098. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1099. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1100. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1101. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1102. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1103. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1104. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1105. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1106. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1107. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1108. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1109. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1110. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1111. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1112. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1113. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1114. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1115. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1116. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1117. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1118. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1119. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1120. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1121. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1122. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1123. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1124. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1125. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1126. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1127. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1128. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1129. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1130. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1131. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1132. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1133. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1134. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1135. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1136. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1137. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1138. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1139. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1140. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1141. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1142. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1143. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1144. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1145. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1146. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1147. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1148. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1149. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1150. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1151. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1152. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1153. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1154. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1155. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1156. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1157. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1158. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1159. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1160. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1161. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1162. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1163. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1164. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1165. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1166. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1167. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1168. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1169. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1170. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1171. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1172. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1173. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1174. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1175. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1176. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1177. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1178. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1179. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1180. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1181. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1182. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1183. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1184. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1185. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1186. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1187. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1188. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1189. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1190. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1191. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1192. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1193. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1194. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1195. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1196. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1197. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1198. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1199. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1200. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1201. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1202. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1203. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1204. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1205. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1206. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1207. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1208. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1209. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1210. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1211. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1212. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1213. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1214. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1215. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1216. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1217. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1218. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1219. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1220. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1221. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1222. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1223. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1224. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1225. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1226. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1227. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1228. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1229. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1230. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1231. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1232. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1233. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1234. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1235. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1236. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1237. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1238. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1239. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1240. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1241. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1242. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1243. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1244. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1245. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1246. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1247. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1248. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1249. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1250. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1251. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1252. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1253. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1254. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1255. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1256. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1257. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1258. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1259. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1260. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1261. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1262. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1263. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1264. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1265. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1266. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1267. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1268. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1269. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1270. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1271. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1272. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1273. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1274. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1275. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1276. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1277. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1278. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1279. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1280. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1281. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1282. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1283. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1284. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1285. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1286. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1287. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1288. gbinv1.seq - Invertebrate sequence entries, part 1.
1289. gbinv10.seq - Invertebrate sequence entries, part 10.
1290. gbinv11.seq - Invertebrate sequence entries, part 11.
1291. gbinv12.seq - Invertebrate sequence entries, part 12.
1292. gbinv13.seq - Invertebrate sequence entries, part 13.
1293. gbinv14.seq - Invertebrate sequence entries, part 14.
1294. gbinv15.seq - Invertebrate sequence entries, part 15.
1295. gbinv16.seq - Invertebrate sequence entries, part 16.
1296. gbinv17.seq - Invertebrate sequence entries, part 17.
1297. gbinv18.seq - Invertebrate sequence entries, part 18.
1298. gbinv19.seq - Invertebrate sequence entries, part 19.
1299. gbinv2.seq - Invertebrate sequence entries, part 2.
1300. gbinv20.seq - Invertebrate sequence entries, part 20.
1301. gbinv21.seq - Invertebrate sequence entries, part 21.
1302. gbinv22.seq - Invertebrate sequence entries, part 22.
1303. gbinv23.seq - Invertebrate sequence entries, part 23.
1304. gbinv24.seq - Invertebrate sequence entries, part 24.
1305. gbinv25.seq - Invertebrate sequence entries, part 25.
1306. gbinv26.seq - Invertebrate sequence entries, part 26.
1307. gbinv27.seq - Invertebrate sequence entries, part 27.
1308. gbinv28.seq - Invertebrate sequence entries, part 28.
1309. gbinv29.seq - Invertebrate sequence entries, part 29.
1310. gbinv3.seq - Invertebrate sequence entries, part 3.
1311. gbinv30.seq - Invertebrate sequence entries, part 30.
1312. gbinv31.seq - Invertebrate sequence entries, part 31.
1313. gbinv4.seq - Invertebrate sequence entries, part 4.
1314. gbinv5.seq - Invertebrate sequence entries, part 5.
1315. gbinv6.seq - Invertebrate sequence entries, part 6.
1316. gbinv7.seq - Invertebrate sequence entries, part 7.
1317. gbinv8.seq - Invertebrate sequence entries, part 8.
1318. gbinv9.seq - Invertebrate sequence entries, part 9.
1319. gbjou1.idx - Index of the entries according to journal citation, part 1.
1320. gbjou10.idx - Index of the entries according to journal citation, part 10.
1321. gbjou11.idx - Index of the entries according to journal citation, part 11.
1322. gbjou12.idx - Index of the entries according to journal citation, part 12.
1323. gbjou13.idx - Index of the entries according to journal citation, part 13.
1324. gbjou2.idx - Index of the entries according to journal citation, part 2.
1325. gbjou3.idx - Index of the entries according to journal citation, part 3.
1326. gbjou4.idx - Index of the entries according to journal citation, part 4.
1327. gbjou5.idx - Index of the entries according to journal citation, part 5.
1328. gbjou6.idx - Index of the entries according to journal citation, part 6.
1329. gbjou7.idx - Index of the entries according to journal citation, part 7.
1330. gbjou8.idx - Index of the entries according to journal citation, part 8.
1331. gbjou9.idx - Index of the entries according to journal citation, part 9.
1332. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1333. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1334. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1335. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1336. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1337. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1338. gbmam1.seq - Other mammalian sequence entries, part 1.
1339. gbmam2.seq - Other mammalian sequence entries, part 2.
1340. gbmam3.seq - Other mammalian sequence entries, part 3.
1341. gbmam4.seq - Other mammalian sequence entries, part 4.
1342. gbmam5.seq - Other mammalian sequence entries, part 5.
1343. gbmam6.seq - Other mammalian sequence entries, part 6.
1344. gbmam7.seq - Other mammalian sequence entries, part 7.
1345. gbmam8.seq - Other mammalian sequence entries, part 8.
1346. gbnew.txt - Accession numbers of entries new since the previous release.
1347. gbpat1.seq - Patent sequence entries, part 1.
1348. gbpat10.seq - Patent sequence entries, part 10.
1349. gbpat100.seq - Patent sequence entries, part 100.
1350. gbpat101.seq - Patent sequence entries, part 101.
1351. gbpat102.seq - Patent sequence entries, part 102.
1352. gbpat103.seq - Patent sequence entries, part 103.
1353. gbpat104.seq - Patent sequence entries, part 104.
1354. gbpat105.seq - Patent sequence entries, part 105.
1355. gbpat106.seq - Patent sequence entries, part 106.
1356. gbpat107.seq - Patent sequence entries, part 107.
1357. gbpat108.seq - Patent sequence entries, part 108.
1358. gbpat109.seq - Patent sequence entries, part 109.
1359. gbpat11.seq - Patent sequence entries, part 11.
1360. gbpat110.seq - Patent sequence entries, part 110.
1361. gbpat111.seq - Patent sequence entries, part 111.
1362. gbpat112.seq - Patent sequence entries, part 112.
1363. gbpat113.seq - Patent sequence entries, part 113.
1364. gbpat114.seq - Patent sequence entries, part 114.
1365. gbpat115.seq - Patent sequence entries, part 115.
1366. gbpat116.seq - Patent sequence entries, part 116.
1367. gbpat117.seq - Patent sequence entries, part 117.
1368. gbpat118.seq - Patent sequence entries, part 118.
1369. gbpat119.seq - Patent sequence entries, part 119.
1370. gbpat12.seq - Patent sequence entries, part 12.
1371. gbpat120.seq - Patent sequence entries, part 120.
1372. gbpat121.seq - Patent sequence entries, part 121.
1373. gbpat122.seq - Patent sequence entries, part 122.
1374. gbpat123.seq - Patent sequence entries, part 123.
1375. gbpat124.seq - Patent sequence entries, part 124.
1376. gbpat125.seq - Patent sequence entries, part 125.
1377. gbpat126.seq - Patent sequence entries, part 126.
1378. gbpat127.seq - Patent sequence entries, part 127.
1379. gbpat128.seq - Patent sequence entries, part 128.
1380. gbpat129.seq - Patent sequence entries, part 129.
1381. gbpat13.seq - Patent sequence entries, part 13.
1382. gbpat130.seq - Patent sequence entries, part 130.
1383. gbpat131.seq - Patent sequence entries, part 131.
1384. gbpat132.seq - Patent sequence entries, part 132.
1385. gbpat133.seq - Patent sequence entries, part 133.
1386. gbpat134.seq - Patent sequence entries, part 134.
1387. gbpat135.seq - Patent sequence entries, part 135.
1388. gbpat136.seq - Patent sequence entries, part 136.
1389. gbpat137.seq - Patent sequence entries, part 137.
1390. gbpat138.seq - Patent sequence entries, part 138.
1391. gbpat139.seq - Patent sequence entries, part 139.
1392. gbpat14.seq - Patent sequence entries, part 14.
1393. gbpat140.seq - Patent sequence entries, part 140.
1394. gbpat141.seq - Patent sequence entries, part 141.
1395. gbpat142.seq - Patent sequence entries, part 142.
1396. gbpat143.seq - Patent sequence entries, part 143.
1397. gbpat144.seq - Patent sequence entries, part 144.
1398. gbpat145.seq - Patent sequence entries, part 145.
1399. gbpat146.seq - Patent sequence entries, part 146.
1400. gbpat147.seq - Patent sequence entries, part 147.
1401. gbpat148.seq - Patent sequence entries, part 148.
1402. gbpat149.seq - Patent sequence entries, part 149.
1403. gbpat15.seq - Patent sequence entries, part 15.
1404. gbpat150.seq - Patent sequence entries, part 150.
1405. gbpat151.seq - Patent sequence entries, part 151.
1406. gbpat152.seq - Patent sequence entries, part 152.
1407. gbpat153.seq - Patent sequence entries, part 153.
1408. gbpat154.seq - Patent sequence entries, part 154.
1409. gbpat155.seq - Patent sequence entries, part 155.
1410. gbpat156.seq - Patent sequence entries, part 156.
1411. gbpat157.seq - Patent sequence entries, part 157.
1412. gbpat158.seq - Patent sequence entries, part 158.
1413. gbpat159.seq - Patent sequence entries, part 159.
1414. gbpat16.seq - Patent sequence entries, part 16.
1415. gbpat160.seq - Patent sequence entries, part 160.
1416. gbpat161.seq - Patent sequence entries, part 161.
1417. gbpat162.seq - Patent sequence entries, part 162.
1418. gbpat163.seq - Patent sequence entries, part 163.
1419. gbpat164.seq - Patent sequence entries, part 164.
1420. gbpat165.seq - Patent sequence entries, part 165.
1421. gbpat166.seq - Patent sequence entries, part 166.
1422. gbpat167.seq - Patent sequence entries, part 167.
1423. gbpat168.seq - Patent sequence entries, part 168.
1424. gbpat169.seq - Patent sequence entries, part 169.
1425. gbpat17.seq - Patent sequence entries, part 17.
1426. gbpat170.seq - Patent sequence entries, part 170.
1427. gbpat171.seq - Patent sequence entries, part 171.
1428. gbpat172.seq - Patent sequence entries, part 172.
1429. gbpat173.seq - Patent sequence entries, part 173.
1430. gbpat174.seq - Patent sequence entries, part 174.
1431. gbpat175.seq - Patent sequence entries, part 175.
1432. gbpat176.seq - Patent sequence entries, part 176.
1433. gbpat177.seq - Patent sequence entries, part 177.
1434. gbpat178.seq - Patent sequence entries, part 178.
1435. gbpat179.seq - Patent sequence entries, part 179.
1436. gbpat18.seq - Patent sequence entries, part 18.
1437. gbpat180.seq - Patent sequence entries, part 180.
1438. gbpat19.seq - Patent sequence entries, part 19.
1439. gbpat2.seq - Patent sequence entries, part 2.
1440. gbpat20.seq - Patent sequence entries, part 20.
1441. gbpat21.seq - Patent sequence entries, part 21.
1442. gbpat22.seq - Patent sequence entries, part 22.
1443. gbpat23.seq - Patent sequence entries, part 23.
1444. gbpat24.seq - Patent sequence entries, part 24.
1445. gbpat25.seq - Patent sequence entries, part 25.
1446. gbpat26.seq - Patent sequence entries, part 26.
1447. gbpat27.seq - Patent sequence entries, part 27.
1448. gbpat28.seq - Patent sequence entries, part 28.
1449. gbpat29.seq - Patent sequence entries, part 29.
1450. gbpat3.seq - Patent sequence entries, part 3.
1451. gbpat30.seq - Patent sequence entries, part 30.
1452. gbpat31.seq - Patent sequence entries, part 31.
1453. gbpat32.seq - Patent sequence entries, part 32.
1454. gbpat33.seq - Patent sequence entries, part 33.
1455. gbpat34.seq - Patent sequence entries, part 34.
1456. gbpat35.seq - Patent sequence entries, part 35.
1457. gbpat36.seq - Patent sequence entries, part 36.
1458. gbpat37.seq - Patent sequence entries, part 37.
1459. gbpat38.seq - Patent sequence entries, part 38.
1460. gbpat39.seq - Patent sequence entries, part 39.
1461. gbpat4.seq - Patent sequence entries, part 4.
1462. gbpat40.seq - Patent sequence entries, part 40.
1463. gbpat41.seq - Patent sequence entries, part 41.
1464. gbpat42.seq - Patent sequence entries, part 42.
1465. gbpat43.seq - Patent sequence entries, part 43.
1466. gbpat44.seq - Patent sequence entries, part 44.
1467. gbpat45.seq - Patent sequence entries, part 45.
1468. gbpat46.seq - Patent sequence entries, part 46.
1469. gbpat47.seq - Patent sequence entries, part 47.
1470. gbpat48.seq - Patent sequence entries, part 48.
1471. gbpat49.seq - Patent sequence entries, part 49.
1472. gbpat5.seq - Patent sequence entries, part 5.
1473. gbpat50.seq - Patent sequence entries, part 50.
1474. gbpat51.seq - Patent sequence entries, part 51.
1475. gbpat52.seq - Patent sequence entries, part 52.
1476. gbpat53.seq - Patent sequence entries, part 53.
1477. gbpat54.seq - Patent sequence entries, part 54.
1478. gbpat55.seq - Patent sequence entries, part 55.
1479. gbpat56.seq - Patent sequence entries, part 56.
1480. gbpat57.seq - Patent sequence entries, part 57.
1481. gbpat58.seq - Patent sequence entries, part 58.
1482. gbpat59.seq - Patent sequence entries, part 59.
1483. gbpat6.seq - Patent sequence entries, part 6.
1484. gbpat60.seq - Patent sequence entries, part 60.
1485. gbpat61.seq - Patent sequence entries, part 61.
1486. gbpat62.seq - Patent sequence entries, part 62.
1487. gbpat63.seq - Patent sequence entries, part 63.
1488. gbpat64.seq - Patent sequence entries, part 64.
1489. gbpat65.seq - Patent sequence entries, part 65.
1490. gbpat66.seq - Patent sequence entries, part 66.
1491. gbpat67.seq - Patent sequence entries, part 67.
1492. gbpat68.seq - Patent sequence entries, part 68.
1493. gbpat69.seq - Patent sequence entries, part 69.
1494. gbpat7.seq - Patent sequence entries, part 7.
1495. gbpat70.seq - Patent sequence entries, part 70.
1496. gbpat71.seq - Patent sequence entries, part 71.
1497. gbpat72.seq - Patent sequence entries, part 72.
1498. gbpat73.seq - Patent sequence entries, part 73.
1499. gbpat74.seq - Patent sequence entries, part 74.
1500. gbpat75.seq - Patent sequence entries, part 75.
1501. gbpat76.seq - Patent sequence entries, part 76.
1502. gbpat77.seq - Patent sequence entries, part 77.
1503. gbpat78.seq - Patent sequence entries, part 78.
1504. gbpat79.seq - Patent sequence entries, part 79.
1505. gbpat8.seq - Patent sequence entries, part 8.
1506. gbpat80.seq - Patent sequence entries, part 80.
1507. gbpat81.seq - Patent sequence entries, part 81.
1508. gbpat82.seq - Patent sequence entries, part 82.
1509. gbpat83.seq - Patent sequence entries, part 83.
1510. gbpat84.seq - Patent sequence entries, part 84.
1511. gbpat85.seq - Patent sequence entries, part 85.
1512. gbpat86.seq - Patent sequence entries, part 86.
1513. gbpat87.seq - Patent sequence entries, part 87.
1514. gbpat88.seq - Patent sequence entries, part 88.
1515. gbpat89.seq - Patent sequence entries, part 89.
1516. gbpat9.seq - Patent sequence entries, part 9.
1517. gbpat90.seq - Patent sequence entries, part 90.
1518. gbpat91.seq - Patent sequence entries, part 91.
1519. gbpat92.seq - Patent sequence entries, part 92.
1520. gbpat93.seq - Patent sequence entries, part 93.
1521. gbpat94.seq - Patent sequence entries, part 94.
1522. gbpat95.seq - Patent sequence entries, part 95.
1523. gbpat96.seq - Patent sequence entries, part 96.
1524. gbpat97.seq - Patent sequence entries, part 97.
1525. gbpat98.seq - Patent sequence entries, part 98.
1526. gbpat99.seq - Patent sequence entries, part 99.
1527. gbphg1.seq - Phage sequence entries, part 1.
1528. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1529. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1530. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1531. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1532. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1533. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1534. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1535. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1536. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1537. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1538. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1539. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1540. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1541. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1542. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1543. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1544. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1545. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1546. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1547. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1548. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1549. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1550. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1551. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1552. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1553. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1554. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1555. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1556. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1557. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1558. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1559. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1560. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1561. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1562. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1563. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1564. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1565. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1566. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1567. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1568. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1569. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1570. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1571. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1572. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1573. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1574. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1575. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1576. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1577. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1578. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1579. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1580. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1581. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1582. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1583. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1584. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1585. gbpri1.seq - Primate sequence entries, part 1.
1586. gbpri10.seq - Primate sequence entries, part 10.
1587. gbpri11.seq - Primate sequence entries, part 11.
1588. gbpri12.seq - Primate sequence entries, part 12.
1589. gbpri13.seq - Primate sequence entries, part 13.
1590. gbpri14.seq - Primate sequence entries, part 14.
1591. gbpri15.seq - Primate sequence entries, part 15.
1592. gbpri16.seq - Primate sequence entries, part 16.
1593. gbpri17.seq - Primate sequence entries, part 17.
1594. gbpri18.seq - Primate sequence entries, part 18.
1595. gbpri19.seq - Primate sequence entries, part 19.
1596. gbpri2.seq - Primate sequence entries, part 2.
1597. gbpri20.seq - Primate sequence entries, part 20.
1598. gbpri21.seq - Primate sequence entries, part 21.
1599. gbpri22.seq - Primate sequence entries, part 22.
1600. gbpri23.seq - Primate sequence entries, part 23.
1601. gbpri24.seq - Primate sequence entries, part 24.
1602. gbpri25.seq - Primate sequence entries, part 25.
1603. gbpri26.seq - Primate sequence entries, part 26.
1604. gbpri27.seq - Primate sequence entries, part 27.
1605. gbpri28.seq - Primate sequence entries, part 28.
1606. gbpri29.seq - Primate sequence entries, part 29.
1607. gbpri3.seq - Primate sequence entries, part 3.
1608. gbpri30.seq - Primate sequence entries, part 30.
1609. gbpri31.seq - Primate sequence entries, part 31.
1610. gbpri32.seq - Primate sequence entries, part 32.
1611. gbpri33.seq - Primate sequence entries, part 33.
1612. gbpri34.seq - Primate sequence entries, part 34.
1613. gbpri35.seq - Primate sequence entries, part 35.
1614. gbpri36.seq - Primate sequence entries, part 36.
1615. gbpri37.seq - Primate sequence entries, part 37.
1616. gbpri38.seq - Primate sequence entries, part 38.
1617. gbpri39.seq - Primate sequence entries, part 39.
1618. gbpri4.seq - Primate sequence entries, part 4.
1619. gbpri40.seq - Primate sequence entries, part 40.
1620. gbpri41.seq - Primate sequence entries, part 41.
1621. gbpri42.seq - Primate sequence entries, part 42.
1622. gbpri43.seq - Primate sequence entries, part 43.
1623. gbpri44.seq - Primate sequence entries, part 44.
1624. gbpri45.seq - Primate sequence entries, part 45.
1625. gbpri5.seq - Primate sequence entries, part 5.
1626. gbpri6.seq - Primate sequence entries, part 6.
1627. gbpri7.seq - Primate sequence entries, part 7.
1628. gbpri8.seq - Primate sequence entries, part 8.
1629. gbpri9.seq - Primate sequence entries, part 9.
1630. gbrel.txt - Release notes (this document).
1631. gbrod1.seq - Rodent sequence entries, part 1.
1632. gbrod10.seq - Rodent sequence entries, part 10.
1633. gbrod11.seq - Rodent sequence entries, part 11.
1634. gbrod12.seq - Rodent sequence entries, part 12.
1635. gbrod13.seq - Rodent sequence entries, part 13.
1636. gbrod14.seq - Rodent sequence entries, part 14.
1637. gbrod15.seq - Rodent sequence entries, part 15.
1638. gbrod16.seq - Rodent sequence entries, part 16.
1639. gbrod17.seq - Rodent sequence entries, part 17.
1640. gbrod18.seq - Rodent sequence entries, part 18.
1641. gbrod19.seq - Rodent sequence entries, part 19.
1642. gbrod2.seq - Rodent sequence entries, part 2.
1643. gbrod20.seq - Rodent sequence entries, part 20.
1644. gbrod21.seq - Rodent sequence entries, part 21.
1645. gbrod22.seq - Rodent sequence entries, part 22.
1646. gbrod23.seq - Rodent sequence entries, part 23.
1647. gbrod24.seq - Rodent sequence entries, part 24.
1648. gbrod25.seq - Rodent sequence entries, part 25.
1649. gbrod26.seq - Rodent sequence entries, part 26.
1650. gbrod27.seq - Rodent sequence entries, part 27.
1651. gbrod28.seq - Rodent sequence entries, part 28.
1652. gbrod29.seq - Rodent sequence entries, part 29.
1653. gbrod3.seq - Rodent sequence entries, part 3.
1654. gbrod4.seq - Rodent sequence entries, part 4.
1655. gbrod5.seq - Rodent sequence entries, part 5.
1656. gbrod6.seq - Rodent sequence entries, part 6.
1657. gbrod7.seq - Rodent sequence entries, part 7.
1658. gbrod8.seq - Rodent sequence entries, part 8.
1659. gbrod9.seq - Rodent sequence entries, part 9.
1660. gbsdr1.txt - Short directory of the data bank, part 1.
1661. gbsdr2.txt - Short directory of the data bank, part 2.
1662. gbsdr3.txt - Short directory of the data bank, part 3.
1663. gbsec.idx - Index of the entries according to secondary accession number.
1664. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1665. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1666. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1667. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1668. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1669. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1670. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1671. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1672. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1673. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1674. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1675. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1676. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1677. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1678. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1679. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1680. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1681. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1682. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1683. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1684. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1685. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1686. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1687. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1688. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1689. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1690. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1691. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1692. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1693. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1694. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1695. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1696. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1697. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1698. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1699. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1700. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1701. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1702. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1703. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1704. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1705. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1706. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1707. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1708. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1709. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1710. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1711. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1712. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1713. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1714. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1715. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1716. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1717. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1718. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1719. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1720. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1721. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1722. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1723. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1724. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1725. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1726. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1727. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1728. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1729. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1730. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1731. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1732. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1733. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1734. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1735. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1736. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1737. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1738. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1739. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1740. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1741. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1742. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1743. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1744. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1745. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1746. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1747. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1748. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1749. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1750. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1751. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1752. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1753. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1754. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1755. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1756. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1757. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1758. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1759. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1760. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1761. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1762. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1763. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1764. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1765. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1766. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1767. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1768. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1769. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1770. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1771. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1772. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1773. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1774. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1775. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1776. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1777. gbuna1.seq - Unannotated sequence entries, part 1.
1778. gbvrl1.seq - Viral sequence entries, part 1.
1779. gbvrl10.seq - Viral sequence entries, part 10.
1780. gbvrl11.seq - Viral sequence entries, part 11.
1781. gbvrl12.seq - Viral sequence entries, part 12.
1782. gbvrl13.seq - Viral sequence entries, part 13.
1783. gbvrl14.seq - Viral sequence entries, part 14.
1784. gbvrl15.seq - Viral sequence entries, part 15.
1785. gbvrl16.seq - Viral sequence entries, part 16.
1786. gbvrl17.seq - Viral sequence entries, part 17.
1787. gbvrl18.seq - Viral sequence entries, part 18.
1788. gbvrl19.seq - Viral sequence entries, part 19.
1789. gbvrl2.seq - Viral sequence entries, part 2.
1790. gbvrl20.seq - Viral sequence entries, part 20.
1791. gbvrl21.seq - Viral sequence entries, part 21.
1792. gbvrl3.seq - Viral sequence entries, part 3.
1793. gbvrl4.seq - Viral sequence entries, part 4.
1794. gbvrl5.seq - Viral sequence entries, part 5.
1795. gbvrl6.seq - Viral sequence entries, part 6.
1796. gbvrl7.seq - Viral sequence entries, part 7.
1797. gbvrl8.seq - Viral sequence entries, part 8.
1798. gbvrl9.seq - Viral sequence entries, part 9.
1799. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1800. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1801. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1802. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1803. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1804. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1805. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1806. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1807. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1808. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1809. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1810. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1811. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1812. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1813. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1814. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1815. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1816. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1817. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1818. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1819. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1820. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1821. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1822. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1823. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1824. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 190.0 flatfiles require roughly 553 GB (sequence
files only) or 595 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

2044852570     gbacc1.idx
2415664515     gbacc2.idx
 848527752     gbacc3.idx
 185421350     gbaut1.idx
 184392335     gbaut10.idx
 184264005     gbaut11.idx
 184620379     gbaut12.idx
 186026701     gbaut13.idx
 187347158     gbaut14.idx
 183895460     gbaut15.idx
 190145846     gbaut16.idx
 190964581     gbaut17.idx
 185818125     gbaut18.idx
 246586990     gbaut19.idx
 251952312     gbaut2.idx
 189963780     gbaut20.idx
 185462589     gbaut21.idx
 183919833     gbaut22.idx
 216922016     gbaut23.idx
 188106542     gbaut24.idx
 184113217     gbaut25.idx
 184297510     gbaut26.idx
 186520333     gbaut27.idx
 184965954     gbaut28.idx
 187484093     gbaut29.idx
 224319905     gbaut3.idx
 198214632     gbaut30.idx
 195621744     gbaut31.idx
 219320842     gbaut32.idx
 224899136     gbaut33.idx
 183949192     gbaut34.idx
 194148008     gbaut35.idx
 208578955     gbaut36.idx
 183870384     gbaut37.idx
 191491819     gbaut38.idx
 184530335     gbaut39.idx
 183997366     gbaut4.idx
 202000366     gbaut40.idx
 185293208     gbaut41.idx
 185157022     gbaut42.idx
 187444112     gbaut43.idx
 188146741     gbaut44.idx
 184117010     gbaut45.idx
 183810312     gbaut46.idx
 185733688     gbaut47.idx
 206064385     gbaut48.idx
 183936703     gbaut49.idx
 254855678     gbaut5.idx
 184563710     gbaut50.idx
 184483774     gbaut51.idx
 187076337     gbaut52.idx
 205044241     gbaut53.idx
 187387952     gbaut54.idx
 184582804     gbaut55.idx
 190950833     gbaut56.idx
 184645088     gbaut57.idx
 184385903     gbaut58.idx
 245127099     gbaut59.idx
 208699189     gbaut6.idx
 184402025     gbaut60.idx
 183919198     gbaut61.idx
 184000264     gbaut62.idx
 187583149     gbaut63.idx
 183873946     gbaut64.idx
 213552878     gbaut65.idx
 183854230     gbaut66.idx
 185134916     gbaut67.idx
 184236973     gbaut68.idx
 186781187     gbaut69.idx
 188797534     gbaut7.idx
 235376470     gbaut70.idx
 194370833     gbaut71.idx
 184122396     gbaut72.idx
 187679140     gbaut73.idx
 184043136     gbaut74.idx
 184206776     gbaut75.idx
 184709093     gbaut76.idx
 205726900     gbaut77.idx
 235131661     gbaut78.idx
 222030024     gbaut79.idx
 184402781     gbaut8.idx
 184051272     gbaut80.idx
 186470472     gbaut81.idx
 183908610     gbaut82.idx
 187047378     gbaut83.idx
 183990677     gbaut84.idx
 201132434     gbaut85.idx
 195295249     gbaut86.idx
 248712445     gbaut87.idx
 184061738     gbaut88.idx
 184213804     gbaut89.idx
 203801420     gbaut9.idx
 183877934     gbaut90.idx
 200775865     gbaut91.idx
 184049976     gbaut92.idx
 199064588     gbaut93.idx
 184590059     gbaut94.idx
 188003483     gbaut95.idx
 211333928     gbaut96.idx
 187057119     gbaut97.idx
 189726762     gbaut98.idx
  31933974     gbaut99.idx
 250000180     gbbct1.seq
 248267367     gbbct10.seq
 248781226     gbbct11.seq
 238005077     gbbct12.seq
 249996924     gbbct13.seq
  55049918     gbbct14.seq
 243170751     gbbct15.seq
 249783342     gbbct16.seq
 245552146     gbbct17.seq
 248629037     gbbct18.seq
 248242267     gbbct19.seq
 248881985     gbbct2.seq
 249282033     gbbct20.seq
 246198766     gbbct21.seq
 245693484     gbbct22.seq
 217807523     gbbct23.seq
 242803907     gbbct24.seq
 241841159     gbbct25.seq
 248677491     gbbct26.seq
 247875393     gbbct27.seq
 249388317     gbbct28.seq
 244186125     gbbct29.seq
 247570692     gbbct3.seq
 247337080     gbbct30.seq
 249996823     gbbct31.seq
 249761469     gbbct32.seq
 249791029     gbbct33.seq
 242886692     gbbct34.seq
 241636446     gbbct35.seq
 164818069     gbbct36.seq
 243024940     gbbct37.seq
 244319012     gbbct38.seq
 244939796     gbbct39.seq
 241184768     gbbct4.seq
 235925835     gbbct40.seq
 246706138     gbbct41.seq
 248039724     gbbct42.seq
 246778832     gbbct43.seq
 231062264     gbbct44.seq
 243873251     gbbct45.seq
 249854455     gbbct46.seq
 235954696     gbbct47.seq
 231580036     gbbct48.seq
 249922026     gbbct49.seq
 213987193     gbbct5.seq
 247105195     gbbct50.seq
 241662950     gbbct51.seq
 245557908     gbbct52.seq
 244123130     gbbct53.seq
 240008572     gbbct54.seq
 241268712     gbbct55.seq
 249301542     gbbct56.seq
 249373846     gbbct57.seq
 247134592     gbbct58.seq
 242978877     gbbct59.seq
 242137198     gbbct6.seq
 242457662     gbbct60.seq
  45359479     gbbct61.seq
 247983762     gbbct62.seq
 229930428     gbbct63.seq
 242702827     gbbct64.seq
 249715641     gbbct65.seq
 245213927     gbbct66.seq
 243140196     gbbct67.seq
  29465664     gbbct68.seq
   6888220     gbbct69.seq
 244097584     gbbct7.seq
  14097435     gbbct70.seq
  23202049     gbbct71.seq
  45101216     gbbct72.seq
  87786070     gbbct73.seq
 170123232     gbbct74.seq
 249998228     gbbct75.seq
 249998024     gbbct76.seq
 243975663     gbbct77.seq
 239379383     gbbct78.seq
 247410755     gbbct79.seq
 229621289     gbbct8.seq
 248640310     gbbct80.seq
 249437581     gbbct81.seq
 249998318     gbbct82.seq
 105443708     gbbct83.seq
 249839347     gbbct84.seq
 249999049     gbbct85.seq
 249999820     gbbct86.seq
 249999785     gbbct87.seq
 226018478     gbbct88.seq
 245129482     gbbct9.seq
  24939851     gbchg.txt
 249998031     gbcon1.seq
 249997677     gbcon10.seq
 249994223     gbcon100.seq
 249995660     gbcon101.seq
 249998605     gbcon102.seq
 249998936     gbcon103.seq
 250000223     gbcon104.seq
 156342446     gbcon105.seq
 249996812     gbcon106.seq
 249993767     gbcon107.seq
 249992301     gbcon108.seq
 249998253     gbcon109.seq
 249620021     gbcon11.seq
  71761075     gbcon110.seq
 213032643     gbcon111.seq
 250000256     gbcon112.seq
 250000098     gbcon113.seq
 249995503     gbcon114.seq
 249986388     gbcon115.seq
 109734089     gbcon116.seq
 249914315     gbcon117.seq
 249998919     gbcon118.seq
 180318680     gbcon119.seq
 247541115     gbcon12.seq
 249997285     gbcon120.seq
 250000198     gbcon121.seq
 249998745     gbcon122.seq
 222379519     gbcon123.seq
 249624887     gbcon124.seq
 249970373     gbcon125.seq
 249856213     gbcon126.seq
 249999989     gbcon127.seq
 250000179     gbcon128.seq
 249994568     gbcon129.seq
 248688966     gbcon13.seq
  27918785     gbcon130.seq
 249966898     gbcon131.seq
 249999302     gbcon132.seq
 249996205     gbcon133.seq
 249897273     gbcon134.seq
 249952724     gbcon135.seq
 249989812     gbcon136.seq
 249979778     gbcon137.seq
 233694874     gbcon138.seq
 246632492     gbcon139.seq
 250000019     gbcon14.seq
 247106152     gbcon140.seq
 249710173     gbcon141.seq
 249974201     gbcon142.seq
 108900727     gbcon143.seq
 250000100     gbcon144.seq
 249759495     gbcon145.seq
 249994840     gbcon146.seq
 249882748     gbcon147.seq
 249997548     gbcon148.seq
 249997824     gbcon149.seq
  65047734     gbcon15.seq
 249984507     gbcon150.seq
 249999751     gbcon151.seq
 203507428     gbcon152.seq
 249976952     gbcon153.seq
 249999146     gbcon154.seq
 249999767     gbcon155.seq
 249936790     gbcon156.seq
 250000041     gbcon157.seq
 130404362     gbcon158.seq
 250000007     gbcon159.seq
 248523003     gbcon16.seq
 249982484     gbcon160.seq
 249998652     gbcon161.seq
 249997399     gbcon162.seq
 249999113     gbcon163.seq
 249974608     gbcon164.seq
 249958025     gbcon165.seq
 249919532     gbcon166.seq
 249993346     gbcon167.seq
 142933131     gbcon168.seq
  18856950     gbcon169.seq
 249997898     gbcon17.seq
 249790103     gbcon18.seq
  57840649     gbcon19.seq
 248936838     gbcon2.seq
 249997878     gbcon20.seq
 249747589     gbcon21.seq
 116219457     gbcon22.seq
 249999291     gbcon23.seq
 120224101     gbcon24.seq
 249998895     gbcon25.seq
 249823610     gbcon26.seq
 250000223     gbcon27.seq
 249997453     gbcon28.seq
 186630076     gbcon29.seq
 249787214     gbcon3.seq
 249999756     gbcon30.seq
 249997224     gbcon31.seq
 249999813     gbcon32.seq
 249999952     gbcon33.seq
 248008966     gbcon34.seq
 232565670     gbcon35.seq
 249999237     gbcon36.seq
 249996869     gbcon37.seq
 249995921     gbcon38.seq
 249996351     gbcon39.seq
 249992212     gbcon4.seq
 249999450     gbcon40.seq
 249997210     gbcon41.seq
  61183731     gbcon42.seq
 249997486     gbcon43.seq
 249994070     gbcon44.seq
 249999391     gbcon45.seq
 249997743     gbcon46.seq
 249994859     gbcon47.seq
  43089049     gbcon48.seq
 249993995     gbcon49.seq
 249999297     gbcon5.seq
 249996310     gbcon50.seq
 249994442     gbcon51.seq
 249997248     gbcon52.seq
 250000078     gbcon53.seq
  36404971     gbcon54.seq
 249993185     gbcon55.seq
 249998119     gbcon56.seq
 249995170     gbcon57.seq
 249998154     gbcon58.seq
 249998078     gbcon59.seq
 249999478     gbcon6.seq
 152679523     gbcon60.seq
 249999955     gbcon61.seq
 249999066     gbcon62.seq
 249997558     gbcon63.seq
 249998625     gbcon64.seq
 183609322     gbcon65.seq
 249999870     gbcon66.seq
 249997967     gbcon67.seq
 249997138     gbcon68.seq
 249995207     gbcon69.seq
 249952781     gbcon7.seq
 245488804     gbcon70.seq
 250000182     gbcon71.seq
 249998695     gbcon72.seq
 249998372     gbcon73.seq
 249996966     gbcon74.seq
 250000007     gbcon75.seq
  96627683     gbcon76.seq
 249993448     gbcon77.seq
 249997901     gbcon78.seq
 249999306     gbcon79.seq
 249993269     gbcon8.seq
 249998084     gbcon80.seq
 249998231     gbcon81.seq
  63991927     gbcon82.seq
 249999058     gbcon83.seq
 249997187     gbcon84.seq
 249997685     gbcon85.seq
 249997978     gbcon86.seq
 249999931     gbcon87.seq
  23617925     gbcon88.seq
 249997115     gbcon89.seq
 249998986     gbcon9.seq
 249995538     gbcon90.seq
 249998987     gbcon91.seq
 249999150     gbcon92.seq
 199759401     gbcon93.seq
 249998078     gbcon94.seq
 249998929     gbcon95.seq
 249997180     gbcon96.seq
 249997829     gbcon97.seq
 249999974     gbcon98.seq
 133578884     gbcon99.seq
     72435     gbdel.txt
 249999575     gbenv1.seq
 250000185     gbenv10.seq
  56503904     gbenv11.seq
 249999642     gbenv12.seq
 249998684     gbenv13.seq
 249999911     gbenv14.seq
 249999049     gbenv15.seq
 249999687     gbenv16.seq
 249999958     gbenv17.seq
 249997180     gbenv18.seq
 209169909     gbenv19.seq
 249998261     gbenv2.seq
 250000259     gbenv20.seq
 250000154     gbenv21.seq
 249998998     gbenv22.seq
 249999430     gbenv23.seq
 156315060     gbenv24.seq
 249998860     gbenv25.seq
 249997133     gbenv26.seq
 249999398     gbenv27.seq
 250000134     gbenv28.seq
 249998129     gbenv29.seq
 249998727     gbenv3.seq
 168375285     gbenv30.seq
 250000150     gbenv31.seq
 249998347     gbenv32.seq
 249999049     gbenv33.seq
 249997022     gbenv34.seq
 185875694     gbenv35.seq
 249999717     gbenv36.seq
 249999103     gbenv37.seq
 249997083     gbenv38.seq
 249997894     gbenv39.seq
 250000220     gbenv4.seq
 249996689     gbenv40.seq
 249996831     gbenv41.seq
  21888207     gbenv42.seq
 249999002     gbenv43.seq
 249998549     gbenv44.seq
 249998178     gbenv45.seq
 249999252     gbenv46.seq
 167938448     gbenv47.seq
 249997838     gbenv48.seq
 249999471     gbenv49.seq
 249998701     gbenv5.seq
 249996304     gbenv50.seq
 249999127     gbenv51.seq
 249998713     gbenv52.seq
 249999871     gbenv53.seq
 183666247     gbenv54.seq
 240962733     gbenv6.seq
 249997397     gbenv7.seq
 249999216     gbenv8.seq
 249997830     gbenv9.seq
 524292008     gbest1.seq
 524288804     gbest10.seq
 524288818     gbest100.seq
 524290484     gbest101.seq
 524290989     gbest102.seq
 524288825     gbest103.seq
 360266833     gbest104.seq
 524291148     gbest105.seq
 524288844     gbest106.seq
 524292352     gbest107.seq
 385897526     gbest108.seq
 389627022     gbest109.seq
 524291005     gbest11.seq
 383480158     gbest110.seq
 384129224     gbest111.seq
 381044237     gbest112.seq
 385319121     gbest113.seq
 390042794     gbest114.seq
 388183097     gbest115.seq
 387287058     gbest116.seq
 383873517     gbest117.seq
 407574183     gbest118.seq
 511503823     gbest119.seq
 524290913     gbest12.seq
 524289208     gbest120.seq
 524289368     gbest121.seq
 524289152     gbest122.seq
 524290278     gbest123.seq
 428160305     gbest124.seq
 524289395     gbest125.seq
 524291003     gbest126.seq
 524289206     gbest127.seq
 524288788     gbest128.seq
 524292302     gbest129.seq
 156598007     gbest13.seq
 524290254     gbest130.seq
 524288989     gbest131.seq
 524291260     gbest132.seq
 524289953     gbest133.seq
 524292326     gbest134.seq
 524289013     gbest135.seq
 524290520     gbest136.seq
 299893019     gbest137.seq
 524290513     gbest138.seq
 524289694     gbest139.seq
 524289958     gbest14.seq
 524288973     gbest140.seq
 524290363     gbest141.seq
 524293655     gbest142.seq
 524289734     gbest143.seq
 524290694     gbest144.seq
 524290459     gbest145.seq
 524291200     gbest146.seq
 524291784     gbest147.seq
 524289899     gbest148.seq
 524288888     gbest149.seq
 524291437     gbest15.seq
 524291140     gbest150.seq
 465419493     gbest151.seq
 524290089     gbest152.seq
 524291577     gbest153.seq
 524288928     gbest154.seq
 524288878     gbest155.seq
 524290400     gbest156.seq
 524289353     gbest157.seq
 524291205     gbest158.seq
 524289380     gbest159.seq
 524289303     gbest16.seq
 524290761     gbest160.seq
 524289178     gbest161.seq
 524288730     gbest162.seq
 524290933     gbest163.seq
 245079342     gbest164.seq
 524289428     gbest165.seq
 524290492     gbest166.seq
 524291139     gbest167.seq
 524290360     gbest168.seq
 524290893     gbest169.seq
 524291325     gbest17.seq
 524289558     gbest170.seq
 524290613     gbest171.seq
 524290355     gbest172.seq
 524289228     gbest173.seq
 524290186     gbest174.seq
 524290536     gbest175.seq
 524288940     gbest176.seq
 524292341     gbest177.seq
 111192436     gbest178.seq
 524290449     gbest179.seq
 524290068     gbest18.seq
 524290245     gbest180.seq
 524289032     gbest181.seq
 524290805     gbest182.seq
 524290975     gbest183.seq
 524290572     gbest184.seq
 524292060     gbest185.seq
 524289570     gbest186.seq
 524290463     gbest187.seq
 524289124     gbest188.seq
 524291002     gbest189.seq
 524292240     gbest19.seq
 524289736     gbest190.seq
 467468230     gbest191.seq
 524292836     gbest192.seq
 524289584     gbest193.seq
 524289688     gbest194.seq
 524290421     gbest195.seq
 524291331     gbest196.seq
 524290000     gbest197.seq
 524290120     gbest198.seq
 524289941     gbest199.seq
 524289694     gbest2.seq
 524289440     gbest20.seq
 524290799     gbest200.seq
 524291059     gbest201.seq
 524289743     gbest202.seq
 524291709     gbest203.seq
 524290922     gbest204.seq
  78323409     gbest205.seq
 524290998     gbest206.seq
 524289308     gbest207.seq
 524290738     gbest208.seq
 524289458     gbest209.seq
 524290938     gbest21.seq
 524292317     gbest210.seq
 524289332     gbest211.seq
 524290236     gbest212.seq
 524288826     gbest213.seq
 524288730     gbest214.seq
 524290086     gbest215.seq
 419061324     gbest216.seq
 524291312     gbest217.seq
 524292660     gbest218.seq
 524289985     gbest219.seq
 511473455     gbest22.seq
 524290465     gbest220.seq
 524288877     gbest221.seq
 524289271     gbest222.seq
 524292296     gbest223.seq
 524290436     gbest224.seq
 524289296     gbest225.seq
 524288978     gbest226.seq
 524290505     gbest227.seq
 524290541     gbest228.seq
 524292348     gbest229.seq
 500459870     gbest23.seq
 348447235     gbest230.seq
 524288851     gbest231.seq
 524289665     gbest232.seq
 524289697     gbest233.seq
 524288722     gbest234.seq
 524292658     gbest235.seq
 524289802     gbest236.seq
 524291322     gbest237.seq
 524289521     gbest238.seq
 524290452     gbest239.seq
 509316969     gbest24.seq
 524290068     gbest240.seq
 524290546     gbest241.seq
 524289110     gbest242.seq
 524291672     gbest243.seq
 524291052     gbest244.seq
  48098032     gbest245.seq
 524290789     gbest246.seq
 524289809     gbest247.seq
 524291785     gbest248.seq
 524290787     gbest249.seq
 318221390     gbest25.seq
 524288904     gbest250.seq
 524290074     gbest251.seq
 524289617     gbest252.seq
 524292072     gbest253.seq
 524291092     gbest254.seq
 524289670     gbest255.seq
 524291387     gbest256.seq
 260315307     gbest257.seq
 524289205     gbest258.seq
 524290518     gbest259.seq
 524289786     gbest26.seq
 524289209     gbest260.seq
 524290324     gbest261.seq
 524289231     gbest262.seq
 524290692     gbest263.seq
 524290618     gbest264.seq
 524289350     gbest265.seq
 524290766     gbest266.seq
 524292392     gbest267.seq
 296849686     gbest268.seq
 524289652     gbest269.seq
 524290608     gbest27.seq
 524290620     gbest270.seq
 524288728     gbest271.seq
 524289720     gbest272.seq
 524290852     gbest273.seq
 524291105     gbest274.seq
 524288912     gbest275.seq
 524290060     gbest276.seq
 524288862     gbest277.seq
 524291602     gbest278.seq
 524292455     gbest279.seq
 524290267     gbest28.seq
 302201519     gbest280.seq
 524292997     gbest281.seq
 524288962     gbest282.seq
 524289504     gbest283.seq
 524290600     gbest284.seq
 524289318     gbest285.seq
 524290164     gbest286.seq
 524289230     gbest287.seq
 524291333     gbest288.seq
 524289850     gbest289.seq
 524290004     gbest29.seq
 524290445     gbest290.seq
 524291756     gbest291.seq
 227738575     gbest292.seq
 524288789     gbest293.seq
 524289637     gbest294.seq
 524290096     gbest295.seq
 524292128     gbest296.seq
 524291196     gbest297.seq
 524290208     gbest298.seq
 524290154     gbest299.seq
 497701912     gbest3.seq
 524292588     gbest30.seq
 524288840     gbest300.seq
 477430888     gbest301.seq
 485388879     gbest302.seq
 487643262     gbest303.seq
 320034000     gbest304.seq
 524291386     gbest305.seq
 524290165     gbest306.seq
 524292927     gbest307.seq
 524289307     gbest308.seq
 524292226     gbest309.seq
 524290499     gbest31.seq
 524292112     gbest310.seq
 524290451     gbest311.seq
 524290048     gbest312.seq
 524290484     gbest313.seq
 524290293     gbest314.seq
 524290387     gbest315.seq
 524291914     gbest316.seq
 497672470     gbest317.seq
 524290018     gbest318.seq
 524291635     gbest319.seq
 524291105     gbest32.seq
 524290461     gbest320.seq
 524291229     gbest321.seq
 524289371     gbest322.seq
 524291825     gbest323.seq
 524290125     gbest324.seq
 524290035     gbest325.seq
 524291136     gbest326.seq
 524114479     gbest327.seq
 524290817     gbest328.seq
 524291046     gbest329.seq
 524289163     gbest33.seq
 524290311     gbest330.seq
 250277380     gbest331.seq
 524288866     gbest332.seq
 524290019     gbest333.seq
 524290178     gbest334.seq
 524293206     gbest335.seq
 501679664     gbest336.seq
 524289164     gbest337.seq
 524290950     gbest338.seq
 524291691     gbest339.seq
 519995576     gbest34.seq
 524289435     gbest340.seq
 524291244     gbest341.seq
 524292163     gbest342.seq
 524289348     gbest343.seq
 524292124     gbest344.seq
 344037444     gbest345.seq
 524290826     gbest346.seq
 524290153     gbest347.seq
 524290301     gbest348.seq
 524289021     gbest349.seq
 492752443     gbest35.seq
 524289883     gbest350.seq
 524289255     gbest351.seq
 524290258     gbest352.seq
 524292881     gbest353.seq
 524291885     gbest354.seq
 524291474     gbest355.seq
 524290706     gbest356.seq
 524291844     gbest357.seq
 524291922     gbest358.seq
 524288931     gbest359.seq
 494461889     gbest36.seq
  23569950     gbest360.seq
 524288752     gbest361.seq
 524290986     gbest362.seq
 524291467     gbest363.seq
 524290555     gbest364.seq
 524291695     gbest365.seq
 524289885     gbest366.seq
 524290151     gbest367.seq
 524290226     gbest368.seq
 524290837     gbest369.seq
 493329100     gbest37.seq
 524290488     gbest370.seq
 386815583     gbest371.seq
 524289237     gbest372.seq
 524288899     gbest373.seq
 524290516     gbest374.seq
 524291457     gbest375.seq
 524289052     gbest376.seq
 524291580     gbest377.seq
 524289198     gbest378.seq
 524291118     gbest379.seq
 487992523     gbest38.seq
 524289322     gbest380.seq
 524290962     gbest381.seq
 524290805     gbest382.seq
 342053922     gbest383.seq
 524289067     gbest384.seq
 524289146     gbest385.seq
 524288752     gbest386.seq
 524289317     gbest387.seq
 524288961     gbest388.seq
 524292348     gbest389.seq
 493187931     gbest39.seq
 524289085     gbest390.seq
 524290160     gbest391.seq
 524290764     gbest392.seq
 524289444     gbest393.seq
 524290079     gbest394.seq
  61522159     gbest395.seq
 524289249     gbest396.seq
 524289216     gbest397.seq
 524289670     gbest398.seq
 524290267     gbest399.seq
 524288944     gbest4.seq
 112853555     gbest40.seq
 524290202     gbest400.seq
 524290252     gbest401.seq
 524292014     gbest402.seq
 524288877     gbest403.seq
 524289957     gbest404.seq
 524289922     gbest405.seq
 524290394     gbest406.seq
 524289348     gbest407.seq
 484177592     gbest408.seq
 524289812     gbest409.seq
 524294013     gbest41.seq
 524289705     gbest410.seq
 524289420     gbest411.seq
 524291025     gbest412.seq
 524291458     gbest413.seq
 524290483     gbest414.seq
 524292475     gbest415.seq
 524289421     gbest416.seq
 524291735     gbest417.seq
 524291381     gbest418.seq
 524290155     gbest419.seq
 524292378     gbest42.seq
 524289129     gbest420.seq
 486207566     gbest421.seq
 524290939     gbest422.seq
 524291326     gbest423.seq
 524291321     gbest424.seq
 524289762     gbest425.seq
 524290372     gbest426.seq
 524289413     gbest427.seq
 524289874     gbest428.seq
 524291260     gbest429.seq
 524291152     gbest43.seq
 524290912     gbest430.seq
 524290057     gbest431.seq
 524290498     gbest432.seq
 524293648     gbest433.seq
 524290014     gbest434.seq
 524290211     gbest435.seq
  84614311     gbest436.seq
 524290862     gbest437.seq
 524288939     gbest438.seq
 524289644     gbest439.seq
 524291055     gbest44.seq
 524291690     gbest440.seq
 524290578     gbest441.seq
 524289510     gbest442.seq
 524291974     gbest443.seq
 524290738     gbest444.seq
 524290766     gbest445.seq
 524289893     gbest446.seq
 524289258     gbest447.seq
 433310930     gbest448.seq
 524289173     gbest449.seq
 524289238     gbest45.seq
 524291143     gbest450.seq
 524289693     gbest451.seq
 524289086     gbest452.seq
 524290878     gbest453.seq
 524289515     gbest454.seq
 524290201     gbest455.seq
 524289595     gbest456.seq
 524289554     gbest457.seq
 524290008     gbest458.seq
 524292517     gbest459.seq
 524290835     gbest46.seq
 257179200     gbest460.seq
 524290282     gbest461.seq
 524291959     gbest462.seq
 524289607     gbest463.seq
 247932027     gbest464.seq
 524291007     gbest47.seq
 524290466     gbest48.seq
 524290144     gbest49.seq
 524289625     gbest5.seq
 524290479     gbest50.seq
 524290055     gbest51.seq
 524288929     gbest52.seq
 524288811     gbest53.seq
 253344689     gbest54.seq
 524289570     gbest55.seq
 524289580     gbest56.seq
 524291000     gbest57.seq
 524289394     gbest58.seq
 524290388     gbest59.seq
 524288762     gbest6.seq
 524290340     gbest60.seq
 524291470     gbest61.seq
 524289195     gbest62.seq
 524291539     gbest63.seq
 524289624     gbest64.seq
 524289234     gbest65.seq
 524289537     gbest66.seq
 462233312     gbest67.seq
 524289050     gbest68.seq
 524289702     gbest69.seq
 524288977     gbest7.seq
 524290845     gbest70.seq
 524289719     gbest71.seq
 524289761     gbest72.seq
 524292289     gbest73.seq
 524289181     gbest74.seq
 524289131     gbest75.seq
 524294841     gbest76.seq
 524291384     gbest77.seq
 524292274     gbest78.seq
 524290205     gbest79.seq
 524290062     gbest8.seq
 189165514     gbest80.seq
 524290308     gbest81.seq
 524289330     gbest82.seq
 524289924     gbest83.seq
 524289535     gbest84.seq
 524290767     gbest85.seq
 524289277     gbest86.seq
 524289276     gbest87.seq
 524292778     gbest88.seq
 524291975     gbest89.seq
 524291254     gbest9.seq
 524289841     gbest90.seq
 524289188     gbest91.seq
 461500840     gbest92.seq
 524290500     gbest93.seq
 524292054     gbest94.seq
 524291571     gbest95.seq
 524289444     gbest96.seq
 524290291     gbest97.seq
 524289582     gbest98.seq
 524290127     gbest99.seq
 187813575     gbgen.idx
 524290527     gbgss1.seq
 524292173     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524290642     gbgss103.seq
 418354253     gbgss104.seq
 524290801     gbgss105.seq
 524290070     gbgss106.seq
 524290718     gbgss107.seq
 524288733     gbgss108.seq
 524288767     gbgss109.seq
 524291375     gbgss11.seq
 524289084     gbgss110.seq
 524290809     gbgss111.seq
 524289971     gbgss112.seq
 524291028     gbgss113.seq
 524291069     gbgss114.seq
 524289142     gbgss115.seq
  55578194     gbgss116.seq
 524289720     gbgss117.seq
 524288912     gbgss118.seq
 524289210     gbgss119.seq
 524290109     gbgss12.seq
 524289140     gbgss120.seq
 524290683     gbgss121.seq
 524289663     gbgss122.seq
 524289754     gbgss123.seq
 524289869     gbgss124.seq
 524290826     gbgss125.seq
 524289630     gbgss126.seq
 524289664     gbgss127.seq
 524289492     gbgss128.seq
 212391980     gbgss129.seq
 524289051     gbgss13.seq
 524289179     gbgss130.seq
 524289525     gbgss131.seq
 524289495     gbgss132.seq
 524291043     gbgss133.seq
 524288845     gbgss134.seq
 524289778     gbgss135.seq
 524289824     gbgss136.seq
 524288865     gbgss137.seq
 524289151     gbgss138.seq
 516020805     gbgss139.seq
 524289106     gbgss14.seq
 515998318     gbgss140.seq
 138159804     gbgss141.seq
 524289872     gbgss142.seq
 524291315     gbgss143.seq
 524290700     gbgss144.seq
 524291307     gbgss145.seq
 524290782     gbgss146.seq
 524289701     gbgss147.seq
 524289366     gbgss148.seq
 524291141     gbgss149.seq
 524291452     gbgss15.seq
 524290962     gbgss150.seq
 524290372     gbgss151.seq
 322462715     gbgss152.seq
 120680411     gbgss153.seq
 249998816     gbgss154.seq
 249999537     gbgss155.seq
 249999830     gbgss156.seq
 249998731     gbgss157.seq
  28697781     gbgss158.seq
 249997137     gbgss159.seq
 524290551     gbgss16.seq
 250000033     gbgss160.seq
 249998542     gbgss161.seq
 249998333     gbgss162.seq
 224919493     gbgss163.seq
 249998415     gbgss164.seq
 249998761     gbgss165.seq
 249998880     gbgss166.seq
 249998198     gbgss167.seq
 190065974     gbgss168.seq
 249999433     gbgss169.seq
 524288946     gbgss17.seq
 249998390     gbgss170.seq
 249999267     gbgss171.seq
 249997904     gbgss172.seq
 249996938     gbgss173.seq
  76835987     gbgss174.seq
 249998100     gbgss175.seq
   2079852     gbgss176.seq
  79542394     gbgss177.seq
 249999009     gbgss178.seq
 250000259     gbgss179.seq
 524291200     gbgss18.seq
  87380505     gbgss180.seq
 249999685     gbgss181.seq
 249998355     gbgss182.seq
 249998984     gbgss183.seq
 202719103     gbgss184.seq
 249999232     gbgss185.seq
 249999013     gbgss186.seq
 249998851     gbgss187.seq
 246250899     gbgss188.seq
 249999268     gbgss189.seq
 314849258     gbgss19.seq
 249997406     gbgss190.seq
 249999279     gbgss191.seq
 243520281     gbgss192.seq
 249999336     gbgss193.seq
 249997150     gbgss194.seq
 249998209     gbgss195.seq
 249998771     gbgss196.seq
 122182588     gbgss197.seq
 249998013     gbgss198.seq
 250000031     gbgss199.seq
 524289034     gbgss2.seq
 524288952     gbgss20.seq
 249999974     gbgss200.seq
 249998152     gbgss201.seq
  94058788     gbgss202.seq
 249998892     gbgss203.seq
 249999850     gbgss204.seq
 249998239     gbgss205.seq
 249999582     gbgss206.seq
 180350984     gbgss207.seq
 249999236     gbgss208.seq
 249997993     gbgss209.seq
 524289034     gbgss21.seq
 249998006     gbgss210.seq
 249999353     gbgss211.seq
  95926739     gbgss212.seq
 249999461     gbgss213.seq
 249999350     gbgss214.seq
 249998406     gbgss215.seq
 249998619     gbgss216.seq
 249999398     gbgss217.seq
 249999343     gbgss218.seq
  37281900     gbgss219.seq
 524291398     gbgss22.seq
 249999424     gbgss220.seq
 249999963     gbgss221.seq
 249997369     gbgss222.seq
  43648880     gbgss223.seq
  52862187     gbgss224.seq
 249999126     gbgss225.seq
 249999236     gbgss226.seq
 249997873     gbgss227.seq
 249998364     gbgss228.seq
  30976250     gbgss229.seq
 524291152     gbgss23.seq
 249997670     gbgss230.seq
 249997588     gbgss231.seq
 249999018     gbgss232.seq
 250000000     gbgss233.seq
  28042636     gbgss234.seq
 249997661     gbgss235.seq
 249998578     gbgss236.seq
 249999135     gbgss237.seq
 249997568     gbgss238.seq
 249999380     gbgss239.seq
 524291392     gbgss24.seq
 250000153     gbgss240.seq
 178837789     gbgss241.seq
 249999812     gbgss242.seq
 249998926     gbgss243.seq
 249999095     gbgss244.seq
 220154622     gbgss245.seq
 250000034     gbgss246.seq
 249997956     gbgss247.seq
 250000074     gbgss248.seq
 249998729     gbgss249.seq
 524290581     gbgss25.seq
 195288113     gbgss250.seq
 249999561     gbgss251.seq
 249998751     gbgss252.seq
 249999600     gbgss253.seq
 249999029     gbgss254.seq
 249999913     gbgss255.seq
  31601752     gbgss256.seq
 524290713     gbgss26.seq
 524289900     gbgss27.seq
 524288854     gbgss28.seq
 524289528     gbgss29.seq
 524289102     gbgss3.seq
 524290730     gbgss30.seq
  38753639     gbgss31.seq
 524289097     gbgss32.seq
 524290723     gbgss33.seq
 524288828     gbgss34.seq
 524289728     gbgss35.seq
 524289696     gbgss36.seq
 524289533     gbgss37.seq
 524290149     gbgss38.seq
 509095937     gbgss39.seq
 524290615     gbgss4.seq
 524288831     gbgss40.seq
 524291401     gbgss41.seq
 524289030     gbgss42.seq
  26828782     gbgss43.seq
 524288946     gbgss44.seq
 524290506     gbgss45.seq
 524290220     gbgss46.seq
 524289800     gbgss47.seq
 209756868     gbgss48.seq
 524291863     gbgss49.seq
 168350020     gbgss5.seq
 524291582     gbgss50.seq
 524290401     gbgss51.seq
 524290464     gbgss52.seq
 524289775     gbgss53.seq
 524289825     gbgss54.seq
 524290727     gbgss55.seq
 524288905     gbgss56.seq
 524290387     gbgss57.seq
 524290533     gbgss58.seq
 524290102     gbgss59.seq
 524290951     gbgss6.seq
   5949935     gbgss60.seq
 524289023     gbgss61.seq
 524290882     gbgss62.seq
 524290246     gbgss63.seq
 457238462     gbgss64.seq
 524291294     gbgss65.seq
 524291022     gbgss66.seq
 524290625     gbgss67.seq
 524289509     gbgss68.seq
 524291296     gbgss69.seq
 524289102     gbgss7.seq
 524290162     gbgss70.seq
 524290176     gbgss71.seq
 524290850     gbgss72.seq
 524289394     gbgss73.seq
 524291500     gbgss74.seq
 524290572     gbgss75.seq
 524290538     gbgss76.seq
  32490242     gbgss77.seq
 524289537     gbgss78.seq
 524291931     gbgss79.seq
 524291704     gbgss8.seq
 524289482     gbgss80.seq
 524290727     gbgss81.seq
 524289703     gbgss82.seq
 524289751     gbgss83.seq
 524289336     gbgss84.seq
 524290248     gbgss85.seq
 524289011     gbgss86.seq
 524292247     gbgss87.seq
 524290044     gbgss88.seq
 376569727     gbgss89.seq
 524290120     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249991127     gbhtc1.seq
 249998926     gbhtc10.seq
 249999236     gbhtc11.seq
  29682109     gbhtc12.seq
 249997534     gbhtc13.seq
 249993980     gbhtc14.seq
  65451009     gbhtc15.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  83873876     gbhtc8.seq
 249996616     gbhtc9.seq
 249904748     gbhtg1.seq
 249868447     gbhtg10.seq
 249917503     gbhtg100.seq
 249844944     gbhtg101.seq
 249902534     gbhtg102.seq
 249987029     gbhtg103.seq
   5671243     gbhtg104.seq
 249895732     gbhtg105.seq
 249878049     gbhtg106.seq
 249902764     gbhtg107.seq
 249967594     gbhtg108.seq
 250000226     gbhtg109.seq
   1107147     gbhtg11.seq
 249971813     gbhtg110.seq
 249766220     gbhtg111.seq
 249788603     gbhtg112.seq
 249946647     gbhtg113.seq
 163821012     gbhtg114.seq
 249665693     gbhtg115.seq
 249919591     gbhtg116.seq
 249991374     gbhtg117.seq
 249871063     gbhtg118.seq
 249882155     gbhtg119.seq
 249888383     gbhtg12.seq
  32773126     gbhtg120.seq
 249935891     gbhtg121.seq
 249834856     gbhtg122.seq
 249978158     gbhtg123.seq
 249875691     gbhtg124.seq
 249782400     gbhtg125.seq
 134760056     gbhtg126.seq
 249831507     gbhtg127.seq
 249847301     gbhtg128.seq
 249810840     gbhtg129.seq
 249970424     gbhtg13.seq
 249939487     gbhtg130.seq
 249795004     gbhtg131.seq
 249944091     gbhtg132.seq
 249805283     gbhtg133.seq
 249923506     gbhtg134.seq
 249884211     gbhtg135.seq
  83860778     gbhtg136.seq
 249587437     gbhtg14.seq
 249775919     gbhtg15.seq
 249742391     gbhtg16.seq
 249169910     gbhtg17.seq
 249983662     gbhtg18.seq
 249677291     gbhtg19.seq
 249994630     gbhtg2.seq
 249988730     gbhtg20.seq
 237145184     gbhtg21.seq
 249760624     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761207     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249841969     gbhtg29.seq
 249950135     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249920767     gbhtg33.seq
 249929437     gbhtg34.seq
 249919058     gbhtg35.seq
 249858205     gbhtg36.seq
 249814604     gbhtg37.seq
 249767419     gbhtg38.seq
 249627604     gbhtg39.seq
 249984089     gbhtg4.seq
 249839726     gbhtg40.seq
 224363115     gbhtg41.seq
 249889211     gbhtg42.seq
 249786793     gbhtg43.seq
 249972417     gbhtg44.seq
 249775813     gbhtg45.seq
 249912462     gbhtg46.seq
 249597716     gbhtg47.seq
 249864529     gbhtg48.seq
 249792865     gbhtg49.seq
 249882044     gbhtg5.seq
 249923827     gbhtg50.seq
 235040386     gbhtg51.seq
 249732627     gbhtg52.seq
 249917686     gbhtg53.seq
 249773162     gbhtg54.seq
 249971346     gbhtg55.seq
 249962497     gbhtg56.seq
  18795863     gbhtg57.seq
 249861195     gbhtg58.seq
 249823462     gbhtg59.seq
 249898460     gbhtg6.seq
 249990521     gbhtg60.seq
 249920304     gbhtg61.seq
 225327613     gbhtg62.seq
 249853600     gbhtg63.seq
 249787648     gbhtg64.seq
 249883720     gbhtg65.seq
 249980269     gbhtg66.seq
 249833261     gbhtg67.seq
  16614633     gbhtg68.seq
 249960711     gbhtg69.seq
 249933725     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249976832     gbhtg72.seq
 225068155     gbhtg73.seq
 249811067     gbhtg74.seq
 249874983     gbhtg75.seq
 249800230     gbhtg76.seq
 249959810     gbhtg77.seq
 244236211     gbhtg78.seq
 249883527     gbhtg79.seq
 249933567     gbhtg8.seq
 249989775     gbhtg80.seq
 249839558     gbhtg81.seq
 249838461     gbhtg82.seq
 216751380     gbhtg83.seq
 249966974     gbhtg84.seq
 249803194     gbhtg85.seq
 249757813     gbhtg86.seq
 249849111     gbhtg87.seq
 220831145     gbhtg88.seq
 249970053     gbhtg89.seq
 249923766     gbhtg9.seq
 249954204     gbhtg90.seq
 249999447     gbhtg91.seq
 249963669     gbhtg92.seq
 208918917     gbhtg93.seq
 249870295     gbhtg94.seq
 249947521     gbhtg95.seq
 249904005     gbhtg96.seq
 249769960     gbhtg97.seq
 167889754     gbhtg98.seq
 249744688     gbhtg99.seq
 249998196     gbinv1.seq
 249971413     gbinv10.seq
 249999663     gbinv11.seq
 178020684     gbinv12.seq
 249996424     gbinv13.seq
 249999446     gbinv14.seq
 249794292     gbinv15.seq
 156055946     gbinv16.seq
 249999193     gbinv17.seq
 248106359     gbinv18.seq
 250000004     gbinv19.seq
 249881826     gbinv2.seq
 249997669     gbinv20.seq
 242506515     gbinv21.seq
 221960400     gbinv22.seq
 175506919     gbinv23.seq
 249999938     gbinv24.seq
 249998505     gbinv25.seq
  86697952     gbinv26.seq
 249997122     gbinv27.seq
 250000035     gbinv28.seq
 249999724     gbinv29.seq
 216030968     gbinv3.seq
 249967282     gbinv30.seq
  44843228     gbinv31.seq
 249998743     gbinv4.seq
 249998816     gbinv5.seq
 247823946     gbinv6.seq
 249998641     gbinv7.seq
  24808013     gbinv8.seq
 249996598     gbinv9.seq
 139558808     gbjou1.idx
 300645084     gbjou10.idx
 264796486     gbjou11.idx
 266713528     gbjou12.idx
  62151405     gbjou13.idx
 142225583     gbjou2.idx
 190783414     gbjou3.idx
 175873186     gbjou4.idx
 268676133     gbjou5.idx
 279400150     gbjou6.idx
 282355688     gbjou7.idx
 276975775     gbjou8.idx
 304416879     gbjou9.idx
 343324353     gbkey1.idx
 180082557     gbkey2.idx
 181042928     gbkey3.idx
 209164388     gbkey4.idx
 327484336     gbkey5.idx
 137245763     gbkey6.idx
 249786132     gbmam1.seq
 249998468     gbmam2.seq
 249997934     gbmam3.seq
 249999579     gbmam4.seq
 249998094     gbmam5.seq
 249999879     gbmam6.seq
 249999172     gbmam7.seq
  24501114     gbmam8.seq
  36627826     gbnew.txt
 250000194     gbpat1.seq
 249999920     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192934528     gbpat107.seq
 249999767     gbpat108.seq
 249999625     gbpat109.seq
 179561584     gbpat11.seq
 249997130     gbpat110.seq
  80125899     gbpat111.seq
 249999944     gbpat112.seq
 249999404     gbpat113.seq
 249986882     gbpat114.seq
 250000102     gbpat115.seq
 249868822     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 249999061     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 249999948     gbpat13.seq
 249997452     gbpat130.seq
  66832984     gbpat131.seq
 249992315     gbpat132.seq
 249999867     gbpat133.seq
 250000197     gbpat134.seq
 249999821     gbpat135.seq
 249998337     gbpat136.seq
  18437114     gbpat137.seq
 249999655     gbpat138.seq
 249998828     gbpat139.seq
 250000225     gbpat14.seq
 249999803     gbpat140.seq
 250000264     gbpat141.seq
 159550039     gbpat142.seq
 249998039     gbpat143.seq
 250000068     gbpat144.seq
 250000023     gbpat145.seq
  86028783     gbpat146.seq
 249999922     gbpat147.seq
 249998037     gbpat148.seq
 249999931     gbpat149.seq
 249998083     gbpat15.seq
  63543776     gbpat150.seq
 249999473     gbpat151.seq
 249998942     gbpat152.seq
 249999889     gbpat153.seq
 249998615     gbpat154.seq
 249999177     gbpat155.seq
 250000056     gbpat156.seq
 222233558     gbpat157.seq
 250000249     gbpat158.seq
 249999893     gbpat159.seq
 249999193     gbpat16.seq
 249999893     gbpat160.seq
 220539897     gbpat161.seq
 249999753     gbpat162.seq
 249999412     gbpat163.seq
 249999708     gbpat164.seq
  12386037     gbpat165.seq
 249997136     gbpat166.seq
 249998441     gbpat167.seq
 250000105     gbpat168.seq
 249997481     gbpat169.seq
  65904774     gbpat17.seq
  35349941     gbpat170.seq
 249998550     gbpat171.seq
 249999207     gbpat172.seq
 249999813     gbpat173.seq
 249999107     gbpat174.seq
 250000129     gbpat175.seq
  60940687     gbpat176.seq
 249999894     gbpat177.seq
 250000245     gbpat178.seq
 249998983     gbpat179.seq
 250000027     gbpat18.seq
 140563884     gbpat180.seq
 249999801     gbpat19.seq
 249998573     gbpat2.seq
 249999076     gbpat20.seq
 249997674     gbpat21.seq
 185825467     gbpat22.seq
 249999474     gbpat23.seq
 249939239     gbpat24.seq
 250000128     gbpat25.seq
 249999993     gbpat26.seq
  71191909     gbpat27.seq
 249988299     gbpat28.seq
 249999952     gbpat29.seq
 249999135     gbpat3.seq
 249998601     gbpat30.seq
 249999272     gbpat31.seq
 249994457     gbpat32.seq
 180203249     gbpat33.seq
 249999898     gbpat34.seq
 249999720     gbpat35.seq
 249999956     gbpat36.seq
 249999157     gbpat37.seq
 130537101     gbpat38.seq
 249996412     gbpat39.seq
 249997195     gbpat4.seq
 249994275     gbpat40.seq
 249998998     gbpat41.seq
 249999990     gbpat42.seq
 249997347     gbpat43.seq
 249843553     gbpat44.seq
 249999190     gbpat45.seq
 250000004     gbpat46.seq
 171468358     gbpat47.seq
 249999830     gbpat48.seq
 249998527     gbpat49.seq
  71727149     gbpat5.seq
 249999531     gbpat50.seq
 250000197     gbpat51.seq
 222934467     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164990304     gbpat56.seq
 249884985     gbpat57.seq
 249999231     gbpat58.seq
 249998872     gbpat59.seq
 249999527     gbpat6.seq
 249998842     gbpat60.seq
 134937218     gbpat61.seq
 249998879     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999505     gbpat67.seq
 144886744     gbpat68.seq
 250000113     gbpat69.seq
 249999387     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244399444     gbpat72.seq
 248969066     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999901     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249994298     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249998023     gbpat82.seq
 249998684     gbpat83.seq
  93332873     gbpat84.seq
 249155856     gbpat85.seq
 249999530     gbpat86.seq
 249999198     gbpat87.seq
 249999368     gbpat88.seq
 249999290     gbpat89.seq
 249999221     gbpat9.seq
 249999957     gbpat90.seq
 145297619     gbpat91.seq
 249999807     gbpat92.seq
 249998984     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196963512     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 192023833     gbphg1.seq
 249998378     gbpln1.seq
 249998252     gbpln10.seq
 249992188     gbpln11.seq
 249998791     gbpln12.seq
 249839762     gbpln13.seq
 214566828     gbpln14.seq
 249998215     gbpln15.seq
 249985349     gbpln16.seq
 249996352     gbpln17.seq
 249710406     gbpln18.seq
 249991116     gbpln19.seq
 249971155     gbpln2.seq
 249606656     gbpln20.seq
 249999321     gbpln21.seq
  33784496     gbpln22.seq
 249993045     gbpln23.seq
  97681487     gbpln24.seq
 249998414     gbpln25.seq
 249997064     gbpln26.seq
 247837359     gbpln27.seq
 221260108     gbpln28.seq
 181007284     gbpln29.seq
 249943940     gbpln3.seq
 249073855     gbpln30.seq
 249999561     gbpln31.seq
 249999783     gbpln32.seq
 249999448     gbpln33.seq
 249999579     gbpln34.seq
 111258266     gbpln35.seq
 250000051     gbpln36.seq
 249997989     gbpln37.seq
 249999202     gbpln38.seq
 249997953     gbpln39.seq
 249921383     gbpln4.seq
 142776015     gbpln40.seq
 249872320     gbpln41.seq
 249867875     gbpln42.seq
 249999762     gbpln43.seq
 249999374     gbpln44.seq
 249999098     gbpln45.seq
 192364741     gbpln46.seq
 249999101     gbpln47.seq
 249999190     gbpln48.seq
 249999711     gbpln49.seq
 249951839     gbpln5.seq
 249999774     gbpln50.seq
 211294463     gbpln51.seq
 249992097     gbpln52.seq
 249999888     gbpln53.seq
 249998948     gbpln54.seq
 249999242     gbpln55.seq
 249991527     gbpln56.seq
  88517405     gbpln57.seq
 249863036     gbpln6.seq
 249999449     gbpln7.seq
 249998269     gbpln8.seq
  52769111     gbpln9.seq
 148952883     gbpri1.seq
 249995439     gbpri10.seq
 130148157     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902483     gbpri16.seq
 249876241     gbpri17.seq
 249991978     gbpri18.seq
 249903031     gbpri19.seq
 249826385     gbpri2.seq
 249948227     gbpri20.seq
 249999807     gbpri21.seq
 249999534     gbpri22.seq
  39023869     gbpri23.seq
 177481322     gbpri24.seq
 249998934     gbpri25.seq
 211358086     gbpri26.seq
 249987118     gbpri27.seq
 249988725     gbpri28.seq
 249948820     gbpri29.seq
 249848091     gbpri3.seq
 249935405     gbpri30.seq
 249945956     gbpri31.seq
 249978441     gbpri32.seq
 249821502     gbpri33.seq
 249997105     gbpri34.seq
  95885141     gbpri35.seq
 249993971     gbpri36.seq
 249999413     gbpri37.seq
 249925671     gbpri38.seq
 249993015     gbpri39.seq
 249800914     gbpri4.seq
 249998242     gbpri40.seq
 182911266     gbpri41.seq
 249995638     gbpri42.seq
 249993419     gbpri43.seq
 249998475     gbpri44.seq
  28057567     gbpri45.seq
 249741329     gbpri5.seq
 249854494     gbpri6.seq
 249967390     gbpri7.seq
 249797768     gbpri8.seq
 249977029     gbpri9.seq
    330986     gbrel.txt
 249911775     gbrod1.seq
 249959654     gbrod10.seq
  62793496     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249824125     gbrod18.seq
 244529626     gbrod19.seq
 249934846     gbrod2.seq
 249768074     gbrod20.seq
 249924095     gbrod21.seq
 230194968     gbrod22.seq
 249999329     gbrod23.seq
 249998217     gbrod24.seq
 249961043     gbrod25.seq
 249948002     gbrod26.seq
 250000050     gbrod27.seq
 249998171     gbrod28.seq
 215222423     gbrod29.seq
 249793562     gbrod3.seq
 249905352     gbrod4.seq
 249860023     gbrod5.seq
 249987740     gbrod6.seq
 249952469     gbrod7.seq
 249821325     gbrod8.seq
 249934220     gbrod9.seq
4302518243     gbsdr1.txt
5866224920     gbsdr2.txt
2720814184     gbsdr3.txt
 159729197     gbsec.idx
 250000193     gbsts1.seq
 249997720     gbsts10.seq
 210919464     gbsts11.seq
 249996524     gbsts12.seq
 249998383     gbsts13.seq
 249999027     gbsts14.seq
 249999569     gbsts15.seq
  24453604     gbsts16.seq
 249999107     gbsts17.seq
 249999933     gbsts18.seq
 249998484     gbsts19.seq
 249998716     gbsts2.seq
 148720073     gbsts20.seq
 249999648     gbsts3.seq
 249999221     gbsts4.seq
  39162150     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249999074     gbsts9.seq
 249996919     gbsyn1.seq
 249998676     gbsyn2.seq
 249984839     gbsyn3.seq
 249988648     gbsyn4.seq
 249976649     gbsyn5.seq
 249964341     gbsyn6.seq
 138439152     gbsyn7.seq
 249999888     gbtsa1.seq
 249997515     gbtsa10.seq
 249999922     gbtsa11.seq
 249997490     gbtsa12.seq
  39984221     gbtsa13.seq
 249997835     gbtsa14.seq
 249999221     gbtsa15.seq
 249998017     gbtsa16.seq
 249997884     gbtsa17.seq
 167500778     gbtsa18.seq
 249998217     gbtsa19.seq
 249997963     gbtsa2.seq
 250000150     gbtsa20.seq
 249998775     gbtsa21.seq
 249998636     gbtsa22.seq
 249998457     gbtsa23.seq
 249998483     gbtsa24.seq
  30034786     gbtsa25.seq
 249998710     gbtsa26.seq
 249998636     gbtsa27.seq
 249991951     gbtsa28.seq
 249997752     gbtsa29.seq
 249998332     gbtsa3.seq
 249998363     gbtsa30.seq
 249999333     gbtsa31.seq
 247719174     gbtsa32.seq
 249998423     gbtsa33.seq
 249998727     gbtsa34.seq
 250000232     gbtsa35.seq
 249999354     gbtsa36.seq
  56599156     gbtsa37.seq
 249998575     gbtsa38.seq
 249997559     gbtsa39.seq
 250000057     gbtsa4.seq
 249998639     gbtsa40.seq
 249999946     gbtsa41.seq
  68324433     gbtsa42.seq
 249998020     gbtsa43.seq
 249997337     gbtsa44.seq
 249998879     gbtsa45.seq
 249999784     gbtsa46.seq
 249999196     gbtsa47.seq
 249999771     gbtsa48.seq
 249998897     gbtsa49.seq
  83183501     gbtsa5.seq
 156843520     gbtsa50.seq
 249997344     gbtsa51.seq
 249997941     gbtsa52.seq
 249996156     gbtsa53.seq
 249999832     gbtsa54.seq
 249999123     gbtsa55.seq
 249998027     gbtsa56.seq
 182093741     gbtsa57.seq
 249998357     gbtsa58.seq
 249999635     gbtsa59.seq
 249999109     gbtsa6.seq
 249998417     gbtsa60.seq
 249999041     gbtsa61.seq
 249998132     gbtsa62.seq
 249998657     gbtsa63.seq
  28554900     gbtsa64.seq
 249991369     gbtsa65.seq
 249999885     gbtsa66.seq
 249996980     gbtsa67.seq
 249998351     gbtsa68.seq
 249999876     gbtsa69.seq
 249999908     gbtsa7.seq
 149602824     gbtsa70.seq
 249999711     gbtsa71.seq
 249998412     gbtsa72.seq
 249999619     gbtsa73.seq
 250000023     gbtsa74.seq
 249998667     gbtsa75.seq
 249998227     gbtsa76.seq
 249996710     gbtsa77.seq
  53047104     gbtsa78.seq
 249998567     gbtsa79.seq
 249998215     gbtsa8.seq
 249998239     gbtsa80.seq
 249998574     gbtsa81.seq
 249990348     gbtsa82.seq
 249993314     gbtsa83.seq
 249999289     gbtsa84.seq
 249998485     gbtsa85.seq
 162227299     gbtsa86.seq
 249998758     gbtsa9.seq
    486393     gbuna1.seq
 249997987     gbvrl1.seq
 249999349     gbvrl10.seq
 194910543     gbvrl11.seq
 249999997     gbvrl12.seq
 249986348     gbvrl13.seq
 249998134     gbvrl14.seq
 250000000     gbvrl15.seq
 249997685     gbvrl16.seq
 249998140     gbvrl17.seq
 249998491     gbvrl18.seq
 249997828     gbvrl19.seq
 249999495     gbvrl2.seq
 249999989     gbvrl20.seq
   4317778     gbvrl21.seq
 249999737     gbvrl3.seq
 250000011     gbvrl4.seq
 194181785     gbvrl5.seq
 249996753     gbvrl6.seq
 249996561     gbvrl7.seq
 249986929     gbvrl8.seq
 249999699     gbvrl9.seq
 249917291     gbvrt1.seq
 249855514     gbvrt10.seq
 249996015     gbvrt11.seq
 185114157     gbvrt12.seq
 249994619     gbvrt13.seq
 249897444     gbvrt14.seq
 249972959     gbvrt15.seq
 249998113     gbvrt16.seq
 249999249     gbvrt17.seq
 249999767     gbvrt18.seq
  98711589     gbvrt19.seq
 249889656     gbvrt2.seq
 249923064     gbvrt20.seq
 249999995     gbvrt21.seq
 249998130     gbvrt22.seq
 249998559     gbvrt23.seq
 249999049     gbvrt24.seq
 249999595     gbvrt25.seq
 157120154     gbvrt26.seq
 249836913     gbvrt3.seq
 249987335     gbvrt4.seq
 104132849     gbvrt5.seq
 249999974     gbvrt6.seq
 249998316     gbvrt7.seq
 249826314     gbvrt8.seq
 249952345     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64114      86193075
BCT10        66         116730258
BCT11        78         117322765
BCT12        112        109949651
BCT13        1802       116295933
BCT14        14334      18583499
BCT15        53933      85390803
BCT16        93         110189094
BCT17        151        93915681
BCT18        61         112455059
BCT19        52         112042350
BCT2         5844       110241480
BCT20        46         114233015
BCT21        58         114931588
BCT22        67         111284815
BCT23        36         96325907
BCT24        40         106881287
BCT25        58         105533856
BCT26        74         111675186
BCT27        55         110045255
BCT28        63         106845575
BCT29        55         109391288
BCT3         52         112655257
BCT30        53         108650404
BCT31        46         110496749
BCT32        95         109522868
BCT33        59         110966729
BCT34        67         108616570
BCT35        124        106350090
BCT36        37         71643089
BCT37        200        108779787
BCT38        53         109969009
BCT39        40         106880984
BCT4         55         106656794
BCT40        55         103457820
BCT41        56         107056790
BCT42        45         111019867
BCT43        76         108801182
BCT44        58         100715765
BCT45        45         107106306
BCT46        59         109333038
BCT47        79         105369104
BCT48        76         103598262
BCT49        68         110616305
BCT5         38315      81650227
BCT50        66         105738712
BCT51        49         103628191
BCT52        53         107838942
BCT53        54         106293899
BCT54        66         108084602
BCT55        61         103087702
BCT56        51         108151942
BCT57        61         114343592
BCT58        71         111004332
BCT59        48         107623817
BCT6         39042      82648391
BCT60        56         110929046
BCT61        20         19969670
BCT62        40         109856401
BCT63        47         105944778
BCT64        55         110357422
BCT65        91         116463611
BCT66        255        105732175
BCT67        68         95118811
BCT68        322        10801608
BCT69        1589       2511877
BCT7         5518       94828825
BCT70        3179       5215895
BCT71        6347       7901828
BCT72        12648      15076979
BCT73        25628      27748204
BCT74        50523      53996220
BCT75        76345      77606795
BCT76        71405      77195984
BCT77        9653       94123533
BCT78        5443       100112703
BCT79        3197       106879231
BCT8         13774      81523996
BCT80        38         115045720
BCT81        3642       110685095
BCT82        14192      102295841
BCT83        30726      31670589
BCT84        68105      85901130
BCT85        27758      113032352
BCT86        75707      79592332
BCT87        77653      78827862
BCT88        43542      81776990
BCT9         6838       96099033
ENV1         94209      70702270
ENV10        83195      87252660
ENV11        20320      17518085
ENV12        84801      80865034
ENV13        118504     43056908
ENV14        89227      77395082
ENV15        96663      67703136
ENV16        96156      63560162
ENV17        111184     66842182
ENV18        115069     68957043
ENV19        53962      72858713
ENV2         94069      68483796
ENV20        68112      87693801
ENV21        91163      74648125
ENV22        128356     34420441
ENV23        123053     29094893
ENV24        77656      17801062
ENV25        123132     49865050
ENV26        97605      67840019
ENV27        115945     56100511
ENV28        136465     52686037
ENV29        109249     60107096
ENV3         85165      75436187
ENV30        60525      48214777
ENV31        62662      85165812
ENV32        89209      73395874
ENV33        102691     43976284
ENV34        96650      56534302
ENV35        70365      54231480
ENV36        111388     47227933
ENV37        101486     61277514
ENV38        106752     64912875
ENV39        66712      95282652
ENV4         81864      84122833
ENV40        73153      79242576
ENV41        62151      84438940
ENV42        5435       7412790
ENV43        71933      79250177
ENV44        108769     49167325
ENV45        112621     56520145
ENV46        104898     61079365
ENV47        68469      36406718
ENV48        98187      43572528
ENV49        42798      53974179
ENV5         87650      86753058
ENV50        42418      55303755
ENV51        62642      61277980
ENV52        103065     56624961
ENV53        94025      65891777
ENV54        65314      52873760
ENV6         99634      61412984
ENV7         131778     31252636
ENV8         86335      70532265
ENV9         93290      72986600
EST1         158932     61578479
EST10        167385     72122173
EST100       231672     140729199
EST101       237802     124852980
EST102       190153     104236045
EST103       184364     101949285
EST104       103193     71889182
EST105       160250     119698853
EST106       172461     105611774
EST107       134884     84746080
EST108       64402      24023712
EST109       63778      22434516
EST11        169595     74018695
EST110       64289      23267056
EST111       64327      27091249
EST112       64826      23100986
EST113       65039      24799093
EST114       63923      27171966
EST115       64304      26439085
EST116       64500      27438643
EST117       64329      25253991
EST118       61682      34942263
EST119       143437     69148920
EST12        166775     70072602
EST120       161509     85063702
EST121       176540     92939816
EST122       149364     96410313
EST123       156225     91806775
EST124       119906     77962123
EST125       189523     90832703
EST126       156066     83062378
EST127       157480     84565404
EST128       156726     84712436
EST129       151478     84989036
EST13        72695      34848854
EST130       173227     92958979
EST131       183360     116973508
EST132       202376     102377290
EST133       159209     87116376
EST134       163003     82938655
EST135       142196     83557290
EST136       144878     89609395
EST137       100352     53529682
EST138       173647     98087376
EST139       245097     113024634
EST14        217838     109343769
EST140       154548     83565381
EST141       167377     92340739
EST142       150567     87983179
EST143       133775     81923085
EST144       154345     96631498
EST145       155780     85598830
EST146       124531     63457173
EST147       121487     65234224
EST148       128019     58013691
EST149       127405     51301558
EST15        168614     105338224
EST150       128750     51314157
EST151       114666     42736056
EST152       163859     82705515
EST153       176185     73807844
EST154       162278     110244175
EST155       200052     122694559
EST156       214239     121752085
EST157       175489     97173867
EST158       154918     108270122
EST159       141852     95175407
EST16        179370     112570464
EST160       154920     96168731
EST161       157632     82605461
EST162       139434     78479271
EST163       167640     93240843
EST164       71435      44426123
EST165       150023     91732089
EST166       191930     110294142
EST167       145734     83903123
EST168       142819     72406653
EST169       149190     87157119
EST17        195485     113421912
EST170       190838     104730335
EST171       156489     95960355
EST172       168507     82508469
EST173       125375     86492621
EST174       170320     99808753
EST175       173349     100632824
EST176       122206     68017354
EST177       157123     90422184
EST178       36040      20910101
EST179       169722     102544886
EST18        190794     121227407
EST180       180480     119007477
EST181       143363     116883808
EST182       196475     100128945
EST183       153063     103417675
EST184       154770     101388996
EST185       141086     81668866
EST186       176203     71381525
EST187       150729     84605822
EST188       157671     99760566
EST189       156081     96182828
EST19        159133     113948375
EST190       139875     83288450
EST191       162380     98123694
EST192       145501     93165509
EST193       129282     90355751
EST194       144178     88129306
EST195       135902     88513039
EST196       129815     92790323
EST197       162840     86849689
EST198       173964     95596657
EST199       173376     96542520
EST2         161860     61550624
EST20        187213     99420130
EST200       171670     95198341
EST201       168820     95407068
EST202       171408     95551825
EST203       173224     95039735
EST204       173942     95722555
EST205       26071      14145658
EST206       188683     105128382
EST207       204869     104647675
EST208       172472     102202197
EST209       180258     101789390
EST21        217083     106514506
EST210       201364     122897276
EST211       194452     112215324
EST212       193236     123998414
EST213       157826     103853508
EST214       218606     142124470
EST215       236981     114289890
EST216       144090     102761491
EST217       162417     109453594
EST218       147468     94888165
EST219       177970     98756745
EST22        198534     65752423
EST220       189640     118163131
EST221       111502     87690743
EST222       134620     120952490
EST223       160288     93323935
EST224       148164     95283375
EST225       195419     107606906
EST226       165956     104004627
EST227       134256     92504650
EST228       142246     105338552
EST229       121037     87171351
EST23        140862     40065399
EST230       89017      60065173
EST231       144707     89923186
EST232       132134     93896873
EST233       142356     101341738
EST234       120291     86685390
EST235       125401     84269360
EST236       155662     108152561
EST237       159222     115371006
EST238       119672     122010725
EST239       147837     88887768
EST24        103787     28102244
EST240       184282     119267577
EST241       151658     92214097
EST242       170294     107705840
EST243       168047     121457538
EST244       144918     107959708
EST245       12728      9508739
EST246       155314     99988755
EST247       211317     97462628
EST248       187801     111520345
EST249       152131     86844599
EST25        120996     50723240
EST250       220345     27616336
EST251       221254     90066703
EST252       163455     120913817
EST253       174720     102321431
EST254       161936     107622791
EST255       175914     115399930
EST256       156223     114468607
EST257       99561      53974488
EST258       185661     97474439
EST259       177456     104472997
EST26        213501     97054723
EST260       166024     119620495
EST261       213639     103014724
EST262       271912     119057190
EST263       210005     121285910
EST264       182168     40387609
EST265       244614     112858925
EST266       168698     97405400
EST267       168071     105513129
EST268       91751      57335915
EST269       165597     113974547
EST27        218819     110001727
EST270       198817     103241138
EST271       155639     106041898
EST272       195434     114967787
EST273       197349     49934451
EST274       208508     42438416
EST275       181445     103178886
EST276       170072     114930491
EST277       185647     115672988
EST278       181693     109072871
EST279       156874     101653801
EST28        190237     88555560
EST280       107765     37295820
EST281       143441     86877283
EST282       119146     79285022
EST283       155963     106087924
EST284       247054     37101314
EST285       263884     24184983
EST286       168438     90780287
EST287       167471     109887997
EST288       161036     104213327
EST289       147170     91851247
EST29        158143     68957152
EST290       263805     37938913
EST291       175249     96902493
EST292       65786      49567265
EST293       194338     110878705
EST294       143325     78882928
EST295       183213     119106362
EST296       183143     112477875
EST297       153695     111899727
EST298       192149     107445583
EST299       177857     99889722
EST3         153644     54437600
EST30        171754     69719151
EST300       174789     110135664
EST301       188994     63439538
EST302       187078     69018136
EST303       187611     72816531
EST304       125121     45341071
EST305       191234     89843416
EST306       181274     127349813
EST307       158971     92980965
EST308       155331     90434581
EST309       127300     99043905
EST31        148807     63221819
EST310       148700     98828832
EST311       165551     100442817
EST312       164669     92445820
EST313       171497     102947767
EST314       150255     99194578
EST315       150183     101501700
EST316       164808     107893360
EST317       149798     103710289
EST318       180081     152154447
EST319       173049     113522912
EST32        168259     76028450
EST320       141881     76116072
EST321       143244     97615879
EST322       144928     99505570
EST323       132589     89348860
EST324       149632     99766976
EST325       150467     102013561
EST326       177881     111147474
EST327       151506     83739788
EST328       150733     86370440
EST329       151983     107660093
EST33        173679     66404329
EST330       156358     97012678
EST331       75668      45944543
EST332       142969     90533688
EST333       142925     89593086
EST334       209441     112523399
EST335       130101     71843744
EST336       92275      55613264
EST337       131682     87116725
EST338       137932     87526178
EST339       124352     79176420
EST34        123502     43663231
EST340       167207     85573407
EST341       212893     84728803
EST342       167017     88160971
EST343       175024     104695592
EST344       161775     96760321
EST345       83671      55846234
EST346       132870     88571128
EST347       136240     89108559
EST348       189873     121547105
EST349       157125     96320507
EST35        97393      29901036
EST350       162118     81354200
EST351       185548     130535600
EST352       110503     75364645
EST353       73462      43657604
EST354       141770     78734463
EST355       130261     77842955
EST356       149892     54279694
EST357       158516     32679823
EST358       158543     32605027
EST359       183886     112070036
EST36        97798      30578433
EST360       8500       6041888
EST361       229380     116863832
EST362       250947     114659736
EST363       197345     103804155
EST364       146744     94472560
EST365       136179     87025130
EST366       147035     87148639
EST367       184173     114009612
EST368       226121     77370370
EST369       186906     101062433
EST37        96708      29347011
EST370       214642     119446089
EST371       155822     86751447
EST372       141135     66880597
EST373       206911     123161947
EST374       146910     93253171
EST375       183485     135800456
EST376       182030     141629606
EST377       160276     100718410
EST378       163851     102390479
EST379       185405     109289935
EST38        98627      29829233
EST380       185059     107455490
EST381       194895     99930044
EST382       187317     114751014
EST383       142725     86103298
EST384       184880     123581471
EST385       203343     139268066
EST386       225508     131106947
EST387       201174     146848815
EST388       212679     165540464
EST389       188252     105691438
EST39        99409      31246345
EST390       195715     112758679
EST391       170743     30917508
EST392       162772     13359065
EST393       156380     21558560
EST394       158386     32980893
EST395       18740      3500796
EST396       158904     31737671
EST397       152491     69878624
EST398       167721     96756186
EST399       173835     118170573
EST4         170812     67108330
EST40        23364      5953454
EST400       167875     98880040
EST401       154848     107464448
EST402       141525     98186920
EST403       146655     102317880
EST404       155819     96456301
EST405       162113     119653940
EST406       164349     99526813
EST407       170202     58713568
EST408       155434     25947225
EST409       160737     106997829
EST41        101025     52987591
EST410       151968     101622599
EST411       179648     118059462
EST412       140089     75802216
EST413       196139     110574622
EST414       157589     117559538
EST415       134137     91654861
EST416       139580     92155723
EST417       147539     92153974
EST418       176489     96701048
EST419       178650     97554302
EST42        119533     50861384
EST420       145879     90440251
EST421       166107     102395210
EST422       161695     96165303
EST423       110350     76140704
EST424       85714      65440406
EST425       100246     67540584
EST426       137972     80425047
EST427       135046     80015127
EST428       133629     82455414
EST429       136630     89185613
EST43        165833     91749823
EST430       141642     86634644
EST431       175692     94665993
EST432       188469     108748454
EST433       128540     84031031
EST434       187990     107765121
EST435       174626     80178983
EST436       32224      17445013
EST437       157757     90445431
EST438       154604     85271660
EST439       216718     126447328
EST44        170265     72258613
EST440       179417     109867210
EST441       174694     106068070
EST442       140389     102089109
EST443       140710     91510254
EST444       152032     77522515
EST445       195701     87010048
EST446       201299     82951681
EST447       206755     85592816
EST448       158996     71006701
EST449       180264     112731054
EST45        167207     84835444
EST450       185135     91423893
EST451       186900     86409916
EST452       200387     105588449
EST453       197581     118495404
EST454       172104     103634127
EST455       200992     125290848
EST456       150680     95469131
EST457       156612     107620351
EST458       193887     99448759
EST459       146054     81393988
EST46        168558     86873194
EST460       81089      47519014
EST461       169132     87778349
EST462       165307     61809794
EST463       168026     61371207
EST464       77761      29659392
EST47        163262     87825019
EST48        162141     83268160
EST49        160106     91089164
EST5         168996     66194437
EST50        161687     88150757
EST51        157075     98885218
EST52        159523     69798362
EST53        145892     81655293
EST54        77893      50484869
EST55        167014     69863326
EST56        164685     74782249
EST57        164346     90732446
EST58        159178     97166701
EST59        156490     101521697
EST6         171504     66930687
EST60        164652     98962423
EST61        160066     108020892
EST62        171124     81366441
EST63        173194     92475995
EST64        155553     84217629
EST65        148982     81884638
EST66        158925     98551453
EST67        135790     77000242
EST68        149407     91679785
EST69        195065     108209511
EST7         169838     72796689
EST70        180928     95035856
EST71        221024     121170482
EST72        185551     110633950
EST73        203997     121403744
EST74        163466     90073924
EST75        133803     61352208
EST76        139606     68714064
EST77        154928     94123793
EST78        157774     100292851
EST79        141999     78491384
EST8         179388     72856367
EST80        52437      24417770
EST81        164129     100478047
EST82        212013     114844649
EST83        223643     123677791
EST84        200580     94359351
EST85        211218     93334305
EST86        162062     92859374
EST87        144093     86857971
EST88        164220     81109529
EST89        158205     79848153
EST9         168560     69305002
EST90        152983     102103871
EST91        152015     88934493
EST92        134784     86959062
EST93        156082     113065452
EST94        142345     104168873
EST95        143183     102383840
EST96        141176     97543929
EST97        147010     80970712
EST98        178720     111290006
EST99        224300     135818237
GSS1         200062     87617305
GSS10        132040     60283336
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167238     128921102
GSS104       149783     82569304
GSS105       191527     120854119
GSS106       167747     112125081
GSS107       197328     115524481
GSS108       204975     134770173
GSS109       209812     138225285
GSS11        137026     73963213
GSS110       207577     140849031
GSS111       206236     142443188
GSS112       205251     143737895
GSS113       205176     143937947
GSS114       202120     146641028
GSS115       182321     139890075
GSS116       18414      10874742
GSS117       132848     84052151
GSS118       169611     80019194
GSS119       184271     79450634
GSS12        147892     75892246
GSS120       170296     148327490
GSS121       177223     120247442
GSS122       184849     149514379
GSS123       192486     124724450
GSS124       187593     137833036
GSS125       192178     126797998
GSS126       190607     95460230
GSS127       166251     152986683
GSS128       164115     115658040
GSS129       66249      42508121
GSS13        145394     68606713
GSS130       171037     155489454
GSS131       172571     154290391
GSS132       172231     155358474
GSS133       173848     154157454
GSS134       172390     153324435
GSS135       180501     140512813
GSS136       180034     143808295
GSS137       162562     117574424
GSS138       199819     91097855
GSS139       265735     40959994
GSS14        169809     84775223
GSS140       265734     40943584
GSS141       71174      10930356
GSS142       256185     58367796
GSS143       253136     60903252
GSS144       193384     82083564
GSS145       196875     71369208
GSS146       186224     149437899
GSS147       181602     151282470
GSS148       168164     155319870
GSS149       171139     157877394
GSS15        161099     97662972
GSS150       239513     66755578
GSS151       224276     84847535
GSS152       139502     50811447
GSS153       45810      10485531
GSS154       87112      63991594
GSS155       83556      62806181
GSS156       103676     48621434
GSS157       68586      58475658
GSS158       7686       7033775
GSS159       68591      57924394
GSS16        172836     87033449
GSS160       69224      56650935
GSS161       69460      56187403
GSS162       71202      55998401
GSS163       68561      51865315
GSS164       75915      58209304
GSS165       87237      74898207
GSS166       81830      44609896
GSS167       92262      44834024
GSS168       63624      47799159
GSS169       77435      61351403
GSS17        183522     113500748
GSS170       69655      58699293
GSS171       67711      62706526
GSS172       61946      53348157
GSS173       95612      42935517
GSS174       21104      4920928
GSS175       112937     70876701
GSS176       823        560132
GSS177       23226      28867035
GSS178       109043     70652585
GSS179       84533      34668223
GSS18        192358     114306485
GSS180       35815      22222733
GSS181       103304     62490220
GSS182       102329     63761256
GSS183       104268     67656826
GSS184       82099      41276456
GSS185       83102      54651503
GSS186       95673      61335435
GSS187       107323     78547443
GSS188       106375     76684757
GSS189       106058     79947480
GSS19        114078     52104778
GSS190       103996     80016519
GSS191       76374      51039123
GSS192       104572     63292187
GSS193       109868     66415305
GSS194       106205     59313311
GSS195       68379      37446344
GSS196       69573      38736929
GSS197       37145      17774305
GSS198       85481      46023427
GSS199       97119      55907586
GSS2         182294     92190593
GSS20        181789     101771260
GSS200       94982      49597190
GSS201       96286      55922591
GSS202       42132      23615490
GSS203       114638     43642267
GSS204       117085     39368203
GSS205       108676     55514545
GSS206       101471     78372335
GSS207       71604      45899517
GSS208       95891      36542252
GSS209       95417      37268709
GSS21        166208     114173594
GSS210       96671      35161518
GSS211       94285      39167432
GSS212       37736      17626556
GSS213       103939     66277823
GSS214       94551      61190929
GSS215       95128      60357048
GSS216       94773      60868501
GSS217       75675      70017159
GSS218       76712      71926232
GSS219       10069      14841525
GSS22        169506     97609042
GSS220       83736      28233267
GSS221       84219      27346468
GSS222       84926      25909272
GSS223       14851      4422302
GSS224       16547      7508221
GSS225       92377      59458826
GSS226       84657      52502700
GSS227       94076      50770605
GSS228       88581      48350254
GSS229       10980      5983348
GSS23        187251     126687349
GSS230       90648      56882510
GSS231       89662      61882079
GSS232       88553      63641206
GSS233       89283      62505584
GSS234       9890       7129098
GSS235       87995      63795538
GSS236       90217      62488977
GSS237       94643      59915214
GSS238       74331      63055090
GSS239       84246      78879440
GSS24        194057     130219707
GSS240       83027      80589521
GSS241       70483      52650376
GSS242       117650     64297121
GSS243       108874     55446727
GSS244       107533     52125503
GSS245       96658      43251344
GSS246       109801     49060015
GSS247       98194      46325477
GSS248       73059      72225597
GSS249       76682      71142435
GSS25        177481     105207105
GSS250       72980      46435649
GSS251       94787      57200301
GSS252       93517      59081345
GSS253       93900      58510429
GSS254       94714      57307691
GSS255       94197      58070562
GSS256       12741      6343956
GSS26        185918     107808246
GSS27        170600     151419573
GSS28        190494     146229226
GSS29        151147     106441309
GSS3         174946     87827370
GSS30        192451     132131298
GSS31        13629      8773195
GSS32        196044     127318947
GSS33        216659     116231837
GSS34        218573     113602417
GSS35        219720     112025390
GSS36        213958     121897898
GSS37        198560     156434224
GSS38        194984     146797396
GSS39        197244     73372753
GSS4         167155     85101061
GSS40        185054     97670908
GSS41        189776     125953978
GSS42        170974     159160741
GSS43        8445       5513515
GSS44        183999     100320381
GSS45        172882     121572550
GSS46        185086     124654027
GSS47        190845     122391958
GSS48        70876      62667060
GSS49        171799     101963548
GSS5         53445      31617730
GSS50        167647     103037030
GSS51        167798     102616122
GSS52        184194     121477291
GSS53        184741     116610251
GSS54        181685     122486352
GSS55        187532     113988808
GSS56        189404     134542890
GSS57        178931     104920751
GSS58        195718     120562198
GSS59        179928     133341146
GSS6         161617     84471320
GSS60        1929       1744988
GSS61        172844     138948397
GSS62        161635     111553347
GSS63        161673     111572480
GSS64        158827     107592995
GSS65        156768     129062324
GSS66        170185     142553826
GSS67        179844     117096102
GSS68        204911     127968663
GSS69        193332     110756601
GSS7         165322     79361222
GSS70        243921     125965583
GSS71        160206     106329772
GSS72        159349     119781671
GSS73        162663     124539163
GSS74        162629     124600831
GSS75        175106     108958250
GSS76        190310     140120691
GSS77        13118      7645896
GSS78        199135     126616367
GSS79        170370     111603100
GSS8         165782     88979718
GSS80        200718     131518447
GSS81        211575     85835271
GSS82        187842     98659368
GSS83        131802     92017231
GSS84        146986     118083551
GSS85        139587     116995322
GSS86        142817     114062378
GSS87        144008     119847686
GSS88        141842     115691442
GSS89        106718     88926972
GSS9         137999     67157765
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        55760      70772571
HTC11        80466      70929569
HTC12        7043       8192975
HTC13        66993      60073171
HTC14        68555      69498879
HTC15        24287      16415337
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         60867      78012683
HTG1         1318       188771164
HTG10        1298       186340737
HTG100       990        189440077
HTG101       996        189331054
HTG102       985        189419172
HTG103       1161       190585510
HTG104       30         4314892
HTG105       1087       189830459
HTG106       1045       189717260
HTG107       1388       191466792
HTG108       1295       190933340
HTG109       1637       191203456
HTG11        6          837687
HTG110       1342       192059426
HTG111       1298       191975983
HTG112       1320       189984665
HTG113       1061       186071359
HTG114       761        123096347
HTG115       1507       182635389
HTG116       1007       191730955
HTG117       1024       187703174
HTG118       1067       193712434
HTG119       1102       193135451
HTG12        1452       184004673
HTG120       133        25376388
HTG121       1029       189520679
HTG122       1054       192676832
HTG123       1164       192121620
HTG124       1083       192945775
HTG125       1083       192937725
HTG126       590        104030016
HTG127       1122       192568597
HTG128       1080       192404608
HTG129       1078       192326016
HTG13        875        191786413
HTG130       1167       192001881
HTG131       1580       191735452
HTG132       1072       192290481
HTG133       1071       192281753
HTG134       1127       191850871
HTG135       1425       188077382
HTG136       445        59222914
HTG14        753        191921309
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2470       186037380
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185208586
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2550       188439001
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190634433
HTG47        1176       190820695
HTG48        1128       191224702
HTG49        1046       191244150
HTG5         1283       185453274
HTG50        1030       189621534
HTG51        1042       178756613
HTG52        968        190052338
HTG53        1105       190148899
HTG54        1046       190158403
HTG55        1014       189831932
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189903667
HTG6         1273       185124562
HTG60        1078       187304761
HTG61        1125       188306505
HTG62        988        170992054
HTG63        1085       189487801
HTG64        1064       189415560
HTG65        1169       188798107
HTG66        1179       187545797
HTG67        1282       184397923
HTG68        94         12194080
HTG69        1221       185314622
HTG7         1276       185375030
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187688486
HTG73        1019       170126516
HTG74        1118       188293510
HTG75        1103       190775743
HTG76        1135       190789237
HTG77        1182       190871034
HTG78        1096       185997580
HTG79        1171       190202119
HTG8         1459       184608562
HTG80        1115       190063261
HTG81        1213       189874691
HTG82        1120       189645029
HTG83        959        164682536
HTG84        1229       188409093
HTG85        1250       187741728
HTG86        1141       189879061
HTG87        1144       189686641
HTG88        978        167870813
HTG89        1182       189961005
HTG9         1200       186916809
HTG90        1104       190233697
HTG91        1146       190217975
HTG92        1109       190471215
HTG93        962        159420591
HTG94        1056       190754252
HTG95        1160       191014458
HTG96        1031       189156227
HTG97        1071       189497493
HTG98        684        127508859
HTG99        1018       189641315
INV1         93998      48445292
INV10        57199      86634079
INV11        83144      65260906
INV12        59641      47161951
INV13        84926      66266045
INV14        81215      66973881
INV15        78590      67305407
INV16        47188      44332633
INV17        33489      109757153
INV18        3223       146908081
INV19        46561      108090739
INV2         21311      155210684
INV20        77489      55916239
INV21        70668      60809996
INV22        20678      125708200
INV23        6          133712559
INV24        53976      99409443
INV25        78653      53750372
INV26        26569      19758919
INV27        79428      56780387
INV28        78464      61133461
INV29        71486      51098653
INV3         1611       160233861
INV30        63761      74575360
INV31        1758       21466827
INV4         3882       133970248
INV5         78843      73616199
INV6         55577      94593127
INV7         53072      88333125
INV8         7459       7953161
INV9         80575      71772037
MAM1         15929      161549746
MAM2         19803      157738669
MAM3         58989      82666319
MAM4         7988       184338917
MAM5         79484      74649786
MAM6         50895      122370246
MAM7         74249      63555831
MAM8         7258       7392083
PAT1         222552     70120341
PAT10        124454     102575462
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224730     34113420
PAT109       250080     15844360
PAT11        98621      64109728
PAT110       180680     63677151
PAT111       51648      26046194
PAT112       114177     110461898
PAT113       137697     83275032
PAT114       164174     99337407
PAT115       158860     103334939
PAT116       137435     114993907
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142059     62828666
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105891     59875090
PAT130       44618      171217879
PAT131       9167       47581637
PAT132       33645      178334734
PAT133       153558     109675196
PAT134       178705     90913377
PAT135       136049     115324159
PAT136       120392     123342367
PAT137       8527       8992390
PAT138       155429     101473147
PAT139       184764     88815933
PAT14        103642     50160219
PAT140       182409     85292093
PAT141       174396     93932900
PAT142       97226      64800823
PAT143       203662     47737230
PAT144       277828     9627968
PAT145       220409     46465135
PAT146       106719     2881142
PAT147       270386     21672571
PAT148       186749     61237793
PAT149       109798     106057839
PAT15        121149     53316510
PAT150       47521      9551424
PAT151       87298      88246391
PAT152       78460      95573571
PAT153       145159     77711416
PAT154       167498     71377475
PAT155       121473     92940947
PAT156       102998     85359486
PAT157       165586     46048712
PAT158       270022     5130418
PAT159       269978     5129582
PAT16        113134     61272877
PAT160       269978     5129582
PAT161       237888     4519872
PAT162       269396     5118524
PAT163       235480     25575098
PAT164       203730     47154285
PAT165       12037      422709
PAT166       165317     74871979
PAT167       91686      126656173
PAT168       172587     71662828
PAT169       137861     72258430
PAT17        39164      16237825
PAT170       9534       13984766
PAT171       93111      87244841
PAT172       91681      79829797
PAT173       83213      91467896
PAT174       109150     53717368
PAT175       121111     65214605
PAT176       61550      15891474
PAT177       86904      129984422
PAT178       159361     78756697
PAT179       211784     48300758
PAT18        146771     52594264
PAT180       93274      41134377
PAT19        153705     78039102
PAT2         194525     84650653
PAT20        104995     118172564
PAT21        133550     95503155
PAT22        84598      79322013
PAT23        123508     103387313
PAT24        119470     105674473
PAT25        145486     86670068
PAT26        175165     64299073
PAT27        71371      1784275
PAT28        102171     77387698
PAT29        93955      87644560
PAT3         171981     95897120
PAT30        119942     61673191
PAT31        96643      78968028
PAT32        128386     55024402
PAT33        92213      51124955
PAT34        111297     78150994
PAT35        138100     29119820
PAT36        158503     24081830
PAT37        114680     49019471
PAT38        44868      54579998
PAT39        95732      83191686
PAT4         153748     106056406
PAT40        100232     70984798
PAT41        136206     39303264
PAT42        143774     35446826
PAT43        123731     64736974
PAT44        104361     81207665
PAT45        93445      74211542
PAT46        113255     66591457
PAT47        65218      54831902
PAT48        135193     108001084
PAT49        167081     97032398
PAT5         57146      23927792
PAT50        116397     127555645
PAT51        196343     76722711
PAT52        80302      127991032
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92809      89400771
PAT59        106512     74783638
PAT6         170642     91909261
PAT60        122361     64031080
PAT61        67433      30299206
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154777     88234848
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131210     96916575
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94633      88060720
PAT83        93689      93464843
PAT84        34072      33980702
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164895     19209843
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129381     101126002
PAT90        175305     3330795
PAT91        101394     1926486
PAT92        169172     12412265
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140779     2674801
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6539       78965392
PLN1         59906      93473814
PLN10        73064      75866951
PLN11        37368      49288557
PLN12        40288      65715135
PLN13        22486      123971328
PLN14        21103      99490647
PLN15        17578      144865462
PLN16        17634      146278605
PLN17        17564      146392665
PLN18        24636      128667828
PLN19        6000       149205408
PLN2         44614      110229020
PLN20        1266       170315035
PLN21        14024      156030132
PLN22        7239       8483649
PLN23        67251      69749254
PLN24        29377      31585173
PLN25        76943      76363980
PLN26        64877      80581708
PLN27        61609      100265946
PLN28        76         95744252
PLN29        3          61743175
PLN3         1365       175352616
PLN30        842        124721503
PLN31        22712      129429639
PLN32        19595      134200900
PLN33        77954      74719810
PLN34        97677      58565857
PLN35        32919      32369415
PLN36        80378      71656866
PLN37        77879      75901312
PLN38        80006      70498807
PLN39        82141      75442002
PLN4         1809       185391480
PLN40        57790      31632553
PLN41        98608      55062825
PLN42        82013      68932500
PLN43        45899      98599899
PLN44        26328      123492156
PLN45        25106      131583821
PLN46        60144      57753150
PLN47        81462      72224681
PLN48        63271      82408528
PLN49        36868      104584716
PLN5         1875       193948849
PLN50        85589      62349393
PLN51        80251      51093477
PLN52        77023      72630054
PLN53        71102      84462914
PLN54        77574      68708731
PLN55        72757      73907430
PLN56        67734      76920525
PLN57        15813      33605222
PLN6         1694       194455396
PLN7         8875       166727332
PLN8         74779      80929027
PLN9         15960      15706263
PRI1         23017      59647552
PRI10        1272       179395210
PRI11        778        94342363
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193666240
PRI18        1099       194310776
PRI19        1166       193657185
PRI2         18429      149128717
PRI20        1737       191818169
PRI21        2647       189828619
PRI22        14648      168994264
PRI23        6232       19009058
PRI24        31573      84616058
PRI25        61951      78207697
PRI26        31350      70628098
PRI27        8521       161801360
PRI28        2251       180645625
PRI29        1618       181509288
PRI3         1432       175161011
PRI30        2007       181705860
PRI31        1958       180727178
PRI32        13185      156524900
PRI33        1327       183635528
PRI34        41711      106642910
PRI35        22923      33121498
PRI36        32189      63608729
PRI37        20152      117784920
PRI38        18563      147331908
PRI39        66684      86887518
PRI4         1281       185439398
PRI40        49544      89484261
PRI41        40139      74379736
PRI42        45900      95174528
PRI43        18093      108064568
PRI44        66076      89447241
PRI45        1457       18351424
PRI5         1325       184269325
PRI6         1180       179951778
PRI7         1245       180985147
PRI8         1213       178408437
PRI9         1367       174689932
ROD1         33082      139573048
ROD10        989        181517379
ROD11        239        45370799
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1189       190476978
ROD19        16761      153123318
ROD2         916        175520958
ROD20        20349      148361192
ROD21        1132       182075942
ROD22        1079       168189648
ROD23        12240      164895229
ROD24        39629      69426318
ROD25        22368      102346854
ROD26        1532       187749424
ROD27        131881     40081047
ROD28        85541      70219130
ROD29        59246      64317916
ROD3         905        173300070
ROD4         901        173844425
ROD5         921        174289711
ROD6         966        178150478
ROD7         970        179681769
ROD8         978        181216054
ROD9         993        181818518
STS1         85283      36763581
STS10        57907      44420267
STS11        48910      37503235
STS12        57924      43637361
STS13        64283      42850336
STS14        93614      34186498
STS15        104286     26517058
STS16        10109      2739230
STS17        103611     27476228
STS18        86931      34449254
STS19        99732      33367582
STS2         84354      49850025
STS20        54952      21017981
STS3         66846      26362760
STS4         76989      36945836
STS5         8457       4958885
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55716      37767321
SYN1         42753      77269197
SYN2         49419      68040737
SYN3         11320      159501663
SYN4         4599       176558238
SYN5         4596       176482727
SYN6         4600       176575736
SYN7         5894       92767949
TSA1         120472     38235688
TSA10        108480     37654586
TSA11        62538      30840256
TSA12        110433     44590798
TSA13        16282      7598904
TSA14        86486      70566494
TSA15        121991     38853496
TSA16        134870     35826510
TSA17        61036      79698424
TSA18        39468      53516874
TSA19        70282      97466599
TSA2         113532     41666458
TSA20        100897     57123531
TSA21        110668     52338593
TSA22        102984     53513191
TSA23        103695     52518403
TSA24        100966     47107597
TSA25        10786      6455891
TSA26        66573      59369298
TSA27        93236      68475106
TSA28        91230      65647744
TSA29        79450      85594729
TSA3         110396     41019325
TSA30        103819     45646892
TSA31        113332     35261472
TSA32        92833      70603170
TSA33        94924      35718056
TSA34        79432      36554147
TSA35        110249     45080197
TSA36        117427     47973607
TSA37        19696      15336790
TSA38        106388     50375672
TSA39        100992     55141702
TSA4         110949     45737681
TSA40        90151      68489264
TSA41        91678      73454415
TSA42        32519      9955030
TSA43        90902      71737996
TSA44        97655      54672826
TSA45        63226      108204047
TSA46        89912      77989665
TSA47        87860      65994759
TSA48        86501      67911324
TSA49        77475      79690624
TSA5         43179      10927440
TSA50        40794      62941250
TSA51        90931      66884444
TSA52        76043      84732155
TSA53        71912      78529712
TSA54        71826      60276693
TSA55        87192      79998644
TSA56        85990      87897435
TSA57        55156      77681419
TSA58        83252      74039729
TSA59        91594      48744665
TSA6         112457     59449948
TSA60        98540      54918616
TSA61        75972      66426414
TSA62        100913     61115519
TSA63        102120     49730592
TSA64        12226      7204525
TSA65        102468     60112114
TSA66        70154      93782023
TSA67        94802      57414821
TSA68        94388      42929737
TSA69        71068      68454615
TSA7         95626      66268412
TSA70        39758      46444273
TSA71        70263      113160948
TSA72        104922     61927258
TSA73        117909     52395033
TSA74        74137      71255913
TSA75        79272      85095993
TSA76        76684      76392231
TSA77        64912      113292613
TSA78        9950       28790541
TSA79        72977      66848466
TSA8         105747     68768936
TSA80        78193      80753452
TSA81        65583      62631516
TSA82        64325      64887880
TSA83        61967      69088092
TSA84        62041      69631974
TSA85        93767      80253595
TSA86        50396      38123325
TSA9         105920     64853842
UNA1         239        125812
VRL1         67999      69114361
VRL10        64669      70455833
VRL11        42900      57093251
VRL12        62839      71111799
VRL13        57380      72796068
VRL14        63338      65132746
VRL15        56925      73305442
VRL16        58455      71581749
VRL17        57250      71369666
VRL18        55081      74954673
VRL19        55784      72404121
VRL2         73133      64529137
VRL20        66533      71141264
VRL21        1724       902139
VRL3         69947      60699816
VRL4         68468      69815743
VRL5         50773      52765552
VRL6         48185      77563239
VRL7         47035      72937762
VRL8         62874      69624995
VRL9         62618      71608839
VRT1         42589      121961551
VRT10        1256       189217253
VRT11        8275       177873094
VRT12        3991       136366329
VRT13        13101      170790688
VRT14        5342       182610424
VRT15        3936       186026494
VRT16        37599      134590371
VRT17        79807      68466686
VRT18        78242      66409629
VRT19        30962      24980963
VRT2         1113       194371060
VRT20        71402      77207069
VRT21        46889      121317377
VRT22        77614      63223659
VRT23        79180      62434063
VRT24        80446      56990170
VRT25        103420     65415235
VRT26        49877      39495475
VRT3         72625      77788559
VRT4         8374       171158924
VRT5         31412      29447352
VRT6         73019      66731968
VRT7         31770      63580334
VRT8         30608      112208508
VRT9         1202       189989805

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 190.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

19974488 16284884320   Homo sapiens
9697015   9974022626   Mus musculus
2187868   6520656032   Rattus norvegicus
2200463   5384418717   Bos taurus
3934250   5062271053   Zea mays
3285666   4887973037   Sus scrofa
1722799   3121277825   Danio rerio
257580    1435225947   Strongylocentrotus purpuratus
453095    1256162876   Macaca mulatta
1348495   1255479936   Oryza sativa Japonica Group
1774103   1197111264   Nicotiana tabacum
1424488   1147323881   Xenopus (Silurana) tropicalis
2329529   1143776415   Arabidopsis thaliana
1252295   1119390905   Drosophila melanogaster
216607    1008294854   Pan troglodytes
766770     998964692   Vitis vinifera
1455680    951100495   Canis lupus familiaris
1902824    906486948   Glycine max
815266     899539532   Gallus gallus
1426822    898569588   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 190.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         June 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 190.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
	Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Ilya Dondoshansky, WonHee Jang, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Jim Ostell, Denis Sinyakov, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center