Release Notes For GenBank Release 191

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2012

               NCBI-GenBank Flat File Release 191.0

                    Distribution Release Notes

 156424033 loci, 143081765233 bases, from 156424033 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 191.0
1.2 Cutoff Date
1.3 Important Changes in Release 191.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 191.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 191.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 191.0, incorporates data available to the collaborating
databases as of August 13, 2012 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 191.0

1.3.1 Organizational changes

The total number of sequence data files increased by 25 with this release:

  - the BCT division is now composed of  89 files (+1)
  - the CON division is now composed of 172 files (+3)
  - the ENV division is now composed of  55 files (+1)
  - the EST division is now composed of 466 files (+2)
  - the GSS division is now composed of 260 files (+4)
  - the INV division is now composed of  32 files (+1)
  - the PAT division is now composed of 182 files (+2)
  - the TSA division is now composed of  96 files (+10)
  - the VRT division is now composed of  27 files (+1)

The total number of 'index' files increased by 3 with this release:

  - the AUT (author name) index is now composed of 101 files (+2)
  - the KEY (keyword)     index is now composed of   7 files (+1)

1.3.2 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
106 of the GSS flatfiles in Release 191.0. Consider gbgss155.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                          August 15 2012

                NCBI-GenBank Flat File Release 191.0

                           GSS Sequences (Part 1)

   87101 loci,    63965498 bases, from    87101 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "155" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New qualifier : /altitude

  Altitude information is an important component of an accurate environmental
sample description (see related qualifiers /lat_lon and /collection_date).
To capture altitude data, a new source-feature qualifier will be legal as of
October 15 2012 (GenBank 192.0) :

Qualifier       /altitude=
Definition      geographical altitude of the location from which the sample
                was collected
Value format    "text"
Example         /altitude="-256 m."
                /altitude="330.12 m."
Cardinality     1
Comment         Values indicate altitudes above or below nominal sea level 
                provided in metres

1.4.2 Modification of the /anticodon qualifier

  As of the October 15 2012 GenBank Release 192.0, the /anticodon qualifier
of tRNA features will be modified to include the sequence of the anticodon:

Qualifier       /anticodon=
Definition      location of the anticodon of tRNA and the amino acid for which
                it codes
Value format    (pos:<location>,aa:<amino_acid>,seq:<text>) where location
                is the position of the anticodon, amino_acid is the 
                abbreviation for the amino acid encoded and seq is the 
                sequence of the anticodon
Example         /anticodon=(pos:34..36,aa:Phe,seq:aaa)
                /anticodon=(pos:join(5,495..496),aa:Leu,seq:taa)
                /anticodon=(pos:complement(4156..4158),aa:Gln,seq:ttg)

Currently, only the 'pos' and 'aa' elements are supported. The addition
of 'seq' should make it more convenient for database users to process
tRNA features: It will no longer be necessary to analyze the 'pos' element
in order to obtain the anticodon sequence.

1.4.3 Expansion of the /linkage_evidence controlled vocabulary

  Genome centers sometimes have knowledge from PCR evidence that two contigs
are linked, and thus should be part of a CON-division/scaffold record, however
none of the values in the linkage_evidence controlled vocabulary are appropriate.

So, also as of GenBank Release 192.0 in October 2012, the value "pcr" will
be legal for the /linkage_evidence qualifier:

Qualifier       /linkage_evidence=
Value format    "paired-ends", "align genus", "align xgenus", "align trnscpt",
                "within clone", "clone contig", "map", "strobe", "pcr", and
                "unspecified"

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1852 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut100.idx - Index of the entries according to author name, part 100.
7. gbaut101.idx - Index of the entries according to author name, part 101.
8. gbaut11.idx - Index of the entries according to author name, part 11.
9. gbaut12.idx - Index of the entries according to author name, part 12.
10. gbaut13.idx - Index of the entries according to author name, part 13.
11. gbaut14.idx - Index of the entries according to author name, part 14.
12. gbaut15.idx - Index of the entries according to author name, part 15.
13. gbaut16.idx - Index of the entries according to author name, part 16.
14. gbaut17.idx - Index of the entries according to author name, part 17.
15. gbaut18.idx - Index of the entries according to author name, part 18.
16. gbaut19.idx - Index of the entries according to author name, part 19.
17. gbaut2.idx - Index of the entries according to author name, part 2.
18. gbaut20.idx - Index of the entries according to author name, part 20.
19. gbaut21.idx - Index of the entries according to author name, part 21.
20. gbaut22.idx - Index of the entries according to author name, part 22.
21. gbaut23.idx - Index of the entries according to author name, part 23.
22. gbaut24.idx - Index of the entries according to author name, part 24.
23. gbaut25.idx - Index of the entries according to author name, part 25.
24. gbaut26.idx - Index of the entries according to author name, part 26.
25. gbaut27.idx - Index of the entries according to author name, part 27.
26. gbaut28.idx - Index of the entries according to author name, part 28.
27. gbaut29.idx - Index of the entries according to author name, part 29.
28. gbaut3.idx - Index of the entries according to author name, part 3.
29. gbaut30.idx - Index of the entries according to author name, part 30.
30. gbaut31.idx - Index of the entries according to author name, part 31.
31. gbaut32.idx - Index of the entries according to author name, part 32.
32. gbaut33.idx - Index of the entries according to author name, part 33.
33. gbaut34.idx - Index of the entries according to author name, part 34.
34. gbaut35.idx - Index of the entries according to author name, part 35.
35. gbaut36.idx - Index of the entries according to author name, part 36.
36. gbaut37.idx - Index of the entries according to author name, part 37.
37. gbaut38.idx - Index of the entries according to author name, part 38.
38. gbaut39.idx - Index of the entries according to author name, part 39.
39. gbaut4.idx - Index of the entries according to author name, part 4.
40. gbaut40.idx - Index of the entries according to author name, part 40.
41. gbaut41.idx - Index of the entries according to author name, part 41.
42. gbaut42.idx - Index of the entries according to author name, part 42.
43. gbaut43.idx - Index of the entries according to author name, part 43.
44. gbaut44.idx - Index of the entries according to author name, part 44.
45. gbaut45.idx - Index of the entries according to author name, part 45.
46. gbaut46.idx - Index of the entries according to author name, part 46.
47. gbaut47.idx - Index of the entries according to author name, part 47.
48. gbaut48.idx - Index of the entries according to author name, part 48.
49. gbaut49.idx - Index of the entries according to author name, part 49.
50. gbaut5.idx - Index of the entries according to author name, part 5.
51. gbaut50.idx - Index of the entries according to author name, part 50.
52. gbaut51.idx - Index of the entries according to author name, part 51.
53. gbaut52.idx - Index of the entries according to author name, part 52.
54. gbaut53.idx - Index of the entries according to author name, part 53.
55. gbaut54.idx - Index of the entries according to author name, part 54.
56. gbaut55.idx - Index of the entries according to author name, part 55.
57. gbaut56.idx - Index of the entries according to author name, part 56.
58. gbaut57.idx - Index of the entries according to author name, part 57.
59. gbaut58.idx - Index of the entries according to author name, part 58.
60. gbaut59.idx - Index of the entries according to author name, part 59.
61. gbaut6.idx - Index of the entries according to author name, part 6.
62. gbaut60.idx - Index of the entries according to author name, part 60.
63. gbaut61.idx - Index of the entries according to author name, part 61.
64. gbaut62.idx - Index of the entries according to author name, part 62.
65. gbaut63.idx - Index of the entries according to author name, part 63.
66. gbaut64.idx - Index of the entries according to author name, part 64.
67. gbaut65.idx - Index of the entries according to author name, part 65.
68. gbaut66.idx - Index of the entries according to author name, part 66.
69. gbaut67.idx - Index of the entries according to author name, part 67.
70. gbaut68.idx - Index of the entries according to author name, part 68.
71. gbaut69.idx - Index of the entries according to author name, part 69.
72. gbaut7.idx - Index of the entries according to author name, part 7.
73. gbaut70.idx - Index of the entries according to author name, part 70.
74. gbaut71.idx - Index of the entries according to author name, part 71.
75. gbaut72.idx - Index of the entries according to author name, part 72.
76. gbaut73.idx - Index of the entries according to author name, part 73.
77. gbaut74.idx - Index of the entries according to author name, part 74.
78. gbaut75.idx - Index of the entries according to author name, part 75.
79. gbaut76.idx - Index of the entries according to author name, part 76.
80. gbaut77.idx - Index of the entries according to author name, part 77.
81. gbaut78.idx - Index of the entries according to author name, part 78.
82. gbaut79.idx - Index of the entries according to author name, part 79.
83. gbaut8.idx - Index of the entries according to author name, part 8.
84. gbaut80.idx - Index of the entries according to author name, part 80.
85. gbaut81.idx - Index of the entries according to author name, part 81.
86. gbaut82.idx - Index of the entries according to author name, part 82.
87. gbaut83.idx - Index of the entries according to author name, part 83.
88. gbaut84.idx - Index of the entries according to author name, part 84.
89. gbaut85.idx - Index of the entries according to author name, part 85.
90. gbaut86.idx - Index of the entries according to author name, part 86.
91. gbaut87.idx - Index of the entries according to author name, part 87.
92. gbaut88.idx - Index of the entries according to author name, part 88.
93. gbaut89.idx - Index of the entries according to author name, part 89.
94. gbaut9.idx - Index of the entries according to author name, part 9.
95. gbaut90.idx - Index of the entries according to author name, part 90.
96. gbaut91.idx - Index of the entries according to author name, part 91.
97. gbaut92.idx - Index of the entries according to author name, part 92.
98. gbaut93.idx - Index of the entries according to author name, part 93.
99. gbaut94.idx - Index of the entries according to author name, part 94.
100. gbaut95.idx - Index of the entries according to author name, part 95.
101. gbaut96.idx - Index of the entries according to author name, part 96.
102. gbaut97.idx - Index of the entries according to author name, part 97.
103. gbaut98.idx - Index of the entries according to author name, part 98.
104. gbaut99.idx - Index of the entries according to author name, part 99.
105. gbbct1.seq - Bacterial sequence entries, part 1.
106. gbbct10.seq - Bacterial sequence entries, part 10.
107. gbbct11.seq - Bacterial sequence entries, part 11.
108. gbbct12.seq - Bacterial sequence entries, part 12.
109. gbbct13.seq - Bacterial sequence entries, part 13.
110. gbbct14.seq - Bacterial sequence entries, part 14.
111. gbbct15.seq - Bacterial sequence entries, part 15.
112. gbbct16.seq - Bacterial sequence entries, part 16.
113. gbbct17.seq - Bacterial sequence entries, part 17.
114. gbbct18.seq - Bacterial sequence entries, part 18.
115. gbbct19.seq - Bacterial sequence entries, part 19.
116. gbbct2.seq - Bacterial sequence entries, part 2.
117. gbbct20.seq - Bacterial sequence entries, part 20.
118. gbbct21.seq - Bacterial sequence entries, part 21.
119. gbbct22.seq - Bacterial sequence entries, part 22.
120. gbbct23.seq - Bacterial sequence entries, part 23.
121. gbbct24.seq - Bacterial sequence entries, part 24.
122. gbbct25.seq - Bacterial sequence entries, part 25.
123. gbbct26.seq - Bacterial sequence entries, part 26.
124. gbbct27.seq - Bacterial sequence entries, part 27.
125. gbbct28.seq - Bacterial sequence entries, part 28.
126. gbbct29.seq - Bacterial sequence entries, part 29.
127. gbbct3.seq - Bacterial sequence entries, part 3.
128. gbbct30.seq - Bacterial sequence entries, part 30.
129. gbbct31.seq - Bacterial sequence entries, part 31.
130. gbbct32.seq - Bacterial sequence entries, part 32.
131. gbbct33.seq - Bacterial sequence entries, part 33.
132. gbbct34.seq - Bacterial sequence entries, part 34.
133. gbbct35.seq - Bacterial sequence entries, part 35.
134. gbbct36.seq - Bacterial sequence entries, part 36.
135. gbbct37.seq - Bacterial sequence entries, part 37.
136. gbbct38.seq - Bacterial sequence entries, part 38.
137. gbbct39.seq - Bacterial sequence entries, part 39.
138. gbbct4.seq - Bacterial sequence entries, part 4.
139. gbbct40.seq - Bacterial sequence entries, part 40.
140. gbbct41.seq - Bacterial sequence entries, part 41.
141. gbbct42.seq - Bacterial sequence entries, part 42.
142. gbbct43.seq - Bacterial sequence entries, part 43.
143. gbbct44.seq - Bacterial sequence entries, part 44.
144. gbbct45.seq - Bacterial sequence entries, part 45.
145. gbbct46.seq - Bacterial sequence entries, part 46.
146. gbbct47.seq - Bacterial sequence entries, part 47.
147. gbbct48.seq - Bacterial sequence entries, part 48.
148. gbbct49.seq - Bacterial sequence entries, part 49.
149. gbbct5.seq - Bacterial sequence entries, part 5.
150. gbbct50.seq - Bacterial sequence entries, part 50.
151. gbbct51.seq - Bacterial sequence entries, part 51.
152. gbbct52.seq - Bacterial sequence entries, part 52.
153. gbbct53.seq - Bacterial sequence entries, part 53.
154. gbbct54.seq - Bacterial sequence entries, part 54.
155. gbbct55.seq - Bacterial sequence entries, part 55.
156. gbbct56.seq - Bacterial sequence entries, part 56.
157. gbbct57.seq - Bacterial sequence entries, part 57.
158. gbbct58.seq - Bacterial sequence entries, part 58.
159. gbbct59.seq - Bacterial sequence entries, part 59.
160. gbbct6.seq - Bacterial sequence entries, part 6.
161. gbbct60.seq - Bacterial sequence entries, part 60.
162. gbbct61.seq - Bacterial sequence entries, part 61.
163. gbbct62.seq - Bacterial sequence entries, part 62.
164. gbbct63.seq - Bacterial sequence entries, part 63.
165. gbbct64.seq - Bacterial sequence entries, part 64.
166. gbbct65.seq - Bacterial sequence entries, part 65.
167. gbbct66.seq - Bacterial sequence entries, part 66.
168. gbbct67.seq - Bacterial sequence entries, part 67.
169. gbbct68.seq - Bacterial sequence entries, part 68.
170. gbbct69.seq - Bacterial sequence entries, part 69.
171. gbbct7.seq - Bacterial sequence entries, part 7.
172. gbbct70.seq - Bacterial sequence entries, part 70.
173. gbbct71.seq - Bacterial sequence entries, part 71.
174. gbbct72.seq - Bacterial sequence entries, part 72.
175. gbbct73.seq - Bacterial sequence entries, part 73.
176. gbbct74.seq - Bacterial sequence entries, part 74.
177. gbbct75.seq - Bacterial sequence entries, part 75.
178. gbbct76.seq - Bacterial sequence entries, part 76.
179. gbbct77.seq - Bacterial sequence entries, part 77.
180. gbbct78.seq - Bacterial sequence entries, part 78.
181. gbbct79.seq - Bacterial sequence entries, part 79.
182. gbbct8.seq - Bacterial sequence entries, part 8.
183. gbbct80.seq - Bacterial sequence entries, part 80.
184. gbbct81.seq - Bacterial sequence entries, part 81.
185. gbbct82.seq - Bacterial sequence entries, part 82.
186. gbbct83.seq - Bacterial sequence entries, part 83.
187. gbbct84.seq - Bacterial sequence entries, part 84.
188. gbbct85.seq - Bacterial sequence entries, part 85.
189. gbbct86.seq - Bacterial sequence entries, part 86.
190. gbbct87.seq - Bacterial sequence entries, part 87.
191. gbbct88.seq - Bacterial sequence entries, part 88.
192. gbbct89.seq - Bacterial sequence entries, part 89.
193. gbbct9.seq - Bacterial sequence entries, part 9.
194. gbchg.txt - Accession numbers of entries updated since the previous release.
195. gbcon1.seq - Constructed sequence entries, part 1.
196. gbcon10.seq - Constructed sequence entries, part 10.
197. gbcon100.seq - Constructed sequence entries, part 100.
198. gbcon101.seq - Constructed sequence entries, part 101.
199. gbcon102.seq - Constructed sequence entries, part 102.
200. gbcon103.seq - Constructed sequence entries, part 103.
201. gbcon104.seq - Constructed sequence entries, part 104.
202. gbcon105.seq - Constructed sequence entries, part 105.
203. gbcon106.seq - Constructed sequence entries, part 106.
204. gbcon107.seq - Constructed sequence entries, part 107.
205. gbcon108.seq - Constructed sequence entries, part 108.
206. gbcon109.seq - Constructed sequence entries, part 109.
207. gbcon11.seq - Constructed sequence entries, part 11.
208. gbcon110.seq - Constructed sequence entries, part 110.
209. gbcon111.seq - Constructed sequence entries, part 111.
210. gbcon112.seq - Constructed sequence entries, part 112.
211. gbcon113.seq - Constructed sequence entries, part 113.
212. gbcon114.seq - Constructed sequence entries, part 114.
213. gbcon115.seq - Constructed sequence entries, part 115.
214. gbcon116.seq - Constructed sequence entries, part 116.
215. gbcon117.seq - Constructed sequence entries, part 117.
216. gbcon118.seq - Constructed sequence entries, part 118.
217. gbcon119.seq - Constructed sequence entries, part 119.
218. gbcon12.seq - Constructed sequence entries, part 12.
219. gbcon120.seq - Constructed sequence entries, part 120.
220. gbcon121.seq - Constructed sequence entries, part 121.
221. gbcon122.seq - Constructed sequence entries, part 122.
222. gbcon123.seq - Constructed sequence entries, part 123.
223. gbcon124.seq - Constructed sequence entries, part 124.
224. gbcon125.seq - Constructed sequence entries, part 125.
225. gbcon126.seq - Constructed sequence entries, part 126.
226. gbcon127.seq - Constructed sequence entries, part 127.
227. gbcon128.seq - Constructed sequence entries, part 128.
228. gbcon129.seq - Constructed sequence entries, part 129.
229. gbcon13.seq - Constructed sequence entries, part 13.
230. gbcon130.seq - Constructed sequence entries, part 130.
231. gbcon131.seq - Constructed sequence entries, part 131.
232. gbcon132.seq - Constructed sequence entries, part 132.
233. gbcon133.seq - Constructed sequence entries, part 133.
234. gbcon134.seq - Constructed sequence entries, part 134.
235. gbcon135.seq - Constructed sequence entries, part 135.
236. gbcon136.seq - Constructed sequence entries, part 136.
237. gbcon137.seq - Constructed sequence entries, part 137.
238. gbcon138.seq - Constructed sequence entries, part 138.
239. gbcon139.seq - Constructed sequence entries, part 139.
240. gbcon14.seq - Constructed sequence entries, part 14.
241. gbcon140.seq - Constructed sequence entries, part 140.
242. gbcon141.seq - Constructed sequence entries, part 141.
243. gbcon142.seq - Constructed sequence entries, part 142.
244. gbcon143.seq - Constructed sequence entries, part 143.
245. gbcon144.seq - Constructed sequence entries, part 144.
246. gbcon145.seq - Constructed sequence entries, part 145.
247. gbcon146.seq - Constructed sequence entries, part 146.
248. gbcon147.seq - Constructed sequence entries, part 147.
249. gbcon148.seq - Constructed sequence entries, part 148.
250. gbcon149.seq - Constructed sequence entries, part 149.
251. gbcon15.seq - Constructed sequence entries, part 15.
252. gbcon150.seq - Constructed sequence entries, part 150.
253. gbcon151.seq - Constructed sequence entries, part 151.
254. gbcon152.seq - Constructed sequence entries, part 152.
255. gbcon153.seq - Constructed sequence entries, part 153.
256. gbcon154.seq - Constructed sequence entries, part 154.
257. gbcon155.seq - Constructed sequence entries, part 155.
258. gbcon156.seq - Constructed sequence entries, part 156.
259. gbcon157.seq - Constructed sequence entries, part 157.
260. gbcon158.seq - Constructed sequence entries, part 158.
261. gbcon159.seq - Constructed sequence entries, part 159.
262. gbcon16.seq - Constructed sequence entries, part 16.
263. gbcon160.seq - Constructed sequence entries, part 160.
264. gbcon161.seq - Constructed sequence entries, part 161.
265. gbcon162.seq - Constructed sequence entries, part 162.
266. gbcon163.seq - Constructed sequence entries, part 163.
267. gbcon164.seq - Constructed sequence entries, part 164.
268. gbcon165.seq - Constructed sequence entries, part 165.
269. gbcon166.seq - Constructed sequence entries, part 166.
270. gbcon167.seq - Constructed sequence entries, part 167.
271. gbcon168.seq - Constructed sequence entries, part 168.
272. gbcon169.seq - Constructed sequence entries, part 169.
273. gbcon17.seq - Constructed sequence entries, part 17.
274. gbcon170.seq - Constructed sequence entries, part 170.
275. gbcon171.seq - Constructed sequence entries, part 171.
276. gbcon172.seq - Constructed sequence entries, part 172.
277. gbcon18.seq - Constructed sequence entries, part 18.
278. gbcon19.seq - Constructed sequence entries, part 19.
279. gbcon2.seq - Constructed sequence entries, part 2.
280. gbcon20.seq - Constructed sequence entries, part 20.
281. gbcon21.seq - Constructed sequence entries, part 21.
282. gbcon22.seq - Constructed sequence entries, part 22.
283. gbcon23.seq - Constructed sequence entries, part 23.
284. gbcon24.seq - Constructed sequence entries, part 24.
285. gbcon25.seq - Constructed sequence entries, part 25.
286. gbcon26.seq - Constructed sequence entries, part 26.
287. gbcon27.seq - Constructed sequence entries, part 27.
288. gbcon28.seq - Constructed sequence entries, part 28.
289. gbcon29.seq - Constructed sequence entries, part 29.
290. gbcon3.seq - Constructed sequence entries, part 3.
291. gbcon30.seq - Constructed sequence entries, part 30.
292. gbcon31.seq - Constructed sequence entries, part 31.
293. gbcon32.seq - Constructed sequence entries, part 32.
294. gbcon33.seq - Constructed sequence entries, part 33.
295. gbcon34.seq - Constructed sequence entries, part 34.
296. gbcon35.seq - Constructed sequence entries, part 35.
297. gbcon36.seq - Constructed sequence entries, part 36.
298. gbcon37.seq - Constructed sequence entries, part 37.
299. gbcon38.seq - Constructed sequence entries, part 38.
300. gbcon39.seq - Constructed sequence entries, part 39.
301. gbcon4.seq - Constructed sequence entries, part 4.
302. gbcon40.seq - Constructed sequence entries, part 40.
303. gbcon41.seq - Constructed sequence entries, part 41.
304. gbcon42.seq - Constructed sequence entries, part 42.
305. gbcon43.seq - Constructed sequence entries, part 43.
306. gbcon44.seq - Constructed sequence entries, part 44.
307. gbcon45.seq - Constructed sequence entries, part 45.
308. gbcon46.seq - Constructed sequence entries, part 46.
309. gbcon47.seq - Constructed sequence entries, part 47.
310. gbcon48.seq - Constructed sequence entries, part 48.
311. gbcon49.seq - Constructed sequence entries, part 49.
312. gbcon5.seq - Constructed sequence entries, part 5.
313. gbcon50.seq - Constructed sequence entries, part 50.
314. gbcon51.seq - Constructed sequence entries, part 51.
315. gbcon52.seq - Constructed sequence entries, part 52.
316. gbcon53.seq - Constructed sequence entries, part 53.
317. gbcon54.seq - Constructed sequence entries, part 54.
318. gbcon55.seq - Constructed sequence entries, part 55.
319. gbcon56.seq - Constructed sequence entries, part 56.
320. gbcon57.seq - Constructed sequence entries, part 57.
321. gbcon58.seq - Constructed sequence entries, part 58.
322. gbcon59.seq - Constructed sequence entries, part 59.
323. gbcon6.seq - Constructed sequence entries, part 6.
324. gbcon60.seq - Constructed sequence entries, part 60.
325. gbcon61.seq - Constructed sequence entries, part 61.
326. gbcon62.seq - Constructed sequence entries, part 62.
327. gbcon63.seq - Constructed sequence entries, part 63.
328. gbcon64.seq - Constructed sequence entries, part 64.
329. gbcon65.seq - Constructed sequence entries, part 65.
330. gbcon66.seq - Constructed sequence entries, part 66.
331. gbcon67.seq - Constructed sequence entries, part 67.
332. gbcon68.seq - Constructed sequence entries, part 68.
333. gbcon69.seq - Constructed sequence entries, part 69.
334. gbcon7.seq - Constructed sequence entries, part 7.
335. gbcon70.seq - Constructed sequence entries, part 70.
336. gbcon71.seq - Constructed sequence entries, part 71.
337. gbcon72.seq - Constructed sequence entries, part 72.
338. gbcon73.seq - Constructed sequence entries, part 73.
339. gbcon74.seq - Constructed sequence entries, part 74.
340. gbcon75.seq - Constructed sequence entries, part 75.
341. gbcon76.seq - Constructed sequence entries, part 76.
342. gbcon77.seq - Constructed sequence entries, part 77.
343. gbcon78.seq - Constructed sequence entries, part 78.
344. gbcon79.seq - Constructed sequence entries, part 79.
345. gbcon8.seq - Constructed sequence entries, part 8.
346. gbcon80.seq - Constructed sequence entries, part 80.
347. gbcon81.seq - Constructed sequence entries, part 81.
348. gbcon82.seq - Constructed sequence entries, part 82.
349. gbcon83.seq - Constructed sequence entries, part 83.
350. gbcon84.seq - Constructed sequence entries, part 84.
351. gbcon85.seq - Constructed sequence entries, part 85.
352. gbcon86.seq - Constructed sequence entries, part 86.
353. gbcon87.seq - Constructed sequence entries, part 87.
354. gbcon88.seq - Constructed sequence entries, part 88.
355. gbcon89.seq - Constructed sequence entries, part 89.
356. gbcon9.seq - Constructed sequence entries, part 9.
357. gbcon90.seq - Constructed sequence entries, part 90.
358. gbcon91.seq - Constructed sequence entries, part 91.
359. gbcon92.seq - Constructed sequence entries, part 92.
360. gbcon93.seq - Constructed sequence entries, part 93.
361. gbcon94.seq - Constructed sequence entries, part 94.
362. gbcon95.seq - Constructed sequence entries, part 95.
363. gbcon96.seq - Constructed sequence entries, part 96.
364. gbcon97.seq - Constructed sequence entries, part 97.
365. gbcon98.seq - Constructed sequence entries, part 98.
366. gbcon99.seq - Constructed sequence entries, part 99.
367. gbdel.txt - Accession numbers of entries deleted since the previous release.
368. gbenv1.seq - Environmental sampling sequence entries, part 1.
369. gbenv10.seq - Environmental sampling sequence entries, part 10.
370. gbenv11.seq - Environmental sampling sequence entries, part 11.
371. gbenv12.seq - Environmental sampling sequence entries, part 12.
372. gbenv13.seq - Environmental sampling sequence entries, part 13.
373. gbenv14.seq - Environmental sampling sequence entries, part 14.
374. gbenv15.seq - Environmental sampling sequence entries, part 15.
375. gbenv16.seq - Environmental sampling sequence entries, part 16.
376. gbenv17.seq - Environmental sampling sequence entries, part 17.
377. gbenv18.seq - Environmental sampling sequence entries, part 18.
378. gbenv19.seq - Environmental sampling sequence entries, part 19.
379. gbenv2.seq - Environmental sampling sequence entries, part 2.
380. gbenv20.seq - Environmental sampling sequence entries, part 20.
381. gbenv21.seq - Environmental sampling sequence entries, part 21.
382. gbenv22.seq - Environmental sampling sequence entries, part 22.
383. gbenv23.seq - Environmental sampling sequence entries, part 23.
384. gbenv24.seq - Environmental sampling sequence entries, part 24.
385. gbenv25.seq - Environmental sampling sequence entries, part 25.
386. gbenv26.seq - Environmental sampling sequence entries, part 26.
387. gbenv27.seq - Environmental sampling sequence entries, part 27.
388. gbenv28.seq - Environmental sampling sequence entries, part 28.
389. gbenv29.seq - Environmental sampling sequence entries, part 29.
390. gbenv3.seq - Environmental sampling sequence entries, part 3.
391. gbenv30.seq - Environmental sampling sequence entries, part 30.
392. gbenv31.seq - Environmental sampling sequence entries, part 31.
393. gbenv32.seq - Environmental sampling sequence entries, part 32.
394. gbenv33.seq - Environmental sampling sequence entries, part 33.
395. gbenv34.seq - Environmental sampling sequence entries, part 34.
396. gbenv35.seq - Environmental sampling sequence entries, part 35.
397. gbenv36.seq - Environmental sampling sequence entries, part 36.
398. gbenv37.seq - Environmental sampling sequence entries, part 37.
399. gbenv38.seq - Environmental sampling sequence entries, part 38.
400. gbenv39.seq - Environmental sampling sequence entries, part 39.
401. gbenv4.seq - Environmental sampling sequence entries, part 4.
402. gbenv40.seq - Environmental sampling sequence entries, part 40.
403. gbenv41.seq - Environmental sampling sequence entries, part 41.
404. gbenv42.seq - Environmental sampling sequence entries, part 42.
405. gbenv43.seq - Environmental sampling sequence entries, part 43.
406. gbenv44.seq - Environmental sampling sequence entries, part 44.
407. gbenv45.seq - Environmental sampling sequence entries, part 45.
408. gbenv46.seq - Environmental sampling sequence entries, part 46.
409. gbenv47.seq - Environmental sampling sequence entries, part 47.
410. gbenv48.seq - Environmental sampling sequence entries, part 48.
411. gbenv49.seq - Environmental sampling sequence entries, part 49.
412. gbenv5.seq - Environmental sampling sequence entries, part 5.
413. gbenv50.seq - Environmental sampling sequence entries, part 50.
414. gbenv51.seq - Environmental sampling sequence entries, part 51.
415. gbenv52.seq - Environmental sampling sequence entries, part 52.
416. gbenv53.seq - Environmental sampling sequence entries, part 53.
417. gbenv54.seq - Environmental sampling sequence entries, part 54.
418. gbenv55.seq - Environmental sampling sequence entries, part 55.
419. gbenv6.seq - Environmental sampling sequence entries, part 6.
420. gbenv7.seq - Environmental sampling sequence entries, part 7.
421. gbenv8.seq - Environmental sampling sequence entries, part 8.
422. gbenv9.seq - Environmental sampling sequence entries, part 9.
423. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
424. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
425. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
426. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
427. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
428. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
429. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
430. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
431. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
432. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
433. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
434. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
435. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
436. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
437. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
438. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
439. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
440. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
441. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
442. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
443. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
444. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
445. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
446. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
447. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
448. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
449. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
450. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
451. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
452. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
453. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
454. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
455. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
456. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
457. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
458. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
459. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
460. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
461. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
462. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
463. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
464. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
465. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
466. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
467. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
468. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
469. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
470. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
471. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
472. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
473. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
474. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
475. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
476. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
477. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
478. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
479. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
480. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
481. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
482. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
483. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
484. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
485. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
486. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
487. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
488. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
489. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
490. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
491. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
492. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
493. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
494. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
495. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
496. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
497. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
498. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
499. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
500. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
501. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
502. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
503. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
504. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
505. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
506. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
507. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
508. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
509. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
510. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
511. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
512. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
513. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
514. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
515. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
516. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
517. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
518. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
519. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
520. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
521. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
522. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
523. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
524. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
525. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
526. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
527. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
528. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
529. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
530. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
531. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
532. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
533. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
534. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
535. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
536. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
537. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
538. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
539. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
540. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
541. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
542. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
543. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
544. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
545. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
546. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
547. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
548. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
549. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
550. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
551. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
552. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
553. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
554. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
555. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
556. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
557. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
558. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
559. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
560. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
561. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
562. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
563. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
564. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
565. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
566. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
567. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
568. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
569. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
570. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
571. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
572. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
573. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
574. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
575. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
576. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
577. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
578. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
579. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
580. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
581. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
582. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
583. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
584. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
585. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
586. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
587. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
588. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
589. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
590. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
591. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
592. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
593. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
594. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
595. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
596. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
597. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
598. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
599. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
600. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
601. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
602. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
603. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
604. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
605. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
606. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
607. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
608. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
609. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
610. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
611. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
612. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
613. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
614. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
615. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
616. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
617. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
618. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
619. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
620. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
621. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
622. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
623. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
624. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
625. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
626. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
627. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
628. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
629. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
630. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
631. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
632. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
633. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
634. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
635. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
636. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
637. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
638. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
639. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
640. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
641. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
642. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
643. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
644. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
645. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
646. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
647. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
648. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
649. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
650. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
651. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
652. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
653. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
654. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
655. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
656. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
657. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
658. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
659. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
660. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
661. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
662. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
663. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
664. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
665. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
666. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
667. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
668. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
669. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
670. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
671. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
672. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
673. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
674. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
675. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
676. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
677. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
678. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
679. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
680. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
681. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
682. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
683. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
684. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
685. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
686. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
687. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
688. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
689. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
690. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
691. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
692. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
693. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
694. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
695. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
696. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
697. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
698. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
699. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
700. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
701. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
702. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
703. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
704. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
705. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
706. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
707. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
708. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
709. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
710. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
711. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
712. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
713. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
714. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
715. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
716. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
717. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
718. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
719. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
720. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
721. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
722. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
723. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
724. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
725. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
726. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
727. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
728. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
729. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
730. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
731. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
732. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
733. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
734. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
735. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
736. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
737. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
738. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
739. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
740. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
741. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
742. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
743. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
744. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
745. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
746. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
747. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
748. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
749. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
750. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
751. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
752. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
753. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
754. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
755. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
756. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
757. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
758. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
759. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
760. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
761. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
762. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
763. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
764. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
765. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
766. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
767. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
768. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
769. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
770. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
771. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
772. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
773. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
774. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
775. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
776. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
777. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
778. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
779. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
780. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
781. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
782. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
783. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
784. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
785. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
786. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
787. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
788. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
789. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
790. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
791. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
792. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
793. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
794. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
795. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
796. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
797. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
798. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
799. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
800. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
801. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
802. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
803. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
804. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
805. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
806. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
807. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
808. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
809. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
810. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
811. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
812. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
813. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
814. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
815. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
816. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
817. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
818. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
819. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
820. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
821. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
822. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
823. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
824. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
825. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
826. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
827. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
828. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
829. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
830. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
831. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
832. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
833. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
834. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
835. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
836. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
837. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
838. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
839. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
840. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
841. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
842. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
843. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
844. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
845. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
846. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
847. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
848. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
849. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
850. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
851. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
852. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
853. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
854. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
855. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
856. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
857. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
858. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
859. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
860. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
861. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
862. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
863. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
864. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
865. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
866. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
867. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
868. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
869. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
870. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
871. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
872. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
873. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
874. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
875. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
876. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
877. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
878. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
879. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
880. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
881. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
882. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
883. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
884. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
885. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
886. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
887. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
888. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
889. gbgen.idx - Index of the entries according to gene symbols.
890. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
891. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
892. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
893. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
894. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
895. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
896. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
897. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
898. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
899. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
900. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
901. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
902. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
903. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
904. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
905. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
906. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
907. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
908. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
909. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
910. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
911. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
912. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
913. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
914. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
915. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
916. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
917. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
918. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
919. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
920. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
921. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
922. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
923. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
924. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
925. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
926. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
927. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
928. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
929. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
930. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
931. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
932. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
933. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
934. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
935. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
936. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
937. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
938. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
939. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
940. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
941. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
942. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
943. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
944. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
945. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
946. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
947. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
948. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
949. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
950. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
951. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
952. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
953. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
954. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
955. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
956. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
957. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
958. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
959. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
960. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
961. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
962. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
963. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
964. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
965. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
966. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
967. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
968. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
969. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
970. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
971. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
972. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
973. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
974. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
975. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
976. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
977. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
978. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
979. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
980. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
981. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
982. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
983. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
984. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
985. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
986. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
987. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
988. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
989. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
990. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
991. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
992. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
993. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
994. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
995. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
996. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
997. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
998. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
999. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1000. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1001. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1002. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1003. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1004. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1005. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1006. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1007. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1008. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1009. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1010. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1011. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1012. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1013. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1014. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1015. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1016. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1017. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1018. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1019. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1020. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1021. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1022. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1023. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1024. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1025. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1026. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1027. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1028. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1029. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1030. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1031. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1032. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1033. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1034. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1035. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1036. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1037. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1038. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1039. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1040. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1041. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1042. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1043. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1044. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1045. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1046. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1047. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1048. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1049. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1050. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1051. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1052. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1053. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1054. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1055. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1056. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1057. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1058. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1059. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1060. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1061. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1062. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1063. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1064. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1065. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1066. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1067. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1068. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1069. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1070. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1071. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1072. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1073. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1074. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1075. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1076. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1077. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1078. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1079. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1080. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1081. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1082. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1083. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1084. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1085. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1086. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1087. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1088. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1089. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1090. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1091. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1092. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1093. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1094. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1095. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1096. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1097. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1098. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1099. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1100. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1101. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1102. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1103. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1104. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1105. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1106. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1107. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1108. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1109. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1110. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1111. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1112. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1113. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1114. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1115. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1116. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1117. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1118. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1119. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1120. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1121. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1122. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1123. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1124. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1125. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1126. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1127. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1128. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1129. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1130. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1131. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1132. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1133. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1134. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1135. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1136. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1137. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1138. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1139. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1140. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1141. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1142. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1143. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1144. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1145. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1146. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1147. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1148. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1149. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1150. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1151. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1152. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1153. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1154. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1155. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1156. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1157. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1158. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1159. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1160. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1161. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1162. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1163. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1164. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1165. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1166. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1167. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1168. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1169. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1170. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1171. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1172. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1173. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1174. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1175. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1176. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1177. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1178. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1179. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1180. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1181. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1182. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1183. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1184. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1185. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1186. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1187. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1188. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1189. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1190. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1191. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1192. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1193. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1194. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1195. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1196. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1197. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1198. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1199. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1200. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1201. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1202. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1203. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1204. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1205. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1206. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1207. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1208. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1209. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1210. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1211. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1212. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1213. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1214. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1215. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1216. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1217. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1218. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1219. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1220. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1221. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1222. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1223. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1224. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1225. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1226. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1227. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1228. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1229. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1230. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1231. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1232. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1233. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1234. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1235. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1236. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1237. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1238. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1239. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1240. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1241. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1242. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1243. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1244. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1245. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1246. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1247. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1248. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1249. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1250. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1251. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1252. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1253. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1254. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1255. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1256. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1257. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1258. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1259. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1260. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1261. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1262. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1263. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1264. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1265. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1266. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1267. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1268. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1269. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1270. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1271. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1272. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1273. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1274. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1275. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1276. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1277. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1278. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1279. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1280. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1281. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1282. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1283. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1284. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1285. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1286. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1287. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1288. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1289. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1290. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1291. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1292. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1293. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1294. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1295. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1296. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1297. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1298. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1299. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1300. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1301. gbinv1.seq - Invertebrate sequence entries, part 1.
1302. gbinv10.seq - Invertebrate sequence entries, part 10.
1303. gbinv11.seq - Invertebrate sequence entries, part 11.
1304. gbinv12.seq - Invertebrate sequence entries, part 12.
1305. gbinv13.seq - Invertebrate sequence entries, part 13.
1306. gbinv14.seq - Invertebrate sequence entries, part 14.
1307. gbinv15.seq - Invertebrate sequence entries, part 15.
1308. gbinv16.seq - Invertebrate sequence entries, part 16.
1309. gbinv17.seq - Invertebrate sequence entries, part 17.
1310. gbinv18.seq - Invertebrate sequence entries, part 18.
1311. gbinv19.seq - Invertebrate sequence entries, part 19.
1312. gbinv2.seq - Invertebrate sequence entries, part 2.
1313. gbinv20.seq - Invertebrate sequence entries, part 20.
1314. gbinv21.seq - Invertebrate sequence entries, part 21.
1315. gbinv22.seq - Invertebrate sequence entries, part 22.
1316. gbinv23.seq - Invertebrate sequence entries, part 23.
1317. gbinv24.seq - Invertebrate sequence entries, part 24.
1318. gbinv25.seq - Invertebrate sequence entries, part 25.
1319. gbinv26.seq - Invertebrate sequence entries, part 26.
1320. gbinv27.seq - Invertebrate sequence entries, part 27.
1321. gbinv28.seq - Invertebrate sequence entries, part 28.
1322. gbinv29.seq - Invertebrate sequence entries, part 29.
1323. gbinv3.seq - Invertebrate sequence entries, part 3.
1324. gbinv30.seq - Invertebrate sequence entries, part 30.
1325. gbinv31.seq - Invertebrate sequence entries, part 31.
1326. gbinv32.seq - Invertebrate sequence entries, part 32.
1327. gbinv4.seq - Invertebrate sequence entries, part 4.
1328. gbinv5.seq - Invertebrate sequence entries, part 5.
1329. gbinv6.seq - Invertebrate sequence entries, part 6.
1330. gbinv7.seq - Invertebrate sequence entries, part 7.
1331. gbinv8.seq - Invertebrate sequence entries, part 8.
1332. gbinv9.seq - Invertebrate sequence entries, part 9.
1333. gbjou1.idx - Index of the entries according to journal citation, part 1.
1334. gbjou10.idx - Index of the entries according to journal citation, part 10.
1335. gbjou11.idx - Index of the entries according to journal citation, part 11.
1336. gbjou12.idx - Index of the entries according to journal citation, part 12.
1337. gbjou13.idx - Index of the entries according to journal citation, part 13.
1338. gbjou2.idx - Index of the entries according to journal citation, part 2.
1339. gbjou3.idx - Index of the entries according to journal citation, part 3.
1340. gbjou4.idx - Index of the entries according to journal citation, part 4.
1341. gbjou5.idx - Index of the entries according to journal citation, part 5.
1342. gbjou6.idx - Index of the entries according to journal citation, part 6.
1343. gbjou7.idx - Index of the entries according to journal citation, part 7.
1344. gbjou8.idx - Index of the entries according to journal citation, part 8.
1345. gbjou9.idx - Index of the entries according to journal citation, part 9.
1346. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1347. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1348. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1349. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1350. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1351. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1352. gbkey7.idx - Index of the entries according to keyword phrase, part 7.
1353. gbmam1.seq - Other mammalian sequence entries, part 1.
1354. gbmam2.seq - Other mammalian sequence entries, part 2.
1355. gbmam3.seq - Other mammalian sequence entries, part 3.
1356. gbmam4.seq - Other mammalian sequence entries, part 4.
1357. gbmam5.seq - Other mammalian sequence entries, part 5.
1358. gbmam6.seq - Other mammalian sequence entries, part 6.
1359. gbmam7.seq - Other mammalian sequence entries, part 7.
1360. gbmam8.seq - Other mammalian sequence entries, part 8.
1361. gbnew.txt - Accession numbers of entries new since the previous release.
1362. gbpat1.seq - Patent sequence entries, part 1.
1363. gbpat10.seq - Patent sequence entries, part 10.
1364. gbpat100.seq - Patent sequence entries, part 100.
1365. gbpat101.seq - Patent sequence entries, part 101.
1366. gbpat102.seq - Patent sequence entries, part 102.
1367. gbpat103.seq - Patent sequence entries, part 103.
1368. gbpat104.seq - Patent sequence entries, part 104.
1369. gbpat105.seq - Patent sequence entries, part 105.
1370. gbpat106.seq - Patent sequence entries, part 106.
1371. gbpat107.seq - Patent sequence entries, part 107.
1372. gbpat108.seq - Patent sequence entries, part 108.
1373. gbpat109.seq - Patent sequence entries, part 109.
1374. gbpat11.seq - Patent sequence entries, part 11.
1375. gbpat110.seq - Patent sequence entries, part 110.
1376. gbpat111.seq - Patent sequence entries, part 111.
1377. gbpat112.seq - Patent sequence entries, part 112.
1378. gbpat113.seq - Patent sequence entries, part 113.
1379. gbpat114.seq - Patent sequence entries, part 114.
1380. gbpat115.seq - Patent sequence entries, part 115.
1381. gbpat116.seq - Patent sequence entries, part 116.
1382. gbpat117.seq - Patent sequence entries, part 117.
1383. gbpat118.seq - Patent sequence entries, part 118.
1384. gbpat119.seq - Patent sequence entries, part 119.
1385. gbpat12.seq - Patent sequence entries, part 12.
1386. gbpat120.seq - Patent sequence entries, part 120.
1387. gbpat121.seq - Patent sequence entries, part 121.
1388. gbpat122.seq - Patent sequence entries, part 122.
1389. gbpat123.seq - Patent sequence entries, part 123.
1390. gbpat124.seq - Patent sequence entries, part 124.
1391. gbpat125.seq - Patent sequence entries, part 125.
1392. gbpat126.seq - Patent sequence entries, part 126.
1393. gbpat127.seq - Patent sequence entries, part 127.
1394. gbpat128.seq - Patent sequence entries, part 128.
1395. gbpat129.seq - Patent sequence entries, part 129.
1396. gbpat13.seq - Patent sequence entries, part 13.
1397. gbpat130.seq - Patent sequence entries, part 130.
1398. gbpat131.seq - Patent sequence entries, part 131.
1399. gbpat132.seq - Patent sequence entries, part 132.
1400. gbpat133.seq - Patent sequence entries, part 133.
1401. gbpat134.seq - Patent sequence entries, part 134.
1402. gbpat135.seq - Patent sequence entries, part 135.
1403. gbpat136.seq - Patent sequence entries, part 136.
1404. gbpat137.seq - Patent sequence entries, part 137.
1405. gbpat138.seq - Patent sequence entries, part 138.
1406. gbpat139.seq - Patent sequence entries, part 139.
1407. gbpat14.seq - Patent sequence entries, part 14.
1408. gbpat140.seq - Patent sequence entries, part 140.
1409. gbpat141.seq - Patent sequence entries, part 141.
1410. gbpat142.seq - Patent sequence entries, part 142.
1411. gbpat143.seq - Patent sequence entries, part 143.
1412. gbpat144.seq - Patent sequence entries, part 144.
1413. gbpat145.seq - Patent sequence entries, part 145.
1414. gbpat146.seq - Patent sequence entries, part 146.
1415. gbpat147.seq - Patent sequence entries, part 147.
1416. gbpat148.seq - Patent sequence entries, part 148.
1417. gbpat149.seq - Patent sequence entries, part 149.
1418. gbpat15.seq - Patent sequence entries, part 15.
1419. gbpat150.seq - Patent sequence entries, part 150.
1420. gbpat151.seq - Patent sequence entries, part 151.
1421. gbpat152.seq - Patent sequence entries, part 152.
1422. gbpat153.seq - Patent sequence entries, part 153.
1423. gbpat154.seq - Patent sequence entries, part 154.
1424. gbpat155.seq - Patent sequence entries, part 155.
1425. gbpat156.seq - Patent sequence entries, part 156.
1426. gbpat157.seq - Patent sequence entries, part 157.
1427. gbpat158.seq - Patent sequence entries, part 158.
1428. gbpat159.seq - Patent sequence entries, part 159.
1429. gbpat16.seq - Patent sequence entries, part 16.
1430. gbpat160.seq - Patent sequence entries, part 160.
1431. gbpat161.seq - Patent sequence entries, part 161.
1432. gbpat162.seq - Patent sequence entries, part 162.
1433. gbpat163.seq - Patent sequence entries, part 163.
1434. gbpat164.seq - Patent sequence entries, part 164.
1435. gbpat165.seq - Patent sequence entries, part 165.
1436. gbpat166.seq - Patent sequence entries, part 166.
1437. gbpat167.seq - Patent sequence entries, part 167.
1438. gbpat168.seq - Patent sequence entries, part 168.
1439. gbpat169.seq - Patent sequence entries, part 169.
1440. gbpat17.seq - Patent sequence entries, part 17.
1441. gbpat170.seq - Patent sequence entries, part 170.
1442. gbpat171.seq - Patent sequence entries, part 171.
1443. gbpat172.seq - Patent sequence entries, part 172.
1444. gbpat173.seq - Patent sequence entries, part 173.
1445. gbpat174.seq - Patent sequence entries, part 174.
1446. gbpat175.seq - Patent sequence entries, part 175.
1447. gbpat176.seq - Patent sequence entries, part 176.
1448. gbpat177.seq - Patent sequence entries, part 177.
1449. gbpat178.seq - Patent sequence entries, part 178.
1450. gbpat179.seq - Patent sequence entries, part 179.
1451. gbpat18.seq - Patent sequence entries, part 18.
1452. gbpat180.seq - Patent sequence entries, part 180.
1453. gbpat181.seq - Patent sequence entries, part 181.
1454. gbpat182.seq - Patent sequence entries, part 182.
1455. gbpat19.seq - Patent sequence entries, part 19.
1456. gbpat2.seq - Patent sequence entries, part 2.
1457. gbpat20.seq - Patent sequence entries, part 20.
1458. gbpat21.seq - Patent sequence entries, part 21.
1459. gbpat22.seq - Patent sequence entries, part 22.
1460. gbpat23.seq - Patent sequence entries, part 23.
1461. gbpat24.seq - Patent sequence entries, part 24.
1462. gbpat25.seq - Patent sequence entries, part 25.
1463. gbpat26.seq - Patent sequence entries, part 26.
1464. gbpat27.seq - Patent sequence entries, part 27.
1465. gbpat28.seq - Patent sequence entries, part 28.
1466. gbpat29.seq - Patent sequence entries, part 29.
1467. gbpat3.seq - Patent sequence entries, part 3.
1468. gbpat30.seq - Patent sequence entries, part 30.
1469. gbpat31.seq - Patent sequence entries, part 31.
1470. gbpat32.seq - Patent sequence entries, part 32.
1471. gbpat33.seq - Patent sequence entries, part 33.
1472. gbpat34.seq - Patent sequence entries, part 34.
1473. gbpat35.seq - Patent sequence entries, part 35.
1474. gbpat36.seq - Patent sequence entries, part 36.
1475. gbpat37.seq - Patent sequence entries, part 37.
1476. gbpat38.seq - Patent sequence entries, part 38.
1477. gbpat39.seq - Patent sequence entries, part 39.
1478. gbpat4.seq - Patent sequence entries, part 4.
1479. gbpat40.seq - Patent sequence entries, part 40.
1480. gbpat41.seq - Patent sequence entries, part 41.
1481. gbpat42.seq - Patent sequence entries, part 42.
1482. gbpat43.seq - Patent sequence entries, part 43.
1483. gbpat44.seq - Patent sequence entries, part 44.
1484. gbpat45.seq - Patent sequence entries, part 45.
1485. gbpat46.seq - Patent sequence entries, part 46.
1486. gbpat47.seq - Patent sequence entries, part 47.
1487. gbpat48.seq - Patent sequence entries, part 48.
1488. gbpat49.seq - Patent sequence entries, part 49.
1489. gbpat5.seq - Patent sequence entries, part 5.
1490. gbpat50.seq - Patent sequence entries, part 50.
1491. gbpat51.seq - Patent sequence entries, part 51.
1492. gbpat52.seq - Patent sequence entries, part 52.
1493. gbpat53.seq - Patent sequence entries, part 53.
1494. gbpat54.seq - Patent sequence entries, part 54.
1495. gbpat55.seq - Patent sequence entries, part 55.
1496. gbpat56.seq - Patent sequence entries, part 56.
1497. gbpat57.seq - Patent sequence entries, part 57.
1498. gbpat58.seq - Patent sequence entries, part 58.
1499. gbpat59.seq - Patent sequence entries, part 59.
1500. gbpat6.seq - Patent sequence entries, part 6.
1501. gbpat60.seq - Patent sequence entries, part 60.
1502. gbpat61.seq - Patent sequence entries, part 61.
1503. gbpat62.seq - Patent sequence entries, part 62.
1504. gbpat63.seq - Patent sequence entries, part 63.
1505. gbpat64.seq - Patent sequence entries, part 64.
1506. gbpat65.seq - Patent sequence entries, part 65.
1507. gbpat66.seq - Patent sequence entries, part 66.
1508. gbpat67.seq - Patent sequence entries, part 67.
1509. gbpat68.seq - Patent sequence entries, part 68.
1510. gbpat69.seq - Patent sequence entries, part 69.
1511. gbpat7.seq - Patent sequence entries, part 7.
1512. gbpat70.seq - Patent sequence entries, part 70.
1513. gbpat71.seq - Patent sequence entries, part 71.
1514. gbpat72.seq - Patent sequence entries, part 72.
1515. gbpat73.seq - Patent sequence entries, part 73.
1516. gbpat74.seq - Patent sequence entries, part 74.
1517. gbpat75.seq - Patent sequence entries, part 75.
1518. gbpat76.seq - Patent sequence entries, part 76.
1519. gbpat77.seq - Patent sequence entries, part 77.
1520. gbpat78.seq - Patent sequence entries, part 78.
1521. gbpat79.seq - Patent sequence entries, part 79.
1522. gbpat8.seq - Patent sequence entries, part 8.
1523. gbpat80.seq - Patent sequence entries, part 80.
1524. gbpat81.seq - Patent sequence entries, part 81.
1525. gbpat82.seq - Patent sequence entries, part 82.
1526. gbpat83.seq - Patent sequence entries, part 83.
1527. gbpat84.seq - Patent sequence entries, part 84.
1528. gbpat85.seq - Patent sequence entries, part 85.
1529. gbpat86.seq - Patent sequence entries, part 86.
1530. gbpat87.seq - Patent sequence entries, part 87.
1531. gbpat88.seq - Patent sequence entries, part 88.
1532. gbpat89.seq - Patent sequence entries, part 89.
1533. gbpat9.seq - Patent sequence entries, part 9.
1534. gbpat90.seq - Patent sequence entries, part 90.
1535. gbpat91.seq - Patent sequence entries, part 91.
1536. gbpat92.seq - Patent sequence entries, part 92.
1537. gbpat93.seq - Patent sequence entries, part 93.
1538. gbpat94.seq - Patent sequence entries, part 94.
1539. gbpat95.seq - Patent sequence entries, part 95.
1540. gbpat96.seq - Patent sequence entries, part 96.
1541. gbpat97.seq - Patent sequence entries, part 97.
1542. gbpat98.seq - Patent sequence entries, part 98.
1543. gbpat99.seq - Patent sequence entries, part 99.
1544. gbphg1.seq - Phage sequence entries, part 1.
1545. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1546. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1547. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1548. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1549. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1550. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1551. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1552. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1553. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1554. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1555. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1556. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1557. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1558. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1559. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1560. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1561. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1562. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1563. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1564. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1565. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1566. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1567. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1568. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1569. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1570. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1571. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1572. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1573. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1574. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1575. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1576. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1577. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1578. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1579. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1580. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1581. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1582. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1583. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1584. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1585. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1586. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1587. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1588. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1589. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1590. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1591. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1592. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1593. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1594. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1595. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1596. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1597. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1598. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1599. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1600. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1601. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1602. gbpri1.seq - Primate sequence entries, part 1.
1603. gbpri10.seq - Primate sequence entries, part 10.
1604. gbpri11.seq - Primate sequence entries, part 11.
1605. gbpri12.seq - Primate sequence entries, part 12.
1606. gbpri13.seq - Primate sequence entries, part 13.
1607. gbpri14.seq - Primate sequence entries, part 14.
1608. gbpri15.seq - Primate sequence entries, part 15.
1609. gbpri16.seq - Primate sequence entries, part 16.
1610. gbpri17.seq - Primate sequence entries, part 17.
1611. gbpri18.seq - Primate sequence entries, part 18.
1612. gbpri19.seq - Primate sequence entries, part 19.
1613. gbpri2.seq - Primate sequence entries, part 2.
1614. gbpri20.seq - Primate sequence entries, part 20.
1615. gbpri21.seq - Primate sequence entries, part 21.
1616. gbpri22.seq - Primate sequence entries, part 22.
1617. gbpri23.seq - Primate sequence entries, part 23.
1618. gbpri24.seq - Primate sequence entries, part 24.
1619. gbpri25.seq - Primate sequence entries, part 25.
1620. gbpri26.seq - Primate sequence entries, part 26.
1621. gbpri27.seq - Primate sequence entries, part 27.
1622. gbpri28.seq - Primate sequence entries, part 28.
1623. gbpri29.seq - Primate sequence entries, part 29.
1624. gbpri3.seq - Primate sequence entries, part 3.
1625. gbpri30.seq - Primate sequence entries, part 30.
1626. gbpri31.seq - Primate sequence entries, part 31.
1627. gbpri32.seq - Primate sequence entries, part 32.
1628. gbpri33.seq - Primate sequence entries, part 33.
1629. gbpri34.seq - Primate sequence entries, part 34.
1630. gbpri35.seq - Primate sequence entries, part 35.
1631. gbpri36.seq - Primate sequence entries, part 36.
1632. gbpri37.seq - Primate sequence entries, part 37.
1633. gbpri38.seq - Primate sequence entries, part 38.
1634. gbpri39.seq - Primate sequence entries, part 39.
1635. gbpri4.seq - Primate sequence entries, part 4.
1636. gbpri40.seq - Primate sequence entries, part 40.
1637. gbpri41.seq - Primate sequence entries, part 41.
1638. gbpri42.seq - Primate sequence entries, part 42.
1639. gbpri43.seq - Primate sequence entries, part 43.
1640. gbpri44.seq - Primate sequence entries, part 44.
1641. gbpri45.seq - Primate sequence entries, part 45.
1642. gbpri5.seq - Primate sequence entries, part 5.
1643. gbpri6.seq - Primate sequence entries, part 6.
1644. gbpri7.seq - Primate sequence entries, part 7.
1645. gbpri8.seq - Primate sequence entries, part 8.
1646. gbpri9.seq - Primate sequence entries, part 9.
1647. gbrel.txt - Release notes (this document).
1648. gbrod1.seq - Rodent sequence entries, part 1.
1649. gbrod10.seq - Rodent sequence entries, part 10.
1650. gbrod11.seq - Rodent sequence entries, part 11.
1651. gbrod12.seq - Rodent sequence entries, part 12.
1652. gbrod13.seq - Rodent sequence entries, part 13.
1653. gbrod14.seq - Rodent sequence entries, part 14.
1654. gbrod15.seq - Rodent sequence entries, part 15.
1655. gbrod16.seq - Rodent sequence entries, part 16.
1656. gbrod17.seq - Rodent sequence entries, part 17.
1657. gbrod18.seq - Rodent sequence entries, part 18.
1658. gbrod19.seq - Rodent sequence entries, part 19.
1659. gbrod2.seq - Rodent sequence entries, part 2.
1660. gbrod20.seq - Rodent sequence entries, part 20.
1661. gbrod21.seq - Rodent sequence entries, part 21.
1662. gbrod22.seq - Rodent sequence entries, part 22.
1663. gbrod23.seq - Rodent sequence entries, part 23.
1664. gbrod24.seq - Rodent sequence entries, part 24.
1665. gbrod25.seq - Rodent sequence entries, part 25.
1666. gbrod26.seq - Rodent sequence entries, part 26.
1667. gbrod27.seq - Rodent sequence entries, part 27.
1668. gbrod28.seq - Rodent sequence entries, part 28.
1669. gbrod29.seq - Rodent sequence entries, part 29.
1670. gbrod3.seq - Rodent sequence entries, part 3.
1671. gbrod4.seq - Rodent sequence entries, part 4.
1672. gbrod5.seq - Rodent sequence entries, part 5.
1673. gbrod6.seq - Rodent sequence entries, part 6.
1674. gbrod7.seq - Rodent sequence entries, part 7.
1675. gbrod8.seq - Rodent sequence entries, part 8.
1676. gbrod9.seq - Rodent sequence entries, part 9.
1677. gbsdr1.txt - Short directory of the data bank, part 1.
1678. gbsdr2.txt - Short directory of the data bank, part 2.
1679. gbsdr3.txt - Short directory of the data bank, part 3.
1680. gbsec.idx - Index of the entries according to secondary accession number.
1681. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1682. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1683. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1684. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1685. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1686. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1687. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1688. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1689. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1690. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1691. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1692. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1693. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1694. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1695. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1696. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1697. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1698. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1699. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1700. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1701. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1702. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1703. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1704. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1705. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1706. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1707. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1708. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1709. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1710. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1711. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1712. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1713. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1714. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1715. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1716. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1717. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1718. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1719. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1720. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1721. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1722. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1723. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1724. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1725. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1726. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1727. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1728. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1729. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1730. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1731. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1732. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1733. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1734. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1735. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1736. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1737. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1738. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1739. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1740. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1741. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1742. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1743. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1744. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1745. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1746. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1747. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1748. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1749. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1750. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1751. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1752. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1753. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1754. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1755. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1756. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1757. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1758. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1759. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1760. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1761. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1762. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1763. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1764. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1765. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1766. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1767. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1768. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1769. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1770. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1771. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1772. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1773. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1774. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1775. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1776. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1777. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1778. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1779. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1780. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1781. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1782. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1783. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1784. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1785. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1786. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1787. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1788. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1789. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1790. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1791. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1792. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1793. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
1794. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
1795. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
1796. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1797. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
1798. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
1799. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
1800. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
1801. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
1802. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
1803. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
1804. gbuna1.seq - Unannotated sequence entries, part 1.
1805. gbvrl1.seq - Viral sequence entries, part 1.
1806. gbvrl10.seq - Viral sequence entries, part 10.
1807. gbvrl11.seq - Viral sequence entries, part 11.
1808. gbvrl12.seq - Viral sequence entries, part 12.
1809. gbvrl13.seq - Viral sequence entries, part 13.
1810. gbvrl14.seq - Viral sequence entries, part 14.
1811. gbvrl15.seq - Viral sequence entries, part 15.
1812. gbvrl16.seq - Viral sequence entries, part 16.
1813. gbvrl17.seq - Viral sequence entries, part 17.
1814. gbvrl18.seq - Viral sequence entries, part 18.
1815. gbvrl19.seq - Viral sequence entries, part 19.
1816. gbvrl2.seq - Viral sequence entries, part 2.
1817. gbvrl20.seq - Viral sequence entries, part 20.
1818. gbvrl21.seq - Viral sequence entries, part 21.
1819. gbvrl3.seq - Viral sequence entries, part 3.
1820. gbvrl4.seq - Viral sequence entries, part 4.
1821. gbvrl5.seq - Viral sequence entries, part 5.
1822. gbvrl6.seq - Viral sequence entries, part 6.
1823. gbvrl7.seq - Viral sequence entries, part 7.
1824. gbvrl8.seq - Viral sequence entries, part 8.
1825. gbvrl9.seq - Viral sequence entries, part 9.
1826. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1827. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1828. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1829. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1830. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1831. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1832. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1833. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1834. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1835. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1836. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1837. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1838. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1839. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1840. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1841. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1842. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1843. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1844. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1845. gbvrt27.seq - Other vertebrate sequence entries, part 27.
1846. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1847. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1848. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1849. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1850. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1851. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1852. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 191.0 flatfiles require roughly 561 GB (sequence
files only) or 604 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

2111226774     gbacc1.idx
2423011140     gbacc2.idx
 855076371     gbacc3.idx
 183869522     gbaut1.idx
 193127298     gbaut10.idx
 210762538     gbaut100.idx
  32040840     gbaut101.idx
 184824550     gbaut11.idx
 184048031     gbaut12.idx
 184283598     gbaut13.idx
 183961085     gbaut14.idx
 183959519     gbaut15.idx
 184086831     gbaut16.idx
 183857514     gbaut17.idx
 210549333     gbaut18.idx
 183981660     gbaut19.idx
 184735234     gbaut2.idx
 185180672     gbaut20.idx
 247480826     gbaut21.idx
 191212894     gbaut22.idx
 190165185     gbaut23.idx
 244507971     gbaut24.idx
 188700764     gbaut25.idx
 186125623     gbaut26.idx
 186023345     gbaut27.idx
 202987519     gbaut28.idx
 186393415     gbaut29.idx
 183897952     gbaut3.idx
 185856975     gbaut30.idx
 208183112     gbaut31.idx
 201855874     gbaut32.idx
 223623874     gbaut33.idx
 228857855     gbaut34.idx
 183902320     gbaut35.idx
 184857907     gbaut36.idx
 241929980     gbaut37.idx
 185965813     gbaut38.idx
 183915343     gbaut39.idx
 240183327     gbaut4.idx
 186700595     gbaut40.idx
 216995885     gbaut41.idx
 184055187     gbaut42.idx
 186462087     gbaut43.idx
 185729516     gbaut44.idx
 184025209     gbaut45.idx
 184373099     gbaut46.idx
 193114976     gbaut47.idx
 183902852     gbaut48.idx
 234610257     gbaut49.idx
 184062952     gbaut5.idx
 184824976     gbaut50.idx
 186565037     gbaut51.idx
 184113103     gbaut52.idx
 183865166     gbaut53.idx
 234585369     gbaut54.idx
 186229574     gbaut55.idx
 183781226     gbaut56.idx
 188219597     gbaut57.idx
 201658423     gbaut58.idx
 183831182     gbaut59.idx
 186279033     gbaut6.idx
 183850849     gbaut60.idx
 188718492     gbaut61.idx
 186683136     gbaut62.idx
 186484862     gbaut63.idx
 184680368     gbaut64.idx
 185906071     gbaut65.idx
 183957069     gbaut66.idx
 189050118     gbaut67.idx
 191599819     gbaut68.idx
 203181038     gbaut69.idx
 188817830     gbaut7.idx
 185081735     gbaut70.idx
 183944085     gbaut71.idx
 184614371     gbaut72.idx
 185724382     gbaut73.idx
 186823328     gbaut74.idx
 183907085     gbaut75.idx
 185154112     gbaut76.idx
 186326659     gbaut77.idx
 184755408     gbaut78.idx
 207177836     gbaut79.idx
 189515725     gbaut8.idx
 237072680     gbaut80.idx
 224678438     gbaut81.idx
 185422346     gbaut82.idx
 184780344     gbaut83.idx
 201454400     gbaut84.idx
 184635449     gbaut85.idx
 183899835     gbaut86.idx
 236123014     gbaut87.idx
 202757635     gbaut88.idx
 251204359     gbaut89.idx
 183875032     gbaut9.idx
 183717165     gbaut90.idx
 184520614     gbaut91.idx
 186051486     gbaut92.idx
 209973151     gbaut93.idx
 185240640     gbaut94.idx
 185441097     gbaut95.idx
 185488772     gbaut96.idx
 184107184     gbaut97.idx
 251499141     gbaut98.idx
 186556213     gbaut99.idx
 249997748     gbbct1.seq
 248276088     gbbct10.seq
 234131801     gbbct11.seq
 247698364     gbbct12.seq
 247157794     gbbct13.seq
  81481852     gbbct14.seq
 243179586     gbbct15.seq
 249797910     gbbct16.seq
 245560130     gbbct17.seq
 248629264     gbbct18.seq
 248242507     gbbct19.seq
 244933494     gbbct2.seq
 249282329     gbbct20.seq
 246199146     gbbct21.seq
 245693884     gbbct22.seq
 217807723     gbbct23.seq
 242804075     gbbct24.seq
 241841463     gbbct25.seq
 248677875     gbbct26.seq
 247875836     gbbct27.seq
 249388745     gbbct28.seq
 244186429     gbbct29.seq
 249650734     gbbct3.seq
 247337416     gbbct30.seq
 249997167     gbbct31.seq
 249762205     gbbct32.seq
 249792757     gbbct33.seq
 242887228     gbbct34.seq
 241639400     gbbct35.seq
 164818353     gbbct36.seq
 243028616     gbbct37.seq
 244322816     gbbct38.seq
 249250113     gbbct39.seq
 246205944     gbbct4.seq
 247838111     gbbct40.seq
 246706562     gbbct41.seq
 248042643     gbbct42.seq
 246778662     gbbct43.seq
 240233511     gbbct44.seq
 243873595     gbbct45.seq
 240747283     gbbct46.seq
 247072445     gbbct47.seq
 231584896     gbbct48.seq
 249922538     gbbct49.seq
 213991730     gbbct5.seq
 247105723     gbbct50.seq
 241663263     gbbct51.seq
 245558316     gbbct52.seq
 244123708     gbbct53.seq
 240009084     gbbct54.seq
 248398058     gbbct55.seq
 249304746     gbbct56.seq
 249376350     gbbct57.seq
 248726305     gbbct58.seq
 241426846     gbbct59.seq
 242141189     gbbct6.seq
 238346377     gbbct60.seq
  67122590     gbbct61.seq
 244924489     gbbct62.seq
 247520655     gbbct63.seq
 244980990     gbbct64.seq
 246778582     gbbct65.seq
 248765600     gbbct66.seq
 249549264     gbbct67.seq
 207398495     gbbct68.seq
   6888429     gbbct69.seq
 244103322     gbbct7.seq
  14097731     gbbct70.seq
  23204828     gbbct71.seq
  45103451     gbbct72.seq
  87794941     gbbct73.seq
 170198679     gbbct74.seq
 249998392     gbbct75.seq
 249997599     gbbct76.seq
 244614721     gbbct77.seq
 239403490     gbbct78.seq
 247760742     gbbct79.seq
 229641979     gbbct8.seq
 248640558     gbbct80.seq
 249988011     gbbct81.seq
 249999053     gbbct82.seq
 121901356     gbbct83.seq
 249372671     gbbct84.seq
 249998990     gbbct85.seq
 249998519     gbbct86.seq
 249999934     gbbct87.seq
 249998543     gbbct88.seq
  45621512     gbbct89.seq
 245148549     gbbct9.seq
  13744264     gbchg.txt
 249997937     gbcon1.seq
 249995122     gbcon10.seq
 135141019     gbcon100.seq
 249999018     gbcon101.seq
 249995506     gbcon102.seq
 249999938     gbcon103.seq
 249996196     gbcon104.seq
 249994668     gbcon105.seq
 158184767     gbcon106.seq
 249997662     gbcon107.seq
 249996981     gbcon108.seq
 249998026     gbcon109.seq
 249991455     gbcon11.seq
 249999534     gbcon110.seq
  73726548     gbcon111.seq
 213431083     gbcon112.seq
 249999151     gbcon113.seq
 249998618     gbcon114.seq
 249995107     gbcon115.seq
 249967397     gbcon116.seq
 112571252     gbcon117.seq
 249993276     gbcon118.seq
 249997920     gbcon119.seq
 249306530     gbcon12.seq
 181287823     gbcon120.seq
 249997376     gbcon121.seq
 249999771     gbcon122.seq
 250000264     gbcon123.seq
 225434488     gbcon124.seq
 249674671     gbcon125.seq
 249966938     gbcon126.seq
 249990910     gbcon127.seq
 249997568     gbcon128.seq
 250000073     gbcon129.seq
 248941383     gbcon13.seq
 249998203     gbcon130.seq
  37398370     gbcon131.seq
 249971298     gbcon132.seq
 249997710     gbcon133.seq
 249994690     gbcon134.seq
 249959868     gbcon135.seq
 249943571     gbcon136.seq
 249999699     gbcon137.seq
 249977443     gbcon138.seq
 234884818     gbcon139.seq
 248692463     gbcon14.seq
 246632932     gbcon140.seq
 247186189     gbcon141.seq
 249991114     gbcon142.seq
 249936667     gbcon143.seq
 109243220     gbcon144.seq
 249997820     gbcon145.seq
 249844248     gbcon146.seq
 249994703     gbcon147.seq
 249999482     gbcon148.seq
 249999953     gbcon149.seq
 249997321     gbcon15.seq
 249998586     gbcon150.seq
 249998707     gbcon151.seq
 249999291     gbcon152.seq
 208228091     gbcon153.seq
 249999735     gbcon154.seq
 249998416     gbcon155.seq
 249994743     gbcon156.seq
 249959779     gbcon157.seq
 249998736     gbcon158.seq
 233046568     gbcon159.seq
  91608699     gbcon16.seq
 249999135     gbcon160.seq
 249964275     gbcon161.seq
 249998425     gbcon162.seq
 249999395     gbcon163.seq
 249997942     gbcon164.seq
 249897000     gbcon165.seq
 246199695     gbcon166.seq
 249875336     gbcon167.seq
 249988239     gbcon168.seq
 249682385     gbcon169.seq
 248418534     gbcon17.seq
 249722211     gbcon170.seq
 246016607     gbcon171.seq
  18870472     gbcon172.seq
 249996775     gbcon18.seq
 249959053     gbcon19.seq
 249297075     gbcon2.seq
  58079501     gbcon20.seq
 249994640     gbcon21.seq
 249193119     gbcon22.seq
 117444305     gbcon23.seq
 249999763     gbcon24.seq
 121171201     gbcon25.seq
 249993709     gbcon26.seq
 249727153     gbcon27.seq
 249999220     gbcon28.seq
 249996705     gbcon29.seq
 249817269     gbcon3.seq
 192075300     gbcon30.seq
 249998917     gbcon31.seq
 249996531     gbcon32.seq
 249997326     gbcon33.seq
 249998915     gbcon34.seq
 249951770     gbcon35.seq
 238917819     gbcon36.seq
 249997270     gbcon37.seq
 249999221     gbcon38.seq
 249994732     gbcon39.seq
 249977746     gbcon4.seq
 249996897     gbcon40.seq
 249997078     gbcon41.seq
 249997414     gbcon42.seq
  63412389     gbcon43.seq
 249995423     gbcon44.seq
 249997315     gbcon45.seq
 249997250     gbcon46.seq
 249997590     gbcon47.seq
 249996159     gbcon48.seq
  44928861     gbcon49.seq
 249992070     gbcon5.seq
 249994872     gbcon50.seq
 249995799     gbcon51.seq
 249997684     gbcon52.seq
 249996690     gbcon53.seq
 249997782     gbcon54.seq
  38241897     gbcon55.seq
 249998302     gbcon56.seq
 249999150     gbcon57.seq
 249998346     gbcon58.seq
 249994564     gbcon59.seq
 249999779     gbcon6.seq
 249999492     gbcon60.seq
 154672375     gbcon61.seq
 249999016     gbcon62.seq
 249996777     gbcon63.seq
 249999159     gbcon64.seq
 249995190     gbcon65.seq
 185611272     gbcon66.seq
 249996810     gbcon67.seq
 249998700     gbcon68.seq
 249997155     gbcon69.seq
 249996243     gbcon7.seq
 249997874     gbcon70.seq
 247616447     gbcon71.seq
 249998269     gbcon72.seq
 249995941     gbcon73.seq
 249998068     gbcon74.seq
 249999277     gbcon75.seq
 249999797     gbcon76.seq
  98773033     gbcon77.seq
 249997150     gbcon78.seq
 249997442     gbcon79.seq
    735104     gbcon8.seq
 249995516     gbcon80.seq
 249996111     gbcon81.seq
 249995971     gbcon82.seq
  64633499     gbcon83.seq
 249998451     gbcon84.seq
 249995859     gbcon85.seq
 249994386     gbcon86.seq
 249994858     gbcon87.seq
 249998199     gbcon88.seq
  23638323     gbcon89.seq
 249993190     gbcon9.seq
 249997115     gbcon90.seq
 249995538     gbcon91.seq
 249998987     gbcon92.seq
 249999150     gbcon93.seq
 199759401     gbcon94.seq
 249994089     gbcon95.seq
 249998565     gbcon96.seq
 249998526     gbcon97.seq
 249996032     gbcon98.seq
 249999284     gbcon99.seq
     66683     gbdel.txt
 249997698     gbenv1.seq
 249999538     gbenv10.seq
  57810239     gbenv11.seq
 249999978     gbenv12.seq
 249999195     gbenv13.seq
 250000136     gbenv14.seq
 250000216     gbenv15.seq
 249999796     gbenv16.seq
 249999995     gbenv17.seq
 250000028     gbenv18.seq
 214371907     gbenv19.seq
 249999868     gbenv2.seq
 249999461     gbenv20.seq
 249999890     gbenv21.seq
 249999712     gbenv22.seq
 249999941     gbenv23.seq
 156915060     gbenv24.seq
 249998189     gbenv25.seq
 249992261     gbenv26.seq
 249998997     gbenv27.seq
 249999193     gbenv28.seq
 249997993     gbenv29.seq
 249999232     gbenv3.seq
 184208891     gbenv30.seq
 249999624     gbenv31.seq
 249999051     gbenv32.seq
 249998115     gbenv33.seq
 249996871     gbenv34.seq
 187073105     gbenv35.seq
 249999958     gbenv36.seq
 249999318     gbenv37.seq
 249997508     gbenv38.seq
 249997658     gbenv39.seq
 250000233     gbenv4.seq
 249996558     gbenv40.seq
 249998338     gbenv41.seq
  43075589     gbenv42.seq
 250000217     gbenv43.seq
 249999313     gbenv44.seq
 250000126     gbenv45.seq
 249998673     gbenv46.seq
 174393566     gbenv47.seq
 249996074     gbenv48.seq
 250000040     gbenv49.seq
 249998766     gbenv5.seq
 249995335     gbenv50.seq
 249999563     gbenv51.seq
 249998630     gbenv52.seq
 249998437     gbenv53.seq
 249998176     gbenv54.seq
 242793829     gbenv55.seq
 249740297     gbenv6.seq
 250000123     gbenv7.seq
 249999849     gbenv8.seq
 249999849     gbenv9.seq
 524291258     gbest1.seq
 524290574     gbest10.seq
 524290454     gbest100.seq
 524290713     gbest101.seq
 524289850     gbest102.seq
 524289904     gbest103.seq
 360494697     gbest104.seq
 524292288     gbest105.seq
 524291533     gbest106.seq
 524289922     gbest107.seq
 385875937     gbest108.seq
 389643195     gbest109.seq
 524289698     gbest11.seq
 383431335     gbest110.seq
 384175352     gbest111.seq
 381048230     gbest112.seq
 385315426     gbest113.seq
 390041916     gbest114.seq
 388175753     gbest115.seq
 387302891     gbest116.seq
 383871806     gbest117.seq
 407537234     gbest118.seq
 510953227     gbest119.seq
 524290692     gbest12.seq
 524289568     gbest120.seq
 524290202     gbest121.seq
 524289950     gbest122.seq
 524291006     gbest123.seq
 430245620     gbest124.seq
 524290381     gbest125.seq
 524289622     gbest126.seq
 524289688     gbest127.seq
 524288741     gbest128.seq
 524291273     gbest129.seq
 157995929     gbest13.seq
 524289207     gbest130.seq
 524289362     gbest131.seq
 524291756     gbest132.seq
 524288996     gbest133.seq
 524289660     gbest134.seq
 524290383     gbest135.seq
 524292875     gbest136.seq
 301905047     gbest137.seq
 524290464     gbest138.seq
 524290515     gbest139.seq
 524290262     gbest14.seq
 524290983     gbest140.seq
 524289154     gbest141.seq
 524292934     gbest142.seq
 524289733     gbest143.seq
 524289484     gbest144.seq
 524290165     gbest145.seq
 524289818     gbest146.seq
 524288975     gbest147.seq
 524289444     gbest148.seq
 524289474     gbest149.seq
 524291584     gbest15.seq
 524290754     gbest150.seq
 466139680     gbest151.seq
 524289802     gbest152.seq
 524290154     gbest153.seq
 524289301     gbest154.seq
 524289356     gbest155.seq
 524291006     gbest156.seq
 524291098     gbest157.seq
 524289164     gbest158.seq
 524291722     gbest159.seq
 524288801     gbest16.seq
 524288869     gbest160.seq
 524292623     gbest161.seq
 524289690     gbest162.seq
 524289462     gbest163.seq
 247433320     gbest164.seq
 524290998     gbest165.seq
 524291121     gbest166.seq
 524290129     gbest167.seq
 524289333     gbest168.seq
 524288769     gbest169.seq
 524291403     gbest17.seq
 524290763     gbest170.seq
 524289532     gbest171.seq
 524289449     gbest172.seq
 524291578     gbest173.seq
 524289399     gbest174.seq
 524290407     gbest175.seq
 524290647     gbest176.seq
 524291784     gbest177.seq
 114349642     gbest178.seq
 524288875     gbest179.seq
 524291236     gbest18.seq
 524289374     gbest180.seq
 524290354     gbest181.seq
 524291074     gbest182.seq
 524290562     gbest183.seq
 524289611     gbest184.seq
 524290921     gbest185.seq
 524290773     gbest186.seq
 524291850     gbest187.seq
 524292493     gbest188.seq
 524290031     gbest189.seq
 524290127     gbest19.seq
 524289277     gbest190.seq
 469152976     gbest191.seq
 524289565     gbest192.seq
 524292225     gbest193.seq
 524290858     gbest194.seq
 524291676     gbest195.seq
 524292616     gbest196.seq
 524289020     gbest197.seq
 524289815     gbest198.seq
 524291447     gbest199.seq
 524290885     gbest2.seq
 524290769     gbest20.seq
 524290347     gbest200.seq
 524291266     gbest201.seq
 524289804     gbest202.seq
 524289897     gbest203.seq
 524290508     gbest204.seq
  78648677     gbest205.seq
 524290635     gbest206.seq
 524289971     gbest207.seq
 524289040     gbest208.seq
 524289083     gbest209.seq
 524289021     gbest21.seq
 524289161     gbest210.seq
 524291316     gbest211.seq
 524289881     gbest212.seq
 524290103     gbest213.seq
 524289905     gbest214.seq
 524290056     gbest215.seq
 423682100     gbest216.seq
 524293163     gbest217.seq
 524290939     gbest218.seq
 524290627     gbest219.seq
 512079353     gbest22.seq
 524290203     gbest220.seq
 524290955     gbest221.seq
 524292480     gbest222.seq
 524290312     gbest223.seq
 524290733     gbest224.seq
 524288936     gbest225.seq
 524292388     gbest226.seq
 524290999     gbest227.seq
 524289285     gbest228.seq
 524289816     gbest229.seq
 500358821     gbest23.seq
 350870038     gbest230.seq
 524288832     gbest231.seq
 524289071     gbest232.seq
 524289115     gbest233.seq
 524290536     gbest234.seq
 524292423     gbest235.seq
 524289677     gbest236.seq
 524290113     gbest237.seq
 524289413     gbest238.seq
 524289432     gbest239.seq
 509299214     gbest24.seq
 524289365     gbest240.seq
 524289497     gbest241.seq
 524291568     gbest242.seq
 524288969     gbest243.seq
 524292128     gbest244.seq
  57368125     gbest245.seq
 524290782     gbest246.seq
 524289653     gbest247.seq
 524292232     gbest248.seq
 524290697     gbest249.seq
 319843806     gbest25.seq
 524290399     gbest250.seq
 524290832     gbest251.seq
 524289795     gbest252.seq
 524289364     gbest253.seq
 524291373     gbest254.seq
 524290837     gbest255.seq
 524289516     gbest256.seq
 262324419     gbest257.seq
 524290651     gbest258.seq
 524289252     gbest259.seq
 524290962     gbest26.seq
 524289552     gbest260.seq
 524289295     gbest261.seq
 524290025     gbest262.seq
 524289056     gbest263.seq
 524289340     gbest264.seq
 524290273     gbest265.seq
 524290692     gbest266.seq
 524290593     gbest267.seq
 304013408     gbest268.seq
 524289118     gbest269.seq
 524290823     gbest27.seq
 524290386     gbest270.seq
 524289338     gbest271.seq
 524289093     gbest272.seq
 524289191     gbest273.seq
 524291274     gbest274.seq
 524290320     gbest275.seq
 524289441     gbest276.seq
 524288720     gbest277.seq
 524291786     gbest278.seq
 524292357     gbest279.seq
 524290986     gbest28.seq
 303444702     gbest280.seq
 524288806     gbest281.seq
 524289465     gbest282.seq
 524291427     gbest283.seq
 524289043     gbest284.seq
 524289273     gbest285.seq
 524291921     gbest286.seq
 524289560     gbest287.seq
 524291096     gbest288.seq
 524291595     gbest289.seq
 524288873     gbest29.seq
 524289521     gbest290.seq
 524292345     gbest291.seq
 230028401     gbest292.seq
 524291443     gbest293.seq
 524289210     gbest294.seq
 524289376     gbest295.seq
 524292344     gbest296.seq
 524291052     gbest297.seq
 524289205     gbest298.seq
 524289507     gbest299.seq
 497614745     gbest3.seq
 524293425     gbest30.seq
 524290651     gbest300.seq
 477408747     gbest301.seq
 485335496     gbest302.seq
 487705325     gbest303.seq
 324088175     gbest304.seq
 524290622     gbest305.seq
 524289347     gbest306.seq
 524288739     gbest307.seq
 524291455     gbest308.seq
 524289193     gbest309.seq
 524288990     gbest31.seq
 524290707     gbest310.seq
 524290194     gbest311.seq
 524291512     gbest312.seq
 524291328     gbest313.seq
 524288963     gbest314.seq
 524291085     gbest315.seq
 524289293     gbest316.seq
 512247904     gbest317.seq
 524289717     gbest318.seq
 524289980     gbest319.seq
 524289250     gbest32.seq
 524291519     gbest320.seq
 524290352     gbest321.seq
 524292211     gbest322.seq
 524292067     gbest323.seq
 524289903     gbest324.seq
 524289793     gbest325.seq
 524290614     gbest326.seq
 523676537     gbest327.seq
 524291720     gbest328.seq
 524291358     gbest329.seq
 524290812     gbest33.seq
 524290916     gbest330.seq
 256130098     gbest331.seq
 524291473     gbest332.seq
 524290448     gbest333.seq
 524288765     gbest334.seq
 524289071     gbest335.seq
 501514475     gbest336.seq
 524292250     gbest337.seq
 524289781     gbest338.seq
 524289493     gbest339.seq
 520096417     gbest34.seq
 524289459     gbest340.seq
 524289296     gbest341.seq
 524291258     gbest342.seq
 524290520     gbest343.seq
 524289241     gbest344.seq
 352088251     gbest345.seq
 524289878     gbest346.seq
 524291635     gbest347.seq
 524290464     gbest348.seq
 524290429     gbest349.seq
 492755506     gbest35.seq
 524290603     gbest350.seq
 524288921     gbest351.seq
 524292363     gbest352.seq
 524292050     gbest353.seq
 524289388     gbest354.seq
 524290841     gbest355.seq
 524288827     gbest356.seq
 524290980     gbest357.seq
 524291056     gbest358.seq
 524290178     gbest359.seq
 494457393     gbest36.seq
  28162295     gbest360.seq
 524290789     gbest361.seq
 524288850     gbest362.seq
 524290707     gbest363.seq
 524291607     gbest364.seq
 524290436     gbest365.seq
 524291330     gbest366.seq
 524289980     gbest367.seq
 524289856     gbest368.seq
 524289392     gbest369.seq
 493331108     gbest37.seq
 524289999     gbest370.seq
 393861390     gbest371.seq
 524289473     gbest372.seq
 524289235     gbest373.seq
 524288858     gbest374.seq
 524291147     gbest375.seq
 524290120     gbest376.seq
 524290134     gbest377.seq
 524289761     gbest378.seq
 524291888     gbest379.seq
 487995595     gbest38.seq
 524288810     gbest380.seq
 524288739     gbest381.seq
 524288874     gbest382.seq
 347880742     gbest383.seq
 524290089     gbest384.seq
 524289614     gbest385.seq
 524289804     gbest386.seq
 524289949     gbest387.seq
 524291224     gbest388.seq
 524289312     gbest389.seq
 493163256     gbest39.seq
 524290523     gbest390.seq
 524291207     gbest391.seq
 524290058     gbest392.seq
 524288854     gbest393.seq
 524290878     gbest394.seq
   9470193     gbest395.seq
 524290463     gbest396.seq
 524290848     gbest397.seq
 524292048     gbest398.seq
 524290041     gbest399.seq
 524289662     gbest4.seq
 113051462     gbest40.seq
 524291225     gbest400.seq
 524290603     gbest401.seq
 524288979     gbest402.seq
 524291463     gbest403.seq
 524289750     gbest404.seq
 524288748     gbest405.seq
 524292003     gbest406.seq
 524291353     gbest407.seq
 510744193     gbest408.seq
 524289160     gbest409.seq
 524290480     gbest41.seq
 524289249     gbest410.seq
 524291855     gbest411.seq
 524288743     gbest412.seq
 524290951     gbest413.seq
 524288763     gbest414.seq
 524290994     gbest415.seq
 524292141     gbest416.seq
 524289822     gbest417.seq
 524290920     gbest418.seq
 524290495     gbest419.seq
 524290973     gbest42.seq
 524290708     gbest420.seq
 524289655     gbest421.seq
   1615669     gbest422.seq
 524290650     gbest423.seq
 524293084     gbest424.seq
 524294089     gbest425.seq
 524290343     gbest426.seq
 524288764     gbest427.seq
 524291194     gbest428.seq
 524290702     gbest429.seq
 524289229     gbest43.seq
 524288911     gbest430.seq
 524289310     gbest431.seq
 524290674     gbest432.seq
 524289885     gbest433.seq
 524291489     gbest434.seq
 524289367     gbest435.seq
 524290778     gbest436.seq
  99471304     gbest437.seq
 524291032     gbest438.seq
 524289088     gbest439.seq
 524289545     gbest44.seq
 524290745     gbest440.seq
 524289423     gbest441.seq
 524290129     gbest442.seq
 524292094     gbest443.seq
 524289685     gbest444.seq
 524290730     gbest445.seq
 524289158     gbest446.seq
 524290523     gbest447.seq
 524290347     gbest448.seq
 448926530     gbest449.seq
 524290769     gbest45.seq
 524290868     gbest450.seq
 524290680     gbest451.seq
 524289782     gbest452.seq
 524289302     gbest453.seq
 524290549     gbest454.seq
 524290097     gbest455.seq
 524289542     gbest456.seq
 524289292     gbest457.seq
 524290473     gbest458.seq
 524289097     gbest459.seq
 524289986     gbest46.seq
 524290616     gbest460.seq
 220963691     gbest461.seq
 524291320     gbest462.seq
 524289550     gbest463.seq
 524291062     gbest464.seq
 524290235     gbest465.seq
 454166198     gbest466.seq
 524290140     gbest47.seq
 524289860     gbest48.seq
 524289953     gbest49.seq
 524290143     gbest5.seq
 524290738     gbest50.seq
 524290875     gbest51.seq
 524289810     gbest52.seq
 524291209     gbest53.seq
 254259872     gbest54.seq
 524289037     gbest55.seq
 524288886     gbest56.seq
 524289337     gbest57.seq
 524288769     gbest58.seq
 524291772     gbest59.seq
 524289793     gbest6.seq
 524289548     gbest60.seq
 524290418     gbest61.seq
 524291456     gbest62.seq
 524291057     gbest63.seq
 524288771     gbest64.seq
 524291140     gbest65.seq
 524289937     gbest66.seq
 464556890     gbest67.seq
 524291162     gbest68.seq
 524289808     gbest69.seq
 524290279     gbest7.seq
 524290591     gbest70.seq
 524290628     gbest71.seq
 524290204     gbest72.seq
 524290002     gbest73.seq
 524289809     gbest74.seq
 524292150     gbest75.seq
 524292057     gbest76.seq
 524290008     gbest77.seq
 524292038     gbest78.seq
 524292213     gbest79.seq
 524290687     gbest8.seq
 192323249     gbest80.seq
 524288774     gbest81.seq
 524290921     gbest82.seq
 524290327     gbest83.seq
 524290563     gbest84.seq
 524289592     gbest85.seq
 524291383     gbest86.seq
 524289519     gbest87.seq
 524290029     gbest88.seq
 524288742     gbest89.seq
 524288917     gbest9.seq
 524289390     gbest90.seq
 524290309     gbest91.seq
 463202912     gbest92.seq
 524289112     gbest93.seq
 524291750     gbest94.seq
 524290922     gbest95.seq
 524290562     gbest96.seq
 524289364     gbest97.seq
 524291422     gbest98.seq
 524290470     gbest99.seq
 192416273     gbgen.idx
 524291268     gbgss1.seq
 524289844     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524290642     gbgss103.seq
 418357212     gbgss104.seq
 524290482     gbgss105.seq
 524289251     gbgss106.seq
 524291219     gbgss107.seq
 524289781     gbgss108.seq
 524289085     gbgss109.seq
 524291170     gbgss11.seq
 524290880     gbgss110.seq
 524290939     gbgss111.seq
 524289900     gbgss112.seq
 524289661     gbgss113.seq
 524291245     gbgss114.seq
 524289712     gbgss115.seq
  55614320     gbgss116.seq
 524288977     gbgss117.seq
 524291250     gbgss118.seq
 524289058     gbgss119.seq
 524291525     gbgss12.seq
 524289335     gbgss120.seq
 524288722     gbgss121.seq
 524291210     gbgss122.seq
 524288737     gbgss123.seq
 524289962     gbgss124.seq
 524289662     gbgss125.seq
 524290929     gbgss126.seq
 524290417     gbgss127.seq
 524292083     gbgss128.seq
 202072024     gbgss129.seq
 524290301     gbgss13.seq
 524288727     gbgss130.seq
 524291361     gbgss131.seq
 524289314     gbgss132.seq
 524290882     gbgss133.seq
 524290446     gbgss134.seq
 524288874     gbgss135.seq
 524290572     gbgss136.seq
 524291579     gbgss137.seq
 524290542     gbgss138.seq
 516030223     gbgss139.seq
 524290538     gbgss14.seq
 516013390     gbgss140.seq
 152921702     gbgss141.seq
 524289602     gbgss142.seq
 524290383     gbgss143.seq
 524290643     gbgss144.seq
 524289848     gbgss145.seq
 524289245     gbgss146.seq
 524291649     gbgss147.seq
 524290423     gbgss148.seq
 524291229     gbgss149.seq
 524290893     gbgss15.seq
 524289724     gbgss150.seq
 524290800     gbgss151.seq
 322567846     gbgss152.seq
 524291914     gbgss153.seq
 279359655     gbgss154.seq
 249999034     gbgss155.seq
 250000148     gbgss156.seq
 250000086     gbgss157.seq
 249998834     gbgss158.seq
  28885095     gbgss159.seq
 524291157     gbgss16.seq
 249997137     gbgss160.seq
 250000033     gbgss161.seq
 249998542     gbgss162.seq
 249998333     gbgss163.seq
 224919493     gbgss164.seq
 249998415     gbgss165.seq
 249998761     gbgss166.seq
 249999722     gbgss167.seq
 249999888     gbgss168.seq
 191344183     gbgss169.seq
 524289284     gbgss17.seq
 249997564     gbgss170.seq
 249996752     gbgss171.seq
 249999513     gbgss172.seq
 249997874     gbgss173.seq
 249999326     gbgss174.seq
  77035229     gbgss175.seq
 249999230     gbgss176.seq
   2090297     gbgss177.seq
  79542394     gbgss178.seq
 249998428     gbgss179.seq
 524290445     gbgss18.seq
 249999593     gbgss180.seq
  87205952     gbgss181.seq
 249999685     gbgss182.seq
 249998355     gbgss183.seq
 249998984     gbgss184.seq
 202702168     gbgss185.seq
 249999232     gbgss186.seq
 249998752     gbgss187.seq
 250000079     gbgss188.seq
 246010499     gbgss189.seq
 315738815     gbgss19.seq
 249997836     gbgss190.seq
 249998110     gbgss191.seq
 249999870     gbgss192.seq
 243311140     gbgss193.seq
 249999336     gbgss194.seq
 249999298     gbgss195.seq
 249998180     gbgss196.seq
 249999024     gbgss197.seq
 122621192     gbgss198.seq
 249998013     gbgss199.seq
 524291236     gbgss2.seq
 524288931     gbgss20.seq
 249999792     gbgss200.seq
 249998459     gbgss201.seq
 249998343     gbgss202.seq
  95905540     gbgss203.seq
 249999742     gbgss204.seq
 249999443     gbgss205.seq
 249998384     gbgss206.seq
 249999963     gbgss207.seq
 183118490     gbgss208.seq
 249999236     gbgss209.seq
 524288871     gbgss21.seq
 249997993     gbgss210.seq
 249998006     gbgss211.seq
 249999353     gbgss212.seq
  95926739     gbgss213.seq
 249999461     gbgss214.seq
 249999350     gbgss215.seq
 249998406     gbgss216.seq
 249998619     gbgss217.seq
 249999398     gbgss218.seq
 249998555     gbgss219.seq
 524290551     gbgss22.seq
  37426508     gbgss220.seq
 249999424     gbgss221.seq
 249999963     gbgss222.seq
 249997369     gbgss223.seq
  43648880     gbgss224.seq
  52925443     gbgss225.seq
 249997818     gbgss226.seq
 249998543     gbgss227.seq
 249997629     gbgss228.seq
 249998343     gbgss229.seq
 524289209     gbgss23.seq
  32070531     gbgss230.seq
 249997670     gbgss231.seq
 249997588     gbgss232.seq
 249999018     gbgss233.seq
 250000000     gbgss234.seq
  28042636     gbgss235.seq
 249997661     gbgss236.seq
 250000032     gbgss237.seq
 249999621     gbgss238.seq
 249998725     gbgss239.seq
 524290237     gbgss24.seq
 250000203     gbgss240.seq
 249997935     gbgss241.seq
 179555991     gbgss242.seq
 249999812     gbgss243.seq
 249998926     gbgss244.seq
 249999095     gbgss245.seq
 220154622     gbgss246.seq
 250000034     gbgss247.seq
 249997956     gbgss248.seq
 250000074     gbgss249.seq
 524289518     gbgss25.seq
 249999182     gbgss250.seq
 249997864     gbgss251.seq
 249999567     gbgss252.seq
 249998654     gbgss253.seq
 141523450     gbgss254.seq
 249999562     gbgss255.seq
 249998752     gbgss256.seq
 249999600     gbgss257.seq
 249999029     gbgss258.seq
 249999913     gbgss259.seq
 524289126     gbgss26.seq
  31601752     gbgss260.seq
 524291882     gbgss27.seq
 524289238     gbgss28.seq
 524290063     gbgss29.seq
 524291209     gbgss3.seq
 524291675     gbgss30.seq
  39710031     gbgss31.seq
 524289648     gbgss32.seq
 524290113     gbgss33.seq
 524289714     gbgss34.seq
 524289477     gbgss35.seq
 524289253     gbgss36.seq
 524289803     gbgss37.seq
 524290304     gbgss38.seq
 509235276     gbgss39.seq
 524291248     gbgss4.seq
 524291637     gbgss40.seq
 524290032     gbgss41.seq
 524290785     gbgss42.seq
  27290698     gbgss43.seq
 524288946     gbgss44.seq
 524289968     gbgss45.seq
 524288819     gbgss46.seq
 524290756     gbgss47.seq
 210287820     gbgss48.seq
 524288819     gbgss49.seq
 168382749     gbgss5.seq
 524291634     gbgss50.seq
 524290649     gbgss51.seq
 524289644     gbgss52.seq
 524290504     gbgss53.seq
 524289673     gbgss54.seq
 524289302     gbgss55.seq
 524289323     gbgss56.seq
 524289163     gbgss57.seq
 524291431     gbgss58.seq
 524290523     gbgss59.seq
 524290951     gbgss6.seq
   9017915     gbgss60.seq
 524289679     gbgss61.seq
 524290709     gbgss62.seq
 524290953     gbgss63.seq
 457241977     gbgss64.seq
 524290913     gbgss65.seq
 524290824     gbgss66.seq
 524289288     gbgss67.seq
 524290050     gbgss68.seq
 524289299     gbgss69.seq
 524288756     gbgss7.seq
 524291837     gbgss70.seq
 524291200     gbgss71.seq
 524290900     gbgss72.seq
 524290251     gbgss73.seq
 524290885     gbgss74.seq
 524291499     gbgss75.seq
 524288863     gbgss76.seq
  37611772     gbgss77.seq
 524289713     gbgss78.seq
 524291088     gbgss79.seq
 524291665     gbgss8.seq
 524289188     gbgss80.seq
 524289725     gbgss81.seq
 524289653     gbgss82.seq
 524292093     gbgss83.seq
 524289596     gbgss84.seq
 524288916     gbgss85.seq
 524288845     gbgss86.seq
 524292186     gbgss87.seq
 524290629     gbgss88.seq
 376669558     gbgss89.seq
 524290499     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249991368     gbhtc1.seq
 249999254     gbhtc10.seq
 249995730     gbhtc11.seq
  33328961     gbhtc12.seq
 249997337     gbhtc13.seq
 249997331     gbhtc14.seq
  65975720     gbhtc15.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  84096736     gbhtc8.seq
 249996193     gbhtc9.seq
 249907861     gbhtg1.seq
 249801162     gbhtg10.seq
 249917503     gbhtg100.seq
 249844960     gbhtg101.seq
 249902534     gbhtg102.seq
 249987236     gbhtg103.seq
   5671243     gbhtg104.seq
 249937698     gbhtg105.seq
 249890707     gbhtg106.seq
 249627730     gbhtg107.seq
 249987618     gbhtg108.seq
 249997717     gbhtg109.seq
   1643239     gbhtg11.seq
 249849347     gbhtg110.seq
 249960622     gbhtg111.seq
 249849747     gbhtg112.seq
 249828930     gbhtg113.seq
 164547921     gbhtg114.seq
 249674352     gbhtg115.seq
 249844567     gbhtg116.seq
 249991810     gbhtg117.seq
 249938336     gbhtg118.seq
 249984745     gbhtg119.seq
 249888438     gbhtg12.seq
  31428922     gbhtg120.seq
 249935899     gbhtg121.seq
 249834856     gbhtg122.seq
 249978158     gbhtg123.seq
 249875691     gbhtg124.seq
 249782400     gbhtg125.seq
 134760056     gbhtg126.seq
 249837708     gbhtg127.seq
 249847144     gbhtg128.seq
 249810959     gbhtg129.seq
 249970556     gbhtg13.seq
 249845531     gbhtg130.seq
 249837450     gbhtg131.seq
 249860594     gbhtg132.seq
 249888950     gbhtg133.seq
 249946060     gbhtg134.seq
 249955802     gbhtg135.seq
  79177816     gbhtg136.seq
 249587437     gbhtg14.seq
 249775919     gbhtg15.seq
 249742391     gbhtg16.seq
 249169910     gbhtg17.seq
 249983662     gbhtg18.seq
 249677588     gbhtg19.seq
 249988506     gbhtg2.seq
 249988774     gbhtg20.seq
 237145184     gbhtg21.seq
 249760635     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761262     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249842167     gbhtg29.seq
 249988698     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249920778     gbhtg33.seq
 249929470     gbhtg34.seq
 249919058     gbhtg35.seq
 249858216     gbhtg36.seq
 249814780     gbhtg37.seq
 249767485     gbhtg38.seq
 249627604     gbhtg39.seq
 249766042     gbhtg4.seq
 249839726     gbhtg40.seq
 224363181     gbhtg41.seq
 249889409     gbhtg42.seq
 249786859     gbhtg43.seq
 249974474     gbhtg44.seq
 249775813     gbhtg45.seq
 249912495     gbhtg46.seq
 249597884     gbhtg47.seq
 249994351     gbhtg48.seq
 249827710     gbhtg49.seq
 249989014     gbhtg5.seq
 249881058     gbhtg50.seq
 234821578     gbhtg51.seq
 249732627     gbhtg52.seq
 249917788     gbhtg53.seq
 249773218     gbhtg54.seq
 249971346     gbhtg55.seq
 249962497     gbhtg56.seq
  18795863     gbhtg57.seq
 249861261     gbhtg58.seq
 249823462     gbhtg59.seq
 249770427     gbhtg6.seq
 249990576     gbhtg60.seq
 249921220     gbhtg61.seq
 225131043     gbhtg62.seq
 249853668     gbhtg63.seq
 249787648     gbhtg64.seq
 249883720     gbhtg65.seq
 249980269     gbhtg66.seq
 249833261     gbhtg67.seq
  16614633     gbhtg68.seq
 249960711     gbhtg69.seq
 249852195     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249976832     gbhtg72.seq
 225068329     gbhtg73.seq
 249811078     gbhtg74.seq
 249874983     gbhtg75.seq
 249800272     gbhtg76.seq
 249959810     gbhtg77.seq
 244236596     gbhtg78.seq
 249884075     gbhtg79.seq
 249758873     gbhtg8.seq
 249989775     gbhtg80.seq
 249840148     gbhtg81.seq
 249838461     gbhtg82.seq
 216751403     gbhtg83.seq
 249966974     gbhtg84.seq
 249803238     gbhtg85.seq
 249757894     gbhtg86.seq
 249849119     gbhtg87.seq
 220831501     gbhtg88.seq
 249970341     gbhtg89.seq
 249968894     gbhtg9.seq
 249954488     gbhtg90.seq
 249999471     gbhtg91.seq
 249963741     gbhtg92.seq
 208664273     gbhtg93.seq
 249870413     gbhtg94.seq
 249944582     gbhtg95.seq
 249904036     gbhtg96.seq
 249769960     gbhtg97.seq
 167889800     gbhtg98.seq
 249744704     gbhtg99.seq
 249997994     gbinv1.seq
 249998779     gbinv10.seq
 249997147     gbinv11.seq
 181211291     gbinv12.seq
 249998571     gbinv13.seq
 249997698     gbinv14.seq
 250000222     gbinv15.seq
 159576868     gbinv16.seq
 249998979     gbinv17.seq
 249937190     gbinv18.seq
 249998620     gbinv19.seq
 249820761     gbinv2.seq
 250000063     gbinv20.seq
 249999708     gbinv21.seq
   8325474     gbinv22.seq
 223386781     gbinv23.seq
 175506967     gbinv24.seq
 249998586     gbinv25.seq
 250000147     gbinv26.seq
  95435064     gbinv27.seq
 250000137     gbinv28.seq
 249997830     gbinv29.seq
 228922623     gbinv3.seq
 249996993     gbinv30.seq
 249996645     gbinv31.seq
 151252255     gbinv32.seq
 249995524     gbinv4.seq
 249999391     gbinv5.seq
 249669363     gbinv6.seq
 249998755     gbinv7.seq
  25492259     gbinv8.seq
 249998824     gbinv9.seq
 139740207     gbjou1.idx
 307006662     gbjou10.idx
 269993860     gbjou11.idx
 279962146     gbjou12.idx
  88048570     gbjou13.idx
 139586757     gbjou2.idx
 206596190     gbjou3.idx
 167967740     gbjou4.idx
 269708758     gbjou5.idx
 278548852     gbjou6.idx
 283359684     gbjou7.idx
 274356026     gbjou8.idx
 302235094     gbjou9.idx
 352024546     gbkey1.idx
 180083269     gbkey2.idx
 179443187     gbkey3.idx
 241334063     gbkey4.idx
 189291223     gbkey5.idx
 183447654     gbkey6.idx
 118219642     gbkey7.idx
 249989011     gbmam1.seq
 249999873     gbmam2.seq
 249853602     gbmam3.seq
 249999107     gbmam4.seq
 250000063     gbmam5.seq
 249999760     gbmam6.seq
 249998460     gbmam7.seq
  48855452     gbmam8.seq
  37399512     gbnew.txt
 249997686     gbpat1.seq
 249999417     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192957204     gbpat107.seq
 250000153     gbpat108.seq
 249999625     gbpat109.seq
 179605660     gbpat11.seq
 249995093     gbpat110.seq
  80149323     gbpat111.seq
 249999706     gbpat112.seq
 249999145     gbpat113.seq
 249992347     gbpat114.seq
 250000102     gbpat115.seq
 249868822     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 249999635     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 249999107     gbpat13.seq
 249997452     gbpat130.seq
  66832984     gbpat131.seq
 249992315     gbpat132.seq
 249999867     gbpat133.seq
 250000197     gbpat134.seq
 249999821     gbpat135.seq
 249998337     gbpat136.seq
  18437114     gbpat137.seq
 249999655     gbpat138.seq
 249998828     gbpat139.seq
 249999899     gbpat14.seq
 249999803     gbpat140.seq
 249999630     gbpat141.seq
 249999242     gbpat142.seq
  71930533     gbpat143.seq
 249998039     gbpat144.seq
 250000068     gbpat145.seq
 250000067     gbpat146.seq
  86028783     gbpat147.seq
 249999922     gbpat148.seq
 249999791     gbpat149.seq
 249999657     gbpat15.seq
 250000047     gbpat150.seq
  63545113     gbpat151.seq
 249999561     gbpat152.seq
 249997572     gbpat153.seq
 250000074     gbpat154.seq
 249999246     gbpat155.seq
 249999515     gbpat156.seq
 250000164     gbpat157.seq
 222294841     gbpat158.seq
 250000249     gbpat159.seq
 249999146     gbpat16.seq
 249999893     gbpat160.seq
 249999893     gbpat161.seq
 220539897     gbpat162.seq
 249999753     gbpat163.seq
 249998700     gbpat164.seq
 249999436     gbpat165.seq
  12392193     gbpat166.seq
 249997274     gbpat167.seq
 249998906     gbpat168.seq
 250000046     gbpat169.seq
  65942979     gbpat17.seq
 249998713     gbpat170.seq
  35425686     gbpat171.seq
 249998924     gbpat172.seq
 249998987     gbpat173.seq
 249999240     gbpat174.seq
 249999114     gbpat175.seq
 249999239     gbpat176.seq
 249999751     gbpat177.seq
  83399607     gbpat178.seq
 250000132     gbpat179.seq
 250000027     gbpat18.seq
 249999617     gbpat180.seq
 249998297     gbpat181.seq
 140780844     gbpat182.seq
 249999801     gbpat19.seq
 249997564     gbpat2.seq
 250000170     gbpat20.seq
 249994457     gbpat21.seq
 186148505     gbpat22.seq
 250000226     gbpat23.seq
 249965771     gbpat24.seq
 250000021     gbpat25.seq
 249999899     gbpat26.seq
  71267866     gbpat27.seq
 249992472     gbpat28.seq
 249999281     gbpat29.seq
 249999687     gbpat3.seq
 249998562     gbpat30.seq
 249999169     gbpat31.seq
 249999668     gbpat32.seq
 180220217     gbpat33.seq
 249999085     gbpat34.seq
 249999204     gbpat35.seq
 249999854     gbpat36.seq
 249998515     gbpat37.seq
 130550573     gbpat38.seq
 249997033     gbpat39.seq
 249995996     gbpat4.seq
 249995003     gbpat40.seq
 249998829     gbpat41.seq
 249999347     gbpat42.seq
 249994544     gbpat43.seq
 249899127     gbpat44.seq
 249999190     gbpat45.seq
 249999007     gbpat46.seq
 171471303     gbpat47.seq
 249998371     gbpat48.seq
 249997524     gbpat49.seq
  71719615     gbpat5.seq
 249999853     gbpat50.seq
 249999528     gbpat51.seq
 222937739     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164995174     gbpat56.seq
 249886561     gbpat57.seq
 249999993     gbpat58.seq
 250000063     gbpat59.seq
 249999527     gbpat6.seq
 250000158     gbpat60.seq
 135004984     gbpat61.seq
 249998945     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999682     gbpat67.seq
 144886744     gbpat68.seq
 250000135     gbpat69.seq
 250000106     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244400042     gbpat72.seq
 248969066     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999925     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249994100     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249996792     gbpat82.seq
 249999999     gbpat83.seq
  93339777     gbpat84.seq
 249156430     gbpat85.seq
 249999629     gbpat86.seq
 249999561     gbpat87.seq
 249999368     gbpat88.seq
 249999290     gbpat89.seq
 249999825     gbpat9.seq
 249999957     gbpat90.seq
 145297619     gbpat91.seq
 249999467     gbpat92.seq
 249998980     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196964910     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 204391061     gbphg1.seq
 249997289     gbpln1.seq
 249998624     gbpln10.seq
 249999177     gbpln11.seq
 249996314     gbpln12.seq
 249878239     gbpln13.seq
 214583978     gbpln14.seq
 249969765     gbpln15.seq
 249989406     gbpln16.seq
 249992843     gbpln17.seq
 249927146     gbpln18.seq
 249993801     gbpln19.seq
 249789662     gbpln2.seq
 249952454     gbpln20.seq
 249993183     gbpln21.seq
  33983540     gbpln22.seq
 249996898     gbpln23.seq
  97740629     gbpln24.seq
 249996192     gbpln25.seq
 249998130     gbpln26.seq
 249822988     gbpln27.seq
 221260740     gbpln28.seq
 181007284     gbpln29.seq
 249972721     gbpln3.seq
 249962159     gbpln30.seq
 249999937     gbpln31.seq
 249996998     gbpln32.seq
 249726673     gbpln33.seq
 249999617     gbpln34.seq
 121994485     gbpln35.seq
 249999436     gbpln36.seq
 249998874     gbpln37.seq
 249997293     gbpln38.seq
 249998580     gbpln39.seq
 249938569     gbpln4.seq
 143837735     gbpln40.seq
 249908388     gbpln41.seq
 249928598     gbpln42.seq
 249999097     gbpln43.seq
 249998190     gbpln44.seq
 244951649     gbpln45.seq
 218760808     gbpln46.seq
 249998480     gbpln47.seq
 249998913     gbpln48.seq
 249997243     gbpln49.seq
 249892773     gbpln5.seq
 249999193     gbpln50.seq
 234337109     gbpln51.seq
 249999809     gbpln52.seq
 249999259     gbpln53.seq
 249998876     gbpln54.seq
 249997706     gbpln55.seq
 249999895     gbpln56.seq
 230009562     gbpln57.seq
 249937073     gbpln6.seq
 249726262     gbpln7.seq
 250000107     gbpln8.seq
  85984779     gbpln9.seq
 148964268     gbpri1.seq
 249995439     gbpri10.seq
 130148157     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902715     gbpri16.seq
 249876249     gbpri17.seq
 249992266     gbpri18.seq
 249904039     gbpri19.seq
 249974672     gbpri2.seq
 249955187     gbpri20.seq
 249970172     gbpri21.seq
 249999032     gbpri22.seq
  52238038     gbpri23.seq
 177491553     gbpri24.seq
 249998613     gbpri25.seq
 211357951     gbpri26.seq
 249986508     gbpri27.seq
 249988068     gbpri28.seq
 249948643     gbpri29.seq
 249819692     gbpri3.seq
 249935305     gbpri30.seq
 249896084     gbpri31.seq
 249967755     gbpri32.seq
 249968207     gbpri33.seq
 249985609     gbpri34.seq
  99003565     gbpri35.seq
 249993971     gbpri36.seq
 249997177     gbpri37.seq
 249923472     gbpri38.seq
 249994486     gbpri39.seq
 249982802     gbpri4.seq
 249998147     gbpri40.seq
 183823873     gbpri41.seq
 250000250     gbpri42.seq
 250000123     gbpri43.seq
 249987456     gbpri44.seq
  63418592     gbpri45.seq
 249741329     gbpri5.seq
 249854494     gbpri6.seq
 249967390     gbpri7.seq
 249797768     gbpri8.seq
 249977029     gbpri9.seq
    329828     gbrel.txt
 249760784     gbrod1.seq
 249890064     gbrod10.seq
  63086316     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249706828     gbrod18.seq
 247511646     gbrod19.seq
 249927954     gbrod2.seq
 249768824     gbrod20.seq
 249924095     gbrod21.seq
 230194968     gbrod22.seq
 249999848     gbrod23.seq
 249997092     gbrod24.seq
 249953950     gbrod25.seq
 249874716     gbrod26.seq
 249999436     gbrod27.seq
 249998663     gbrod28.seq
 223550372     gbrod29.seq
 249846934     gbrod3.seq
 249801207     gbrod4.seq
 249878898     gbrod5.seq
 249894478     gbrod6.seq
 249944880     gbrod7.seq
 249973808     gbrod8.seq
 249999120     gbrod9.seq
4442769309     gbsdr1.txt
5884035056     gbsdr2.txt
2757232054     gbsdr3.txt
 148404862     gbsec.idx
 249996472     gbsts1.seq
 249997720     gbsts10.seq
 210919464     gbsts11.seq
 249996524     gbsts12.seq
 249998812     gbsts13.seq
 249999881     gbsts14.seq
 249999569     gbsts15.seq
  24453604     gbsts16.seq
 249999107     gbsts17.seq
 249999726     gbsts18.seq
 249998944     gbsts19.seq
 249998310     gbsts2.seq
 148773003     gbsts20.seq
 250000245     gbsts3.seq
 249996479     gbsts4.seq
  39285911     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249999304     gbsts9.seq
 249998417     gbsyn1.seq
 249996075     gbsyn2.seq
 249992504     gbsyn3.seq
 249992730     gbsyn4.seq
 249976202     gbsyn5.seq
 249962268     gbsyn6.seq
 140691964     gbsyn7.seq
 249998949     gbtsa1.seq
  39481017     gbtsa10.seq
 249997488     gbtsa11.seq
 249995952     gbtsa12.seq
 249999450     gbtsa13.seq
 249999867     gbtsa14.seq
 238037462     gbtsa15.seq
 249998569     gbtsa16.seq
 249998880     gbtsa17.seq
 249999066     gbtsa18.seq
 249993881     gbtsa19.seq
 249997872     gbtsa2.seq
 175705543     gbtsa20.seq
 249999624     gbtsa21.seq
 250000148     gbtsa22.seq
 249999827     gbtsa23.seq
 249999941     gbtsa24.seq
 249997979     gbtsa25.seq
 249998502     gbtsa26.seq
  40016328     gbtsa27.seq
 249998953     gbtsa28.seq
 250000012     gbtsa29.seq
 249998023     gbtsa3.seq
 249999898     gbtsa30.seq
 249998409     gbtsa31.seq
 249999390     gbtsa32.seq
 249999600     gbtsa33.seq
 249999882     gbtsa34.seq
   4192477     gbtsa35.seq
 249996808     gbtsa36.seq
 249999333     gbtsa37.seq
 249999623     gbtsa38.seq
 249996941     gbtsa39.seq
 249998575     gbtsa4.seq
  62862028     gbtsa40.seq
 249998923     gbtsa41.seq
 249999080     gbtsa42.seq
 249998601     gbtsa43.seq
 249998012     gbtsa44.seq
  74419671     gbtsa45.seq
 249999615     gbtsa46.seq
 249997841     gbtsa47.seq
 249997974     gbtsa48.seq
 249999733     gbtsa49.seq
  89226644     gbtsa5.seq
 250000051     gbtsa50.seq
 249998951     gbtsa51.seq
 249998367     gbtsa52.seq
 162692273     gbtsa53.seq
 249999165     gbtsa54.seq
 249999807     gbtsa55.seq
 250000157     gbtsa56.seq
 249997931     gbtsa57.seq
 249997382     gbtsa58.seq
 249999902     gbtsa59.seq
 249998268     gbtsa6.seq
 211805636     gbtsa60.seq
 249999394     gbtsa61.seq
 249998952     gbtsa62.seq
 249999194     gbtsa63.seq
 249997286     gbtsa64.seq
 249994947     gbtsa65.seq
 249999039     gbtsa66.seq
 249999769     gbtsa67.seq
 241066495     gbtsa68.seq
 249998385     gbtsa69.seq
 249999386     gbtsa7.seq
 249999307     gbtsa70.seq
 249998418     gbtsa71.seq
 249999196     gbtsa72.seq
 250000195     gbtsa73.seq
 249998576     gbtsa74.seq
 220923327     gbtsa75.seq
 249998956     gbtsa76.seq
 249998196     gbtsa77.seq
 249999461     gbtsa78.seq
 239607201     gbtsa79.seq
 250000131     gbtsa8.seq
 249998447     gbtsa80.seq
 249998843     gbtsa81.seq
 249999713     gbtsa82.seq
 249998691     gbtsa83.seq
 244524991     gbtsa84.seq
 249998567     gbtsa85.seq
 249999625     gbtsa86.seq
 249999647     gbtsa87.seq
 249997596     gbtsa88.seq
 223760067     gbtsa89.seq
 250000161     gbtsa9.seq
 249999535     gbtsa90.seq
 249998914     gbtsa91.seq
 250000173     gbtsa92.seq
 249999583     gbtsa93.seq
 249999643     gbtsa94.seq
 249999044     gbtsa95.seq
 199437195     gbtsa96.seq
    496438     gbuna1.seq
 249995862     gbvrl1.seq
 249997976     gbvrl10.seq
 223493200     gbvrl11.seq
 249994824     gbvrl12.seq
 249998100     gbvrl13.seq
 249998623     gbvrl14.seq
 249998854     gbvrl15.seq
 155773879     gbvrl16.seq
 249993876     gbvrl17.seq
 249998098     gbvrl18.seq
 249885152     gbvrl19.seq
 249997531     gbvrl2.seq
 249997360     gbvrl20.seq
 230771280     gbvrl21.seq
 249997456     gbvrl3.seq
 249995796     gbvrl4.seq
 196748139     gbvrl5.seq
 249999515     gbvrl6.seq
 249998362     gbvrl7.seq
 249985287     gbvrl8.seq
 249997221     gbvrl9.seq
 249874317     gbvrt1.seq
 249855727     gbvrt10.seq
 249950363     gbvrt11.seq
 185412106     gbvrt12.seq
 249994619     gbvrt13.seq
 249897444     gbvrt14.seq
 249972959     gbvrt15.seq
 249998719     gbvrt16.seq
 249998845     gbvrt17.seq
 249998625     gbvrt18.seq
  99005938     gbvrt19.seq
 249763404     gbvrt2.seq
 249993758     gbvrt20.seq
 249998351     gbvrt21.seq
 249995660     gbvrt22.seq
 249998411     gbvrt23.seq
 249999533     gbvrt24.seq
 249999942     gbvrt25.seq
 249998483     gbvrt26.seq
  67203972     gbvrt27.seq
 249925189     gbvrt3.seq
 249971864     gbvrt4.seq
 108369374     gbvrt5.seq
 249999162     gbvrt6.seq
 249995379     gbvrt7.seq
 249866684     gbvrt8.seq
 249793190     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64023      86300155
BCT10        66         116730258
BCT11        73         110421436
BCT12        116        114824687
BCT13        43         115610209
BCT14        16098      29879523
BCT15        53933      85390803
BCT16        93         110189094
BCT17        151        93915681
BCT18        61         112455059
BCT19        52         112042350
BCT2         7028       108523942
BCT20        46         114233015
BCT21        58         114931588
BCT22        67         111284815
BCT23        36         96325907
BCT24        40         106881287
BCT25        58         105533856
BCT26        74         111675186
BCT27        55         110045255
BCT28        63         106845575
BCT29        55         109391288
BCT3         52         112760544
BCT30        53         108650404
BCT31        46         110496749
BCT32        95         109522868
BCT33        59         110966729
BCT34        67         108616570
BCT35        124        106350090
BCT36        37         71643089
BCT37        200        108779787
BCT38        53         109969009
BCT39        38         108760252
BCT4         56         109240941
BCT40        58         108566760
BCT41        56         107056790
BCT42        45         111019867
BCT43        76         108801182
BCT44        59         105114885
BCT45        45         107106306
BCT46        59         105661869
BCT47        80         110031975
BCT48        76         103598262
BCT49        68         110616305
BCT5         38315      81650251
BCT50        66         105738712
BCT51        49         103628191
BCT52        53         107838942
BCT53        54         106293899
BCT54        66         108084602
BCT55        62         106537062
BCT56        51         108151942
BCT57        61         114343592
BCT58        72         111881349
BCT59        52         106635495
BCT6         39042      82648391
BCT60        55         109631466
BCT61        24         29766607
BCT62        37         108301494
BCT63        51         114579812
BCT64        51         110641147
BCT65        94         115116012
BCT66        87         116727452
BCT67        224        103978750
BCT68        378        79770713
BCT69        1589       2511877
BCT7         5518       94828825
BCT70        3179       5215895
BCT71        6347       7902811
BCT72        12648      15076979
BCT73        25628      27748204
BCT74        50524      54025639
BCT75        76196      77916541
BCT76        71347      77183377
BCT77        9861       94273623
BCT78        5443       100112703
BCT79        3204       106888908
BCT8         13774      81523996
BCT80        38         115045720
BCT81        2906       111081668
BCT82        9382       104505691
BCT83        36434      36376690
BCT84        68473      83704518
BCT85        21460      116768471
BCT86        76018      79077590
BCT87        76898      78787780
BCT88        56583      88457247
BCT89        8707       16032019
BCT9         6838       96099579
ENV1         94157      70620469
ENV10        83206      87346718
ENV11        20753      17759630
ENV12        84731      80836816
ENV13        118374     43043542
ENV14        89191      77243957
ENV15        96516      67725185
ENV16        96174      63451257
ENV17        110608     66897332
ENV18        116009     68435975
ENV19        55188      74519286
ENV2         94588      68178071
ENV20        67984      87506640
ENV21        91110      74607046
ENV22        128245     34579383
ENV23        123050     29085485
ENV24        77951      17879768
ENV25        123125     49854998
ENV26        97612      67850071
ENV27        115923     56090834
ENV28        136462     52689159
ENV29        108233     61860390
ENV3         84870      76331335
ENV30        67628      50497266
ENV31        62536      84995133
ENV32        88979      73398903
ENV33        102630     44139292
ENV34        96840      56263320
ENV35        70682      54665936
ENV36        111348     47246661
ENV37        101239     61328081
ENV38        107377     63802320
ENV39        63529      90706905
ENV4         81825      83753532
ENV40        72612      78784068
ENV41        62033      84252434
ENV42        10676      14557450
ENV43        71796      79120799
ENV44        108689     48868393
ENV45        112195     56839537
ENV46        104940     61108997
ENV47        71208      37730853
ENV48        100296     43940158
ENV49        42748      53871722
ENV5         88276      85772107
ENV50        42393      55126018
ENV51        61118      57433289
ENV52        100749     58836729
ENV53        99224      60906557
ENV54        78157      84056952
ENV55        85400      68747440
ENV6         102003     64851633
ENV7         131426     31030828
ENV8         86281      70412298
ENV9         93252      72994590
EST1         158919     61572670
EST10        167139     71988367
EST100       231728     140759569
EST101       237801     124862161
EST102       190125     104227327
EST103       184379     101957621
EST104       103261     71909704
EST105       160239     119708147
EST106       172277     105508441
EST107       134982     84815980
EST108       64410      24031603
EST109       63776      22431101
EST11        169721     74099220
EST110       64299      23288677
EST111       64315      27069250
EST112       64824      23107445
EST113       65040      24790630
EST114       63924      27180737
EST115       64305      26429609
EST116       64500      27444790
EST117       64330      25257006
EST118       61686      34908256
EST119       143119     68966800
EST12        166645     70031758
EST120       160888     84978304
EST121       176958     92875029
EST122       149343     96402797
EST123       156321     91867642
EST124       120438     78337241
EST125       189413     90793267
EST126       156145     83080662
EST127       157306     84448927
EST128       156483     84633958
EST129       151624     85035499
EST13        73170      35019205
EST130       172887     92812017
EST131       183357     116989628
EST132       202615     102418677
EST133       159032     87132031
EST134       163127     82940607
EST135       142121     83541380
EST136       144981     89677687
EST137       100783     53708840
EST138       173428     97947123
EST139       245172     113120967
EST14        217762     109290584
EST140       154604     83537274
EST141       167336     92309071
EST142       150626     88071169
EST143       133615     81724435
EST144       154277     96721519
EST145       155909     85640307
EST146       124542     63436663
EST147       121488     65223250
EST148       127999     58055303
EST149       127406     51314130
EST15        168655     105349955
EST150       128755     51319039
EST151       114837     42807339
EST152       163817     82670544
EST153       176181     73813138
EST154       162328     110225101
EST155       199962     122662852
EST156       214261     121762969
EST157       175421     97157634
EST158       154757     108204674
EST159       141933     95124899
EST16        179296     112569356
EST160       154695     96138112
EST161       157562     82566102
EST162       139288     78415936
EST163       167588     93187425
EST164       72140      44758761
EST165       150024     91750788
EST166       191856     110266805
EST167       145719     83906641
EST168       142842     72416347
EST169       148917     87011046
EST17        195484     113305036
EST170       190780     104720629
EST171       156407     95939391
EST172       168547     82345406
EST173       125072     86535552
EST174       169942     99561534
EST175       173296     100700285
EST176       122553     68069085
EST177       157101     90321335
EST178       36887      21447512
EST179       169723     102566855
EST18        190689     121250690
EST180       180464     118982955
EST181       143356     116914512
EST182       196498     100138569
EST183       153047     103333944
EST184       154522     101382113
EST185       141221     81639672
EST186       175991     71262570
EST187       150655     84670067
EST188       157789     99613782
EST189       155722     96122423
EST19        159213     114020404
EST190       139680     83099771
EST191       163230     98669848
EST192       145538     93176883
EST193       129268     90353568
EST194       144223     88150140
EST195       135853     88473654
EST196       129805     92785273
EST197       162728     86807149
EST198       173959     95600247
EST199       173380     96534986
EST2         161834     61542584
EST20        186760     99319386
EST200       171666     95206579
EST201       168840     95366744
EST202       171392     95593144
EST203       173219     95038890
EST204       173942     95721578
EST205       26180      14203519
EST206       188671     105136467
EST207       204803     104615997
EST208       172190     101986311
EST209       180084     101649739
EST21        216941     106358784
EST210       201541     123057061
EST211       194262     112145991
EST212       193147     123702308
EST213       157157     103905937
EST214       218808     141912449
EST215       235844     114373628
EST216       146330     103402447
EST217       162283     109338394
EST218       147437     94925068
EST219       177637     98545831
EST22        198878     65987328
EST220       189807     118129067
EST221       111631     87725636
EST222       134719     121245690
EST223       160091     93040853
EST224       148057     95112847
EST225       194896     107670998
EST226       166401     104029401
EST227       134166     92480302
EST228       142052     105266602
EST229       121259     87259918
EST23        140948     40079855
EST230       89564      60495311
EST231       144756     89901526
EST232       132134     93883405
EST233       142363     101348184
EST234       120291     86696241
EST235       125399     84261145
EST236       153462     106153945
EST237       160147     115715857
EST238       118657     122169529
EST239       148257     89260403
EST24        103791     28101789
EST240       183038     118548215
EST241       151183     92542662
EST242       170653     107961119
EST243       166906     121558135
EST244       146756     107297476
EST245       15207      11283307
EST246       155091     99909073
EST247       210601     97235690
EST248       188435     111507702
EST249       151707     87159473
EST25        121292     50795226
EST250       220321     27323623
EST251       221201     90124604
EST252       163550     120656457
EST253       174887     102436142
EST254       161850     107587017
EST255       175548     115323814
EST256       156669     114553096
EST257       100111     54409670
EST258       184698     97080252
EST259       177237     103967491
EST26        213500     97049458
EST260       165698     119891172
EST261       212708     102652858
EST262       271077     118307010
EST263       210856     121524905
EST264       182227     41698625
EST265       243468     111141786
EST266       170359     98312871
EST267       168002     105176770
EST268       93669      58665790
EST269       165524     113939504
EST27        218821     110002855
EST270       198843     103230021
EST271       155496     105949402
EST272       195505     115046936
EST273       197207     50021956
EST274       208525     42270051
EST275       181450     103150334
EST276       169715     114902505
EST277       185967     115664199
EST278       181669     109075674
EST279       156923     101674564
EST28        190222     88557556
EST280       108016     37489039
EST281       143438     86863446
EST282       119048     79228177
EST283       155888     106003528
EST284       246811     37265763
EST285       263884     24184990
EST286       168681     90618179
EST287       167316     109826584
EST288       161011     104208316
EST289       147332     91885738
EST29        158134     68950708
EST290       263250     38100500
EST291       175512     96532760
EST292       66272      49969506
EST293       193918     110576399
EST294       143091     78600748
EST295       182707     119513079
EST296       183812     112244338
EST297       153383     111911082
EST298       191551     106971546
EST299       178091     99988659
EST3         153587     54414675
EST30        171771     69726547
EST300       174360     110359114
EST301       189004     63459702
EST302       187071     68925169
EST303       187624     72914872
EST304       126701     45877615
EST305       191186     89789810
EST306       179959     126342388
EST307       159074     93171886
EST308       155080     90650973
EST309       127508     98608836
EST31        148797     63215044
EST310       148586     98740908
EST311       164316     100202429
EST312       165391     92670857
EST313       171382     103154641
EST314       150012     98425268
EST315       149765     101360164
EST316       164019     107347796
EST317       153293     106108676
EST318       180015     152085522
EST319       173069     113569587
EST32        168204     76007457
EST320       141864     76093338
EST321       143267     97633029
EST322       144940     99524668
EST323       132580     89339481
EST324       149017     99301101
EST325       149370     101464336
EST326       177912     111574766
EST327       151539     83344017
EST328       150623     86430767
EST329       152009     106654162
EST33        173590     66342519
EST330       155605     97750124
EST331       78190      47046178
EST332       142938     90533374
EST333       142785     89580287
EST334       208523     112186140
EST335       131114     72332785
EST336       92124      55354642
EST337       131208     86750698
EST338       137757     87403456
EST339       124459     79399589
EST34        123630     43748008
EST340       163475     85784712
EST341       214584     84217029
EST342       168122     87446104
EST343       173486     104249423
EST344       163053     97361603
EST345       85636      57128214
EST346       132838     88506987
EST347       136171     89007999
EST348       188778     121616312
EST349       156801     96050905
EST35        97392      29902012
EST350       161988     80812428
EST351       186196     130527859
EST352       111720     76416614
EST353       73442      43711500
EST354       140989     78231962
EST355       130268     77824324
EST356       149481     54909609
EST357       158537     32630477
EST358       158527     32642395
EST359       183121     110647129
EST36        97797      30573877
EST360       10250      6991814
EST361       228691     116964140
EST362       250968     114628779
EST363       198095     103873366
EST364       146808     94519207
EST365       136109     87033193
EST366       146552     86974859
EST367       183706     113625571
EST368       225548     78495744
EST369       187723     99984010
EST37        96709      29349638
EST370       213516     119326353
EST371       157578     87421421
EST372       141951     67349447
EST373       205653     122282110
EST374       146226     92870965
EST375       183586     135518404
EST376       181450     141135185
EST377       160974     101687333
EST378       163810     102115724
EST379       185244     109372563
EST38        98626      29830415
EST380       186009     108385342
EST381       203489     108141702
EST382       178879     108266580
EST383       142728     84610036
EST384       187268     125000491
EST385       203697     137424548
EST386       226807     130044242
EST387       202907     136766304
EST388       208703     168554231
EST389       210956     131861759
EST39        99404      31247076
EST390       166979     103696464
EST391       184889     89450447
EST392       168479     13181383
EST393       157194     13613768
EST394       157840     29133329
EST395       2853       614114
EST396       158883     31792957
EST397       158595     32477090
EST398       148173     85844790
EST399       181441     107502464
EST4         170787     67086973
EST40        23403      5963435
EST400       163635     113119579
EST401       166856     97307686
EST402       153768     106201311
EST403       140153     97690172
EST404       145218     96224748
EST405       168402     113796691
EST406       145087     102095438
EST407       173694     102686577
EST408       167866     40683476
EST409       165547     51532130
EST41        101029     52983886
EST410       156956     108554392
EST411       163014     101869502
EST412       164410     107606660
EST413       147013     88313056
EST414       196885     119421467
EST415       148342     101305834
EST416       132948     91230993
EST417       149581     93278217
EST418       156855     94366497
EST419       172239     93195067
EST42        119521     50857311
EST420       164963     97160954
EST421       160486     94146100
EST422       673        304270
EST423       174001     106173030
EST424       141673     88488064
EST425       101906     72734553
EST426       80722      62089908
EST427       102934     68130742
EST428       158252     87358726
EST429       126134     76291358
EST43        165793     91722936
EST430       138720     90884435
EST431       141337     83158336
EST432       163291     96792766
EST433       156136     86128304
EST434       196508     116080345
EST435       126593     85154181
EST436       187356     98955956
EST437       29541      10548709
EST438       186196     98100931
EST439       154065     83939835
EST44        170223     72275932
EST440       167860     97556007
EST441       218392     128256777
EST442       161991     110280228
EST443       168965     102538178
EST444       140160     91992718
EST445       135626     91965412
EST446       176847     77678042
EST447       189332     82280456
EST448       206169     86518307
EST449       173468     73158362
EST45        167188     84798545
EST450       189198     95751169
EST451       179355     105187217
EST452       188896     88917094
EST453       185345     84936426
EST454       211759     121067096
EST455       172982     110361705
EST456       182519     108190694
EST457       202515     118813917
EST458       134492     100187068
EST459       147699     89461489
EST46        168563     86873694
EST460       193608     99577652
EST461       63317      35634708
EST462       156582     86613484
EST463       158704     82744926
EST464       178165     87321226
EST465       168655     59192174
EST466       140747     55007416
EST47        163202     87803502
EST48        162154     83297368
EST49        160118     91074838
EST5         168952     66190553
EST50        161551     88079945
EST51        157123     98918672
EST52        159530     69786594
EST53        145757     81585881
EST54        78248      50659900
EST55        167004     69859769
EST56        164692     74783033
EST57        164330     90722931
EST58        159162     97161813
EST59        156479     101499332
EST6         171459     66908856
EST60        164595     98911060
EST61        160084     108009513
EST62        171075     81433531
EST63        173111     92401904
EST64        155484     84166361
EST65        148901     81874464
EST66        158740     98434651
EST67        136342     77286323
EST68        149420     91681634
EST69        194824     108042916
EST7         169819     72790359
EST70        180871     95053131
EST71        221041     121169337
EST72        185576     110619219
EST73        203840     121313745
EST74        163292     90035123
EST75        134013     61454330
EST76        139681     68743367
EST77        154485     93935567
EST78        157730     100224222
EST79        141898     78481824
EST8         179312     72807406
EST80        53314      24842814
EST81        164056     100445757
EST82        211918     114778154
EST83        223622     123686716
EST84        200498     94290611
EST85        211038     93323964
EST86        162190     92841516
EST87        144113     86867191
EST88        164214     81063373
EST89        158059     79860827
EST9         168640     69363511
EST90        152890     102069413
EST91        152102     88933690
EST92        135245     87208674
EST93        156061     113043996
EST94        142346     104167361
EST95        143182     102384042
EST96        141144     97523162
EST97        147023     80990119
EST98        178711     111264699
EST99        224239     135790483
GSS1         200049     87610619
GSS10        132038     60282099
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167238     128921102
GSS104       149783     82569304
GSS105       191526     120853400
GSS106       167739     112119335
GSS107       197325     115523214
GSS108       204973     134770012
GSS109       209813     138224231
GSS11        137026     73963370
GSS110       207578     140849159
GSS111       206236     142443289
GSS112       205249     143740479
GSS113       205178     143934182
GSS114       202120     146641207
GSS115       182321     139892606
GSS116       18426      10881931
GSS117       132846     84050698
GSS118       169072     79781623
GSS119       184204     79238716
GSS12        147892     75892995
GSS120       170230     148231065
GSS121       177342     120228560
GSS122       180008     146282290
GSS123       187336     120423257
GSS124       187090     139433568
GSS125       192188     127013290
GSS126       191924     93005866
GSS127       167706     156841329
GSS128       163313     113710801
GSS129       62172      37870488
GSS13        145394     68606312
GSS130       171035     155492836
GSS131       172358     154451939
GSS132       172393     155154973
GSS133       173792     154156214
GSS134       171958     154859390
GSS135       181184     139199308
GSS136       178330     146221282
GSS137       166000     119339079
GSS138       190342     95481284
GSS139       265734     40968643
GSS14        169793     84763419
GSS140       265732     40957724
GSS141       78778      12099649
GSS142       254320     58600070
GSS143       260133     56300171
GSS144       191914     86087031
GSS145       196593     66971541
GSS146       186705     148709868
GSS147       182550     151069668
GSS148       168001     155188007
GSS149       171122     157880040
GSS15        161094     97661031
GSS150       235918     71543717
GSS151       227234     80563555
GSS152       135510     55573887
GSS153       178882     71469419
GSS154       78517      48535763
GSS155       87101      63965498
GSS156       83558      62804555
GSS157       103650     48608393
GSS158       68607      58482786
GSS159       7739       7073908
GSS16        172835     87034673
GSS160       68591      57924394
GSS161       69224      56650935
GSS162       69460      56187403
GSS163       71202      55998401
GSS164       68561      51865315
GSS165       75915      58209304
GSS166       87237      74898207
GSS167       81504      44375177
GSS168       92239      44894040
GSS169       63973      47973862
GSS17        183363     113392831
GSS170       77367      61295678
GSS171       69656      58696022
GSS172       67712      62704471
GSS173       61920      53368409
GSS174       95643      42963254
GSS175       21165      4933990
GSS176       112938     70877522
GSS177       822        559311
GSS178       23226      28867035
GSS179       109092     70683886
GSS18        192347     114304499
GSS180       84555      34682016
GSS181       35744      22177639
GSS182       103304     62490220
GSS183       102329     63761256
GSS184       104268     67656826
GSS185       82099      41276456
GSS186       83102      54651503
GSS187       95684      61343347
GSS188       107373     78577773
GSS189       106314     76646515
GSS19        114273     52228513
GSS190       106101     79982459
GSS191       104015     80025091
GSS192       76402      51055333
GSS193       104482     63232426
GSS194       109868     66415305
GSS195       106206     59314004
GSS196       68379      37446316
GSS197       69530      38713112
GSS198       37187      17797457
GSS199       85481      46023427
GSS2         182295     92190515
GSS20        181787     101769657
GSS200       96935      55799967
GSS201       95009      49632000
GSS202       95897      55649530
GSS203       42678      23961360
GSS204       114055     43442995
GSS205       116422     39251295
GSS206       108882     55041759
GSS207       101472     78371349
GSS208       72643      46689469
GSS209       95891      36542252
GSS21        166208     114174113
GSS210       95417      37268709
GSS211       96671      35161518
GSS212       94285      39167432
GSS213       37736      17626556
GSS214       103939     66277823
GSS215       94551      61190929
GSS216       95128      60357048
GSS217       94773      60868501
GSS218       75675      70017159
GSS219       76647      71905251
GSS22        169505     97608334
GSS220       10134      14862506
GSS221       83736      28233267
GSS222       84219      27346468
GSS223       84926      25909272
GSS224       14851      4422302
GSS225       16547      7508221
GSS226       92128      59308050
GSS227       84494      52388719
GSS228       94098      50827589
GSS229       88585      48343496
GSS23        187250     126684076
GSS230       11366      6197879
GSS231       90648      56882510
GSS232       89662      61882079
GSS233       88553      63641206
GSS234       89283      62505584
GSS235       9890       7129098
GSS236       87995      63795538
GSS237       90151      62444409
GSS238       94552      59902397
GSS239       74253      62877141
GSS24        194054     130219272
GSS240       84212      78927630
GSS241       83059      80543045
GSS242       70720      52883996
GSS243       117650     64297121
GSS244       108874     55446727
GSS245       107533     52125503
GSS246       96658      43251344
GSS247       109801     49060015
GSS248       98194      46325477
GSS249       73059      72225597
GSS25        177482     105208945
GSS250       77252      72611065
GSS251       92153      71186606
GSS252       92497      70716768
GSS253       91113      68310278
GSS254       53385      32873257
GSS255       94787      57200301
GSS256       93517      59081345
GSS257       93900      58510429
GSS258       94714      57307691
GSS259       94197      58070562
GSS26        185732     107675520
GSS260       12741      6343956
GSS27        170506     151234083
GSS28        190511     146386306
GSS29        151054     106332306
GSS3         174946     87828983
GSS30        192536     132230345
GSS31        13906      8947947
GSS32        195895     127234153
GSS33        216654     116238131
GSS34        218577     113597712
GSS35        219716     112030658
GSS36        213973     121865192
GSS37        198560     156440039
GSS38        194985     146794861
GSS39        197291     73457394
GSS4         167157     85100788
GSS40        185038     97613049
GSS41        189714     125917418
GSS42        170994     159189605
GSS43        8594       5601792
GSS44        183999     100320381
GSS45        172878     121569559
GSS46        184887     124543257
GSS47        190865     122371435
GSS48        71059      62801344
GSS49        171798     101962849
GSS5         53455      31623154
GSS50        167647     103037071
GSS51        167798     102616250
GSS52        184193     121476304
GSS53        184567     116494932
GSS54        181405     122335974
GSS55        187007     113499944
GSS56        189584     134960167
GSS57        178535     104507484
GSS58        195825     120606407
GSS59        180005     133176132
GSS6         161617     84471320
GSS60        2942       2617861
GSS61        172843     138947742
GSS62        161635     111553216
GSS63        161673     111573033
GSS64        158828     107593228
GSS65        156725     129035036
GSS66        170186     142548970
GSS67        179830     117087269
GSS68        204915     127984702
GSS69        193334     110750279
GSS7         165321     79360873
GSS70        243920     125962415
GSS71        160221     106344582
GSS72        158987     119491159
GSS73        162110     124115907
GSS74        162075     124178387
GSS75        174784     108842816
GSS76        190577     140143222
GSS77        14678      8894629
GSS78        199135     126616367
GSS79        170360     111594897
GSS8         165782     88979534
GSS80        200697     131497570
GSS81        211558     85861841
GSS82        187859     98638965
GSS83        131805     92017452
GSS84        146987     118084732
GSS85        139587     116995274
GSS86        142817     114059806
GSS87        144009     119847617
GSS88        141840     115691511
GSS89        106746     88951103
GSS9         137999     67157719
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        55897      70697619
HTC11        80042      70775818
HTC12        7833       9351822
HTC13        66993      60073171
HTC14        68563      69502858
HTC15        24394      16582662
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         60957      77955151
HTG1         1318       188771164
HTG10        1297       186285876
HTG100       990        189440077
HTG101       996        189331054
HTG102       985        189419172
HTG103       1161       190585510
HTG104       30         4314892
HTG105       1087       189854687
HTG106       1046       189729798
HTG107       1386       191260179
HTG108       1296       190949055
HTG109       1639       191195132
HTG11        9          1245953
HTG110       1337       191968355
HTG111       1314       192036268
HTG112       1362       189911244
HTG113       1058       186003265
HTG114       765        123625687
HTG115       1507       182635389
HTG116       1010       191662213
HTG117       1027       187693809
HTG118       1066       193766406
HTG119       1103       193215949
HTG12        1452       184004673
HTG120       127        24335712
HTG121       1029       189520679
HTG122       1054       192676832
HTG123       1164       192121620
HTG124       1083       192945775
HTG125       1083       192937725
HTG126       590        104030016
HTG127       1122       192576031
HTG128       1080       192404979
HTG129       1078       192326016
HTG13        875        191786413
HTG130       1166       191911933
HTG131       1558       191794330
HTG132       1069       192223091
HTG133       1070       192335254
HTG134       1129       191836509
HTG135       1415       187961138
HTG136       416        55843124
HTG14        753        191921309
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2468       186022324
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2515       185223642
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2549       188262266
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190634433
HTG47        1176       190820695
HTG48        1128       191324694
HTG49        1046       191269623
HTG5         1283       185544093
HTG50        1030       189589096
HTG51        1041       178589404
HTG52        968        190052338
HTG53        1105       190148899
HTG54        1046       190158403
HTG55        1014       189831932
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189903667
HTG6         1273       185016781
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1085       189487801
HTG64        1064       189415560
HTG65        1169       188798107
HTG66        1179       187545797
HTG67        1282       184397923
HTG68        94         12194080
HTG69        1221       185314622
HTG7         1275       185326125
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187688486
HTG73        1019       170126516
HTG74        1118       188293510
HTG75        1103       190775743
HTG76        1135       190789237
HTG77        1182       190871034
HTG78        1096       185997580
HTG79        1171       190202119
HTG8         1459       184462575
HTG80        1115       190063261
HTG81        1213       189874691
HTG82        1120       189645029
HTG83        959        164682536
HTG84        1229       188409093
HTG85        1250       187741728
HTG86        1141       189879061
HTG87        1144       189686641
HTG88        978        167870813
HTG89        1182       189961005
HTG9         1200       186951993
HTG90        1104       190233697
HTG91        1146       190217975
HTG92        1109       190471215
HTG93        961        159222190
HTG94        1056       190754252
HTG95        1160       191011164
HTG96        1031       189156227
HTG97        1071       189497493
HTG98        684        127508859
HTG99        1018       189641315
INV1         93710      48149379
INV10        57048      86472222
INV11        82660      65190288
INV12        60564      47658135
INV13        84615      65948455
INV14        80807      66814741
INV15        78786      66598902
INV16        47728      45596844
INV17        28422      113216941
INV18        8395       143017433
INV19        42693      111932587
INV2         25604      148242029
INV20        77321      56389462
INV21        73088      62436200
INV22        2196       1432329
INV23        21065      125978647
INV24        6          133712559
INV25        53828      99132549
INV26        78385      53587131
INV27        29140      21582111
INV28        79195      57182614
INV29        77372      59761206
INV3         1669       170114785
INV30        73007      55005776
INV31        75565      55008510
INV32        21268      62908891
INV4         3854       133939858
INV5         78656      73294037
INV6         55791      94943908
INV7         52827      88207534
INV8         7704       8078752
INV9         80302      71524112
MAM1         15978      161631160
MAM2         19601      157960796
MAM3         59191      82318171
MAM4         7677       184681986
MAM5         79456      74653477
MAM6         49982      123699146
MAM7         73556      63393653
MAM8         14721      14698483
PAT1         222551     70117059
PAT10        124441     102578063
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224730     34113420
PAT109       250080     15844360
PAT11        98661      64110448
PAT110       180676     63661713
PAT111       51652      26061632
PAT112       114176     110461877
PAT113       137694     83273592
PAT114       164178     99338868
PAT115       158860     103334939
PAT116       137435     114993907
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142059     62828666
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105889     59875047
PAT130       44618      171217879
PAT131       9167       47581637
PAT132       33645      178334734
PAT133       153558     109675196
PAT134       178705     90913377
PAT135       136049     115324159
PAT136       120392     123342367
PAT137       8527       8992390
PAT138       155429     101473147
PAT139       184764     88815933
PAT14        103639     50158899
PAT140       182409     85292093
PAT141       174403     93928365
PAT142       125174     122942590
PAT143       75688      7342969
PAT144       203662     47737230
PAT145       277828     9627968
PAT146       220409     46465135
PAT147       106719     2881142
PAT148       270386     21672571
PAT149       186749     61237793
PAT15        121136     53309242
PAT150       109797     106057638
PAT151       47522      9551625
PAT152       87296      88239857
PAT153       78456      95569971
PAT154       145126     77720617
PAT155       167516     71362939
PAT156       121462     92949984
PAT157       103016     85343211
PAT158       165600     46071419
PAT159       270022     5130418
PAT16        113129     61271009
PAT160       269978     5129582
PAT161       269978     5129582
PAT162       237888     4519872
PAT163       269396     5118524
PAT164       235479     25574351
PAT165       203725     47154834
PAT166       12043      422907
PAT167       165317     74871979
PAT168       91686      126656173
PAT169       172585     71662774
PAT17        39187      16248324
PAT170       137841     72230790
PAT171       9556       14012460
PAT172       93111      87244841
PAT173       91680      79829497
PAT174       83213      91466816
PAT175       109148     53718640
PAT176       119767     63745357
PAT177       156331     19195880
PAT178       77192      19195381
PAT179       86862      129980830
PAT18        146771     52594264
PAT180       159196     78756411
PAT181       211906     48209823
PAT182       93359      41229190
PAT19        153705     78039102
PAT2         194513     84656825
PAT20        104751     118096823
PAT21        133743     95365390
PAT22        84649      79535519
PAT23        123507     103387008
PAT24        119471     105674778
PAT25        145424     86657649
PAT26        175151     64309592
PAT27        71447      1786175
PAT28        102171     77387698
PAT29        93951      87640330
PAT3         171983     95896583
PAT30        119941     61674794
PAT31        96634      78969836
PAT32        128390     55023697
PAT33        92223      51126479
PAT34        111296     78150585
PAT35        138098     29120154
PAT36        158504     24081221
PAT37        114675     49019980
PAT38        44875      54580173
PAT39        95732      83191686
PAT4         153749     106054879
PAT40        100232     70984798
PAT41        136205     39303239
PAT42        143773     35446818
PAT43        123732     64730827
PAT44        104362     81213845
PAT45        93445      74211542
PAT46        113254     66591441
PAT47        65219      54831918
PAT48        135192     108000182
PAT49        167081     97031566
PAT5         57141      23924741
PAT50        116396     127556602
PAT51        196341     76723288
PAT52        80306      127991232
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92802      89391390
PAT59        106504     74790004
PAT6         170642     91909261
PAT60        122362     64031281
PAT61        67447      30302020
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154764     88226846
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131220     96904061
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94632      88056898
PAT83        93686      93467861
PAT84        34076      33981506
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164895     19209843
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129357     101143197
PAT90        175305     3330795
PAT91        101394     1926486
PAT92        169171     12412246
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140780     2674820
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6612       84079451
PLN1         59896      93463967
PLN10        73057      75862628
PLN11        37374      49291780
PLN12        40287      65712463
PLN13        22488      123975100
PLN14        21103      99490647
PLN15        17566      144768265
PLN16        17622      146203357
PLN17        17550      146317118
PLN18        24673      128747914
PLN19        5999       149130224
PLN2         46958      106863009
PLN20        1268       170558125
PLN21        13938      156108673
PLN22        7326       8521642
PLN23        67246      69729753
PLN24        29382      31604637
PLN25        76931      76348053
PLN26        64744      80336917
PLN27        61754      100526505
PLN28        76         95744252
PLN29        3          61743175
PLN3         1367       174788753
PLN30        866        124507183
PLN31        19553      133482252
PLN32        19176      132662782
PLN33        77514      74519103
PLN34        94760      61452074
PLN35        39858      32525301
PLN36        80354      71636537
PLN37        77840      75856665
PLN38        80049      70452091
PLN39        82072      75441565
PLN4         1794       185164686
PLN40        58133      31952345
PLN41        98608      55062825
PLN42        82013      68933542
PLN43        45870      98596344
PLN44        19079      132069325
PLN45        30914      126696382
PLN46        62182      69901826
PLN47        81434      72239467
PLN48        63214      82386801
PLN49        36777      105085915
PLN5         1880       193606194
PLN50        84332      64098423
PLN51        89151      54717621
PLN52        76991      72433985
PLN53        71094      84124899
PLN54        76372      69165597
PLN55        72636      73945135
PLN56        77682      65426818
PLN57        50862      84034703
PLN6         1692       194502170
PLN7         1501       179946925
PLN8         72249      84219303
PLN9         26119      24786392
PRI1         23018      59654044
PRI10        1272       179395210
PRI11        778        94342363
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193666240
PRI18        1099       194310776
PRI19        1166       193657185
PRI2         18509      149121371
PRI20        1737       191818169
PRI21        2646       189795035
PRI22        11045      175339288
PRI23        9906       22933121
PRI24        31572      84615190
PRI25        61951      78207697
PRI26        31350      70628098
PRI27        8521       161801360
PRI28        2251       180645625
PRI29        1618       181509288
PRI3         1432       175165681
PRI30        2007       181705860
PRI31        1957       180697490
PRI32        13185      156514786
PRI33        1328       183749995
PRI34        41218      106774346
PRI35        23502      34414975
PRI36        32189      63608729
PRI37        20152      117784920
PRI38        18563      147331908
PRI39        66684      86887520
PRI4         1282       185548571
PRI40        49543      89484398
PRI41        40247      74813579
PRI42        45355      95623522
PRI43        18497      108336501
PRI44        72365      79705815
PRI45        5561       39071238
PRI5         1325       184269325
PRI6         1180       179951778
PRI7         1245       180985147
PRI8         1213       178408437
PRI9         1367       174689932
ROD1         33125      139383708
ROD10        989        181485158
ROD11        240        45576056
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1189       190422909
ROD19        16774      155343582
ROD2         916        175542994
ROD20        20349      148361192
ROD21        1132       182075942
ROD22        1079       168189648
ROD23        12240      164895229
ROD24        39630      69427578
ROD25        22367      102345594
ROD26        1533       187689982
ROD27        131995     39944399
ROD28        85506      70248737
ROD29        61801      66168542
ROD3         905        173326813
ROD4         901        173780081
ROD5         920        174266650
ROD6         966        178082195
ROD7         970        179708672
ROD8         979        181294026
ROD9         993        181869376
STS1         85257      36750501
STS10        57907      44420267
STS11        48910      37503235
STS12        57924      43637361
STS13        64283      42850336
STS14        93614      34186498
STS15        104286     26517058
STS16        10109      2739230
STS17        103611     27476228
STS18        86926      34447437
STS19        99725      33367017
STS2         84327      49855709
STS20        54963      21020152
STS3         66836      26359108
STS4         77030      36944377
STS5         8484       4973721
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55716      37767321
SYN1         42743      77285482
SYN2         49429      68017951
SYN3         11333      159477453
SYN4         4599       176561065
SYN5         4596       176482713
SYN6         4600       176575084
SYN7         6114       93800290
TSA1         119977     38112352
TSA10        12846      14458686
TSA11        104981     27321556
TSA12        63093      36049176
TSA13        78048      76369363
TSA14        108605     44529741
TSA15        114370     41370569
TSA16        85951      70204975
TSA17        120164     38802704
TSA18        134981     34131922
TSA19        61572      79385070
TSA2         113082     41399259
TSA20        41183      55937127
TSA21        70040      97061853
TSA22        99950      57210299
TSA23        110053     52104020
TSA24        103102     51799165
TSA25        101858     53620884
TSA26        101686     46128771
TSA27        13589      8598813
TSA28        66220      59270523
TSA29        92710      68066368
TSA3         109975     40913799
TSA30        91369      64643058
TSA31        78775      86284206
TSA32        103058     45918331
TSA33        113025     34990868
TSA34        93746      70323871
TSA35        1570       1101186
TSA36        94687      35571775
TSA37        78654      36313539
TSA38        109342     44676214
TSA39        116438     47145157
TSA4         110065     45516394
TSA40        22607      16956112
TSA41        105982     50234310
TSA42        100521     54488647
TSA43        89586      68305082
TSA44        90610      73541586
TSA45        35029      10846458
TSA46        90399      71322568
TSA47        97546      54457852
TSA48        62949      108079873
TSA49        89272      78140782
TSA5         45429      11644788
TSA50        88125      65246302
TSA51        86194      67762175
TSA52        77217      79589707
TSA53        42625      64548218
TSA54        90659      66659366
TSA55        75915      84448762
TSA56        75448      75795718
TSA57        70815      62253595
TSA58        86796      78390657
TSA59        83918      82050306
TSA6         111608     58989548
TSA60        64105      89501542
TSA61        83190      73972725
TSA62        94586      46478070
TSA63        93415      57217802
TSA64        81911      61986266
TSA65        91953      75378690
TSA66        97253      73901722
TSA67        86288      55661177
TSA68        102410     54948021
TSA69        109335     48669792
TSA7         95472      65433174
TSA70        77363      90687544
TSA71        90364      68959254
TSA72        90310      46987101
TSA73        94723      53136584
TSA74        80183      75233809
TSA75        55304      68873319
TSA76        70124      113089686
TSA77        91984      73409780
TSA78        113387     56477169
TSA79        109216     52543226
TSA8         105034     69035742
TSA80        109175     49378845
TSA81        67049      70014304
TSA82        80457      88837063
TSA83        72637      76131544
TSA84        55393      121084573
TSA85        72977      66848466
TSA86        85239      74155317
TSA87        87966      67478305
TSA88        91304      52572550
TSA89        59408      54656946
TSA9         106293     63251904
TSA90        64087      65481741
TSA91        62776      67314514
TSA92        62796      68082050
TSA93        83597      81259826
TSA94        80901      66046271
TSA95        75665      66697134
TSA96        73587      59631026
UNA1         244        127803
VRL1         67819      69199598
VRL10        66738      68567372
VRL11        49390      65674528
VRL12        62819      71064019
VRL13        57371      72799083
VRL14        63326      65125364
VRL15        56728      73407772
VRL16        36770      44669912
VRL17        54785      72424401
VRL18        59298      71187763
VRL19        55608      73671167
VRL2         72972      64641902
VRL20        54790      74370012
VRL21        62647      65277634
VRL3         70178      60497453
VRL4         68648      69687853
VRL5         51283      53659358
VRL6         48168      77535236
VRL7         46998      72885417
VRL8         61320      69810929
VRL9         61020      73308013
VRT1         43702      119977451
VRT10        1256       189217442
VRT11        8274       177839690
VRT12        3993       136596069
VRT13        13101      170790688
VRT14        5342       182610424
VRT15        3936       186026494
VRT16        37577      134621116
VRT17        79791      68463908
VRT18        78225      66383592
VRT19        31070      25053068
VRT2         1137       194215832
VRT20        71383      77240698
VRT21        46664      121689262
VRT22        77673      63084785
VRT23        78653      62390793
VRT24        80480      57399744
VRT25        103986     65739951
VRT26        83768      54308649
VRT27        20789      18856424
VRT3         72618      78162527
VRT4         8284       172139250
VRT5         31530      31398001
VRT6         73014      66723456
VRT7         31769      63581671
VRT8         30614      112215697
VRT9         1201       189867913

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 191.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

20031278 16310774187   Homo sapiens
9697507   9974977889   Mus musculus
2188117   6521253272   Rattus norvegicus
2200915   5386258455   Bos taurus
3934412   5062731057   Zea mays
3286633   4887861860   Sus scrofa
1722826   3120857462   Danio rerio
257584    1435236534   Strongylocentrotus purpuratus
453167    1256203101   Macaca mulatta
1348553   1255686573   Oryza sativa Japonica Group
1588278   1249938611   Xenopus (Silurana) tropicalis
1774357   1197357811   Nicotiana tabacum
2329786   1144226616   Arabidopsis thaliana
1253074   1119965220   Drosophila melanogaster
216613    1008323292   Pan troglodytes
766851     999010073   Vitis vinifera
1455863    951238343   Canis lupus familiaris
1902878    906638854   Glycine max
815360     899631338   Gallus gallus
1426899    898689329   Triticum aestivum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2010

                NCBI-GenBank Flat File Release 191.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         June 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 191.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
	Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Ilya Dondoshansky, WonHee Jang, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Jim Ostell, Denis Sinyakov, Karl Sirotkin,
	Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
	Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center