Release Notes For GenBank Release 191
GBREL.TXT Genetic Sequence Data Bank
August 15 2012
NCBI-GenBank Flat File Release 191.0
Distribution Release Notes
156424033 loci, 143081765233 bases, from 156424033 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 191.0
1.2 Cutoff Date
1.3 Important Changes in Release 191.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 191.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
E-MAIL: update@ncbi.nlm.nih.gov
URL for GenBank's web-based submission tool (BankIt) :
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 191.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 191.0, incorporates data available to the collaborating
databases as of August 13, 2012 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 191.0
1.3.1 Organizational changes
The total number of sequence data files increased by 25 with this release:
- the BCT division is now composed of 89 files (+1)
- the CON division is now composed of 172 files (+3)
- the ENV division is now composed of 55 files (+1)
- the EST division is now composed of 466 files (+2)
- the GSS division is now composed of 260 files (+4)
- the INV division is now composed of 32 files (+1)
- the PAT division is now composed of 182 files (+2)
- the TSA division is now composed of 96 files (+10)
- the VRT division is now composed of 27 files (+1)
The total number of 'index' files increased by 3 with this release:
- the AUT (author name) index is now composed of 101 files (+2)
- the KEY (keyword) index is now composed of 7 files (+1)
1.3.2 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
info@ncbi.nlm.nih.gov
Our apologies for any inconvenience that these changes may cause.
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
106 of the GSS flatfiles in Release 191.0. Consider gbgss155.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
August 15 2012
NCBI-GenBank Flat File Release 191.0
GSS Sequences (Part 1)
87101 loci, 63965498 bases, from 87101 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "155" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New qualifier : /altitude
Altitude information is an important component of an accurate environmental
sample description (see related qualifiers /lat_lon and /collection_date).
To capture altitude data, a new source-feature qualifier will be legal as of
October 15 2012 (GenBank 192.0) :
Qualifier /altitude=
Definition geographical altitude of the location from which the sample
was collected
Value format "text"
Example /altitude="-256 m."
/altitude="330.12 m."
Cardinality 1
Comment Values indicate altitudes above or below nominal sea level
provided in metres
1.4.2 Modification of the /anticodon qualifier
As of the October 15 2012 GenBank Release 192.0, the /anticodon qualifier
of tRNA features will be modified to include the sequence of the anticodon:
Qualifier /anticodon=
Definition location of the anticodon of tRNA and the amino acid for which
it codes
Value format (pos:<location>,aa:<amino_acid>,seq:<text>) where location
is the position of the anticodon, amino_acid is the
abbreviation for the amino acid encoded and seq is the
sequence of the anticodon
Example /anticodon=(pos:34..36,aa:Phe,seq:aaa)
/anticodon=(pos:join(5,495..496),aa:Leu,seq:taa)
/anticodon=(pos:complement(4156..4158),aa:Gln,seq:ttg)
Currently, only the 'pos' and 'aa' elements are supported. The addition
of 'seq' should make it more convenient for database users to process
tRNA features: It will no longer be necessary to analyze the 'pos' element
in order to obtain the anticodon sequence.
1.4.3 Expansion of the /linkage_evidence controlled vocabulary
Genome centers sometimes have knowledge from PCR evidence that two contigs
are linked, and thus should be part of a CON-division/scaffold record, however
none of the values in the linkage_evidence controlled vocabulary are appropriate.
So, also as of GenBank Release 192.0 in October 2012, the value "pcr" will
be legal for the /linkage_evidence qualifier:
Qualifier /linkage_evidence=
Value format "paired-ends", "align genus", "align xgenus", "align trnscpt",
"within clone", "clone contig", "map", "strobe", "pcr", and
"unspecified"
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1852 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut100.idx - Index of the entries according to author name, part 100.
7. gbaut101.idx - Index of the entries according to author name, part 101.
8. gbaut11.idx - Index of the entries according to author name, part 11.
9. gbaut12.idx - Index of the entries according to author name, part 12.
10. gbaut13.idx - Index of the entries according to author name, part 13.
11. gbaut14.idx - Index of the entries according to author name, part 14.
12. gbaut15.idx - Index of the entries according to author name, part 15.
13. gbaut16.idx - Index of the entries according to author name, part 16.
14. gbaut17.idx - Index of the entries according to author name, part 17.
15. gbaut18.idx - Index of the entries according to author name, part 18.
16. gbaut19.idx - Index of the entries according to author name, part 19.
17. gbaut2.idx - Index of the entries according to author name, part 2.
18. gbaut20.idx - Index of the entries according to author name, part 20.
19. gbaut21.idx - Index of the entries according to author name, part 21.
20. gbaut22.idx - Index of the entries according to author name, part 22.
21. gbaut23.idx - Index of the entries according to author name, part 23.
22. gbaut24.idx - Index of the entries according to author name, part 24.
23. gbaut25.idx - Index of the entries according to author name, part 25.
24. gbaut26.idx - Index of the entries according to author name, part 26.
25. gbaut27.idx - Index of the entries according to author name, part 27.
26. gbaut28.idx - Index of the entries according to author name, part 28.
27. gbaut29.idx - Index of the entries according to author name, part 29.
28. gbaut3.idx - Index of the entries according to author name, part 3.
29. gbaut30.idx - Index of the entries according to author name, part 30.
30. gbaut31.idx - Index of the entries according to author name, part 31.
31. gbaut32.idx - Index of the entries according to author name, part 32.
32. gbaut33.idx - Index of the entries according to author name, part 33.
33. gbaut34.idx - Index of the entries according to author name, part 34.
34. gbaut35.idx - Index of the entries according to author name, part 35.
35. gbaut36.idx - Index of the entries according to author name, part 36.
36. gbaut37.idx - Index of the entries according to author name, part 37.
37. gbaut38.idx - Index of the entries according to author name, part 38.
38. gbaut39.idx - Index of the entries according to author name, part 39.
39. gbaut4.idx - Index of the entries according to author name, part 4.
40. gbaut40.idx - Index of the entries according to author name, part 40.
41. gbaut41.idx - Index of the entries according to author name, part 41.
42. gbaut42.idx - Index of the entries according to author name, part 42.
43. gbaut43.idx - Index of the entries according to author name, part 43.
44. gbaut44.idx - Index of the entries according to author name, part 44.
45. gbaut45.idx - Index of the entries according to author name, part 45.
46. gbaut46.idx - Index of the entries according to author name, part 46.
47. gbaut47.idx - Index of the entries according to author name, part 47.
48. gbaut48.idx - Index of the entries according to author name, part 48.
49. gbaut49.idx - Index of the entries according to author name, part 49.
50. gbaut5.idx - Index of the entries according to author name, part 5.
51. gbaut50.idx - Index of the entries according to author name, part 50.
52. gbaut51.idx - Index of the entries according to author name, part 51.
53. gbaut52.idx - Index of the entries according to author name, part 52.
54. gbaut53.idx - Index of the entries according to author name, part 53.
55. gbaut54.idx - Index of the entries according to author name, part 54.
56. gbaut55.idx - Index of the entries according to author name, part 55.
57. gbaut56.idx - Index of the entries according to author name, part 56.
58. gbaut57.idx - Index of the entries according to author name, part 57.
59. gbaut58.idx - Index of the entries according to author name, part 58.
60. gbaut59.idx - Index of the entries according to author name, part 59.
61. gbaut6.idx - Index of the entries according to author name, part 6.
62. gbaut60.idx - Index of the entries according to author name, part 60.
63. gbaut61.idx - Index of the entries according to author name, part 61.
64. gbaut62.idx - Index of the entries according to author name, part 62.
65. gbaut63.idx - Index of the entries according to author name, part 63.
66. gbaut64.idx - Index of the entries according to author name, part 64.
67. gbaut65.idx - Index of the entries according to author name, part 65.
68. gbaut66.idx - Index of the entries according to author name, part 66.
69. gbaut67.idx - Index of the entries according to author name, part 67.
70. gbaut68.idx - Index of the entries according to author name, part 68.
71. gbaut69.idx - Index of the entries according to author name, part 69.
72. gbaut7.idx - Index of the entries according to author name, part 7.
73. gbaut70.idx - Index of the entries according to author name, part 70.
74. gbaut71.idx - Index of the entries according to author name, part 71.
75. gbaut72.idx - Index of the entries according to author name, part 72.
76. gbaut73.idx - Index of the entries according to author name, part 73.
77. gbaut74.idx - Index of the entries according to author name, part 74.
78. gbaut75.idx - Index of the entries according to author name, part 75.
79. gbaut76.idx - Index of the entries according to author name, part 76.
80. gbaut77.idx - Index of the entries according to author name, part 77.
81. gbaut78.idx - Index of the entries according to author name, part 78.
82. gbaut79.idx - Index of the entries according to author name, part 79.
83. gbaut8.idx - Index of the entries according to author name, part 8.
84. gbaut80.idx - Index of the entries according to author name, part 80.
85. gbaut81.idx - Index of the entries according to author name, part 81.
86. gbaut82.idx - Index of the entries according to author name, part 82.
87. gbaut83.idx - Index of the entries according to author name, part 83.
88. gbaut84.idx - Index of the entries according to author name, part 84.
89. gbaut85.idx - Index of the entries according to author name, part 85.
90. gbaut86.idx - Index of the entries according to author name, part 86.
91. gbaut87.idx - Index of the entries according to author name, part 87.
92. gbaut88.idx - Index of the entries according to author name, part 88.
93. gbaut89.idx - Index of the entries according to author name, part 89.
94. gbaut9.idx - Index of the entries according to author name, part 9.
95. gbaut90.idx - Index of the entries according to author name, part 90.
96. gbaut91.idx - Index of the entries according to author name, part 91.
97. gbaut92.idx - Index of the entries according to author name, part 92.
98. gbaut93.idx - Index of the entries according to author name, part 93.
99. gbaut94.idx - Index of the entries according to author name, part 94.
100. gbaut95.idx - Index of the entries according to author name, part 95.
101. gbaut96.idx - Index of the entries according to author name, part 96.
102. gbaut97.idx - Index of the entries according to author name, part 97.
103. gbaut98.idx - Index of the entries according to author name, part 98.
104. gbaut99.idx - Index of the entries according to author name, part 99.
105. gbbct1.seq - Bacterial sequence entries, part 1.
106. gbbct10.seq - Bacterial sequence entries, part 10.
107. gbbct11.seq - Bacterial sequence entries, part 11.
108. gbbct12.seq - Bacterial sequence entries, part 12.
109. gbbct13.seq - Bacterial sequence entries, part 13.
110. gbbct14.seq - Bacterial sequence entries, part 14.
111. gbbct15.seq - Bacterial sequence entries, part 15.
112. gbbct16.seq - Bacterial sequence entries, part 16.
113. gbbct17.seq - Bacterial sequence entries, part 17.
114. gbbct18.seq - Bacterial sequence entries, part 18.
115. gbbct19.seq - Bacterial sequence entries, part 19.
116. gbbct2.seq - Bacterial sequence entries, part 2.
117. gbbct20.seq - Bacterial sequence entries, part 20.
118. gbbct21.seq - Bacterial sequence entries, part 21.
119. gbbct22.seq - Bacterial sequence entries, part 22.
120. gbbct23.seq - Bacterial sequence entries, part 23.
121. gbbct24.seq - Bacterial sequence entries, part 24.
122. gbbct25.seq - Bacterial sequence entries, part 25.
123. gbbct26.seq - Bacterial sequence entries, part 26.
124. gbbct27.seq - Bacterial sequence entries, part 27.
125. gbbct28.seq - Bacterial sequence entries, part 28.
126. gbbct29.seq - Bacterial sequence entries, part 29.
127. gbbct3.seq - Bacterial sequence entries, part 3.
128. gbbct30.seq - Bacterial sequence entries, part 30.
129. gbbct31.seq - Bacterial sequence entries, part 31.
130. gbbct32.seq - Bacterial sequence entries, part 32.
131. gbbct33.seq - Bacterial sequence entries, part 33.
132. gbbct34.seq - Bacterial sequence entries, part 34.
133. gbbct35.seq - Bacterial sequence entries, part 35.
134. gbbct36.seq - Bacterial sequence entries, part 36.
135. gbbct37.seq - Bacterial sequence entries, part 37.
136. gbbct38.seq - Bacterial sequence entries, part 38.
137. gbbct39.seq - Bacterial sequence entries, part 39.
138. gbbct4.seq - Bacterial sequence entries, part 4.
139. gbbct40.seq - Bacterial sequence entries, part 40.
140. gbbct41.seq - Bacterial sequence entries, part 41.
141. gbbct42.seq - Bacterial sequence entries, part 42.
142. gbbct43.seq - Bacterial sequence entries, part 43.
143. gbbct44.seq - Bacterial sequence entries, part 44.
144. gbbct45.seq - Bacterial sequence entries, part 45.
145. gbbct46.seq - Bacterial sequence entries, part 46.
146. gbbct47.seq - Bacterial sequence entries, part 47.
147. gbbct48.seq - Bacterial sequence entries, part 48.
148. gbbct49.seq - Bacterial sequence entries, part 49.
149. gbbct5.seq - Bacterial sequence entries, part 5.
150. gbbct50.seq - Bacterial sequence entries, part 50.
151. gbbct51.seq - Bacterial sequence entries, part 51.
152. gbbct52.seq - Bacterial sequence entries, part 52.
153. gbbct53.seq - Bacterial sequence entries, part 53.
154. gbbct54.seq - Bacterial sequence entries, part 54.
155. gbbct55.seq - Bacterial sequence entries, part 55.
156. gbbct56.seq - Bacterial sequence entries, part 56.
157. gbbct57.seq - Bacterial sequence entries, part 57.
158. gbbct58.seq - Bacterial sequence entries, part 58.
159. gbbct59.seq - Bacterial sequence entries, part 59.
160. gbbct6.seq - Bacterial sequence entries, part 6.
161. gbbct60.seq - Bacterial sequence entries, part 60.
162. gbbct61.seq - Bacterial sequence entries, part 61.
163. gbbct62.seq - Bacterial sequence entries, part 62.
164. gbbct63.seq - Bacterial sequence entries, part 63.
165. gbbct64.seq - Bacterial sequence entries, part 64.
166. gbbct65.seq - Bacterial sequence entries, part 65.
167. gbbct66.seq - Bacterial sequence entries, part 66.
168. gbbct67.seq - Bacterial sequence entries, part 67.
169. gbbct68.seq - Bacterial sequence entries, part 68.
170. gbbct69.seq - Bacterial sequence entries, part 69.
171. gbbct7.seq - Bacterial sequence entries, part 7.
172. gbbct70.seq - Bacterial sequence entries, part 70.
173. gbbct71.seq - Bacterial sequence entries, part 71.
174. gbbct72.seq - Bacterial sequence entries, part 72.
175. gbbct73.seq - Bacterial sequence entries, part 73.
176. gbbct74.seq - Bacterial sequence entries, part 74.
177. gbbct75.seq - Bacterial sequence entries, part 75.
178. gbbct76.seq - Bacterial sequence entries, part 76.
179. gbbct77.seq - Bacterial sequence entries, part 77.
180. gbbct78.seq - Bacterial sequence entries, part 78.
181. gbbct79.seq - Bacterial sequence entries, part 79.
182. gbbct8.seq - Bacterial sequence entries, part 8.
183. gbbct80.seq - Bacterial sequence entries, part 80.
184. gbbct81.seq - Bacterial sequence entries, part 81.
185. gbbct82.seq - Bacterial sequence entries, part 82.
186. gbbct83.seq - Bacterial sequence entries, part 83.
187. gbbct84.seq - Bacterial sequence entries, part 84.
188. gbbct85.seq - Bacterial sequence entries, part 85.
189. gbbct86.seq - Bacterial sequence entries, part 86.
190. gbbct87.seq - Bacterial sequence entries, part 87.
191. gbbct88.seq - Bacterial sequence entries, part 88.
192. gbbct89.seq - Bacterial sequence entries, part 89.
193. gbbct9.seq - Bacterial sequence entries, part 9.
194. gbchg.txt - Accession numbers of entries updated since the previous release.
195. gbcon1.seq - Constructed sequence entries, part 1.
196. gbcon10.seq - Constructed sequence entries, part 10.
197. gbcon100.seq - Constructed sequence entries, part 100.
198. gbcon101.seq - Constructed sequence entries, part 101.
199. gbcon102.seq - Constructed sequence entries, part 102.
200. gbcon103.seq - Constructed sequence entries, part 103.
201. gbcon104.seq - Constructed sequence entries, part 104.
202. gbcon105.seq - Constructed sequence entries, part 105.
203. gbcon106.seq - Constructed sequence entries, part 106.
204. gbcon107.seq - Constructed sequence entries, part 107.
205. gbcon108.seq - Constructed sequence entries, part 108.
206. gbcon109.seq - Constructed sequence entries, part 109.
207. gbcon11.seq - Constructed sequence entries, part 11.
208. gbcon110.seq - Constructed sequence entries, part 110.
209. gbcon111.seq - Constructed sequence entries, part 111.
210. gbcon112.seq - Constructed sequence entries, part 112.
211. gbcon113.seq - Constructed sequence entries, part 113.
212. gbcon114.seq - Constructed sequence entries, part 114.
213. gbcon115.seq - Constructed sequence entries, part 115.
214. gbcon116.seq - Constructed sequence entries, part 116.
215. gbcon117.seq - Constructed sequence entries, part 117.
216. gbcon118.seq - Constructed sequence entries, part 118.
217. gbcon119.seq - Constructed sequence entries, part 119.
218. gbcon12.seq - Constructed sequence entries, part 12.
219. gbcon120.seq - Constructed sequence entries, part 120.
220. gbcon121.seq - Constructed sequence entries, part 121.
221. gbcon122.seq - Constructed sequence entries, part 122.
222. gbcon123.seq - Constructed sequence entries, part 123.
223. gbcon124.seq - Constructed sequence entries, part 124.
224. gbcon125.seq - Constructed sequence entries, part 125.
225. gbcon126.seq - Constructed sequence entries, part 126.
226. gbcon127.seq - Constructed sequence entries, part 127.
227. gbcon128.seq - Constructed sequence entries, part 128.
228. gbcon129.seq - Constructed sequence entries, part 129.
229. gbcon13.seq - Constructed sequence entries, part 13.
230. gbcon130.seq - Constructed sequence entries, part 130.
231. gbcon131.seq - Constructed sequence entries, part 131.
232. gbcon132.seq - Constructed sequence entries, part 132.
233. gbcon133.seq - Constructed sequence entries, part 133.
234. gbcon134.seq - Constructed sequence entries, part 134.
235. gbcon135.seq - Constructed sequence entries, part 135.
236. gbcon136.seq - Constructed sequence entries, part 136.
237. gbcon137.seq - Constructed sequence entries, part 137.
238. gbcon138.seq - Constructed sequence entries, part 138.
239. gbcon139.seq - Constructed sequence entries, part 139.
240. gbcon14.seq - Constructed sequence entries, part 14.
241. gbcon140.seq - Constructed sequence entries, part 140.
242. gbcon141.seq - Constructed sequence entries, part 141.
243. gbcon142.seq - Constructed sequence entries, part 142.
244. gbcon143.seq - Constructed sequence entries, part 143.
245. gbcon144.seq - Constructed sequence entries, part 144.
246. gbcon145.seq - Constructed sequence entries, part 145.
247. gbcon146.seq - Constructed sequence entries, part 146.
248. gbcon147.seq - Constructed sequence entries, part 147.
249. gbcon148.seq - Constructed sequence entries, part 148.
250. gbcon149.seq - Constructed sequence entries, part 149.
251. gbcon15.seq - Constructed sequence entries, part 15.
252. gbcon150.seq - Constructed sequence entries, part 150.
253. gbcon151.seq - Constructed sequence entries, part 151.
254. gbcon152.seq - Constructed sequence entries, part 152.
255. gbcon153.seq - Constructed sequence entries, part 153.
256. gbcon154.seq - Constructed sequence entries, part 154.
257. gbcon155.seq - Constructed sequence entries, part 155.
258. gbcon156.seq - Constructed sequence entries, part 156.
259. gbcon157.seq - Constructed sequence entries, part 157.
260. gbcon158.seq - Constructed sequence entries, part 158.
261. gbcon159.seq - Constructed sequence entries, part 159.
262. gbcon16.seq - Constructed sequence entries, part 16.
263. gbcon160.seq - Constructed sequence entries, part 160.
264. gbcon161.seq - Constructed sequence entries, part 161.
265. gbcon162.seq - Constructed sequence entries, part 162.
266. gbcon163.seq - Constructed sequence entries, part 163.
267. gbcon164.seq - Constructed sequence entries, part 164.
268. gbcon165.seq - Constructed sequence entries, part 165.
269. gbcon166.seq - Constructed sequence entries, part 166.
270. gbcon167.seq - Constructed sequence entries, part 167.
271. gbcon168.seq - Constructed sequence entries, part 168.
272. gbcon169.seq - Constructed sequence entries, part 169.
273. gbcon17.seq - Constructed sequence entries, part 17.
274. gbcon170.seq - Constructed sequence entries, part 170.
275. gbcon171.seq - Constructed sequence entries, part 171.
276. gbcon172.seq - Constructed sequence entries, part 172.
277. gbcon18.seq - Constructed sequence entries, part 18.
278. gbcon19.seq - Constructed sequence entries, part 19.
279. gbcon2.seq - Constructed sequence entries, part 2.
280. gbcon20.seq - Constructed sequence entries, part 20.
281. gbcon21.seq - Constructed sequence entries, part 21.
282. gbcon22.seq - Constructed sequence entries, part 22.
283. gbcon23.seq - Constructed sequence entries, part 23.
284. gbcon24.seq - Constructed sequence entries, part 24.
285. gbcon25.seq - Constructed sequence entries, part 25.
286. gbcon26.seq - Constructed sequence entries, part 26.
287. gbcon27.seq - Constructed sequence entries, part 27.
288. gbcon28.seq - Constructed sequence entries, part 28.
289. gbcon29.seq - Constructed sequence entries, part 29.
290. gbcon3.seq - Constructed sequence entries, part 3.
291. gbcon30.seq - Constructed sequence entries, part 30.
292. gbcon31.seq - Constructed sequence entries, part 31.
293. gbcon32.seq - Constructed sequence entries, part 32.
294. gbcon33.seq - Constructed sequence entries, part 33.
295. gbcon34.seq - Constructed sequence entries, part 34.
296. gbcon35.seq - Constructed sequence entries, part 35.
297. gbcon36.seq - Constructed sequence entries, part 36.
298. gbcon37.seq - Constructed sequence entries, part 37.
299. gbcon38.seq - Constructed sequence entries, part 38.
300. gbcon39.seq - Constructed sequence entries, part 39.
301. gbcon4.seq - Constructed sequence entries, part 4.
302. gbcon40.seq - Constructed sequence entries, part 40.
303. gbcon41.seq - Constructed sequence entries, part 41.
304. gbcon42.seq - Constructed sequence entries, part 42.
305. gbcon43.seq - Constructed sequence entries, part 43.
306. gbcon44.seq - Constructed sequence entries, part 44.
307. gbcon45.seq - Constructed sequence entries, part 45.
308. gbcon46.seq - Constructed sequence entries, part 46.
309. gbcon47.seq - Constructed sequence entries, part 47.
310. gbcon48.seq - Constructed sequence entries, part 48.
311. gbcon49.seq - Constructed sequence entries, part 49.
312. gbcon5.seq - Constructed sequence entries, part 5.
313. gbcon50.seq - Constructed sequence entries, part 50.
314. gbcon51.seq - Constructed sequence entries, part 51.
315. gbcon52.seq - Constructed sequence entries, part 52.
316. gbcon53.seq - Constructed sequence entries, part 53.
317. gbcon54.seq - Constructed sequence entries, part 54.
318. gbcon55.seq - Constructed sequence entries, part 55.
319. gbcon56.seq - Constructed sequence entries, part 56.
320. gbcon57.seq - Constructed sequence entries, part 57.
321. gbcon58.seq - Constructed sequence entries, part 58.
322. gbcon59.seq - Constructed sequence entries, part 59.
323. gbcon6.seq - Constructed sequence entries, part 6.
324. gbcon60.seq - Constructed sequence entries, part 60.
325. gbcon61.seq - Constructed sequence entries, part 61.
326. gbcon62.seq - Constructed sequence entries, part 62.
327. gbcon63.seq - Constructed sequence entries, part 63.
328. gbcon64.seq - Constructed sequence entries, part 64.
329. gbcon65.seq - Constructed sequence entries, part 65.
330. gbcon66.seq - Constructed sequence entries, part 66.
331. gbcon67.seq - Constructed sequence entries, part 67.
332. gbcon68.seq - Constructed sequence entries, part 68.
333. gbcon69.seq - Constructed sequence entries, part 69.
334. gbcon7.seq - Constructed sequence entries, part 7.
335. gbcon70.seq - Constructed sequence entries, part 70.
336. gbcon71.seq - Constructed sequence entries, part 71.
337. gbcon72.seq - Constructed sequence entries, part 72.
338. gbcon73.seq - Constructed sequence entries, part 73.
339. gbcon74.seq - Constructed sequence entries, part 74.
340. gbcon75.seq - Constructed sequence entries, part 75.
341. gbcon76.seq - Constructed sequence entries, part 76.
342. gbcon77.seq - Constructed sequence entries, part 77.
343. gbcon78.seq - Constructed sequence entries, part 78.
344. gbcon79.seq - Constructed sequence entries, part 79.
345. gbcon8.seq - Constructed sequence entries, part 8.
346. gbcon80.seq - Constructed sequence entries, part 80.
347. gbcon81.seq - Constructed sequence entries, part 81.
348. gbcon82.seq - Constructed sequence entries, part 82.
349. gbcon83.seq - Constructed sequence entries, part 83.
350. gbcon84.seq - Constructed sequence entries, part 84.
351. gbcon85.seq - Constructed sequence entries, part 85.
352. gbcon86.seq - Constructed sequence entries, part 86.
353. gbcon87.seq - Constructed sequence entries, part 87.
354. gbcon88.seq - Constructed sequence entries, part 88.
355. gbcon89.seq - Constructed sequence entries, part 89.
356. gbcon9.seq - Constructed sequence entries, part 9.
357. gbcon90.seq - Constructed sequence entries, part 90.
358. gbcon91.seq - Constructed sequence entries, part 91.
359. gbcon92.seq - Constructed sequence entries, part 92.
360. gbcon93.seq - Constructed sequence entries, part 93.
361. gbcon94.seq - Constructed sequence entries, part 94.
362. gbcon95.seq - Constructed sequence entries, part 95.
363. gbcon96.seq - Constructed sequence entries, part 96.
364. gbcon97.seq - Constructed sequence entries, part 97.
365. gbcon98.seq - Constructed sequence entries, part 98.
366. gbcon99.seq - Constructed sequence entries, part 99.
367. gbdel.txt - Accession numbers of entries deleted since the previous release.
368. gbenv1.seq - Environmental sampling sequence entries, part 1.
369. gbenv10.seq - Environmental sampling sequence entries, part 10.
370. gbenv11.seq - Environmental sampling sequence entries, part 11.
371. gbenv12.seq - Environmental sampling sequence entries, part 12.
372. gbenv13.seq - Environmental sampling sequence entries, part 13.
373. gbenv14.seq - Environmental sampling sequence entries, part 14.
374. gbenv15.seq - Environmental sampling sequence entries, part 15.
375. gbenv16.seq - Environmental sampling sequence entries, part 16.
376. gbenv17.seq - Environmental sampling sequence entries, part 17.
377. gbenv18.seq - Environmental sampling sequence entries, part 18.
378. gbenv19.seq - Environmental sampling sequence entries, part 19.
379. gbenv2.seq - Environmental sampling sequence entries, part 2.
380. gbenv20.seq - Environmental sampling sequence entries, part 20.
381. gbenv21.seq - Environmental sampling sequence entries, part 21.
382. gbenv22.seq - Environmental sampling sequence entries, part 22.
383. gbenv23.seq - Environmental sampling sequence entries, part 23.
384. gbenv24.seq - Environmental sampling sequence entries, part 24.
385. gbenv25.seq - Environmental sampling sequence entries, part 25.
386. gbenv26.seq - Environmental sampling sequence entries, part 26.
387. gbenv27.seq - Environmental sampling sequence entries, part 27.
388. gbenv28.seq - Environmental sampling sequence entries, part 28.
389. gbenv29.seq - Environmental sampling sequence entries, part 29.
390. gbenv3.seq - Environmental sampling sequence entries, part 3.
391. gbenv30.seq - Environmental sampling sequence entries, part 30.
392. gbenv31.seq - Environmental sampling sequence entries, part 31.
393. gbenv32.seq - Environmental sampling sequence entries, part 32.
394. gbenv33.seq - Environmental sampling sequence entries, part 33.
395. gbenv34.seq - Environmental sampling sequence entries, part 34.
396. gbenv35.seq - Environmental sampling sequence entries, part 35.
397. gbenv36.seq - Environmental sampling sequence entries, part 36.
398. gbenv37.seq - Environmental sampling sequence entries, part 37.
399. gbenv38.seq - Environmental sampling sequence entries, part 38.
400. gbenv39.seq - Environmental sampling sequence entries, part 39.
401. gbenv4.seq - Environmental sampling sequence entries, part 4.
402. gbenv40.seq - Environmental sampling sequence entries, part 40.
403. gbenv41.seq - Environmental sampling sequence entries, part 41.
404. gbenv42.seq - Environmental sampling sequence entries, part 42.
405. gbenv43.seq - Environmental sampling sequence entries, part 43.
406. gbenv44.seq - Environmental sampling sequence entries, part 44.
407. gbenv45.seq - Environmental sampling sequence entries, part 45.
408. gbenv46.seq - Environmental sampling sequence entries, part 46.
409. gbenv47.seq - Environmental sampling sequence entries, part 47.
410. gbenv48.seq - Environmental sampling sequence entries, part 48.
411. gbenv49.seq - Environmental sampling sequence entries, part 49.
412. gbenv5.seq - Environmental sampling sequence entries, part 5.
413. gbenv50.seq - Environmental sampling sequence entries, part 50.
414. gbenv51.seq - Environmental sampling sequence entries, part 51.
415. gbenv52.seq - Environmental sampling sequence entries, part 52.
416. gbenv53.seq - Environmental sampling sequence entries, part 53.
417. gbenv54.seq - Environmental sampling sequence entries, part 54.
418. gbenv55.seq - Environmental sampling sequence entries, part 55.
419. gbenv6.seq - Environmental sampling sequence entries, part 6.
420. gbenv7.seq - Environmental sampling sequence entries, part 7.
421. gbenv8.seq - Environmental sampling sequence entries, part 8.
422. gbenv9.seq - Environmental sampling sequence entries, part 9.
423. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
424. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
425. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
426. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
427. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
428. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
429. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
430. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
431. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
432. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
433. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
434. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
435. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
436. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
437. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
438. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
439. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
440. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
441. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
442. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
443. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
444. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
445. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
446. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
447. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
448. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
449. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
450. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
451. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
452. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
453. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
454. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
455. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
456. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
457. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
458. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
459. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
460. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
461. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
462. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
463. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
464. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
465. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
466. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
467. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
468. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
469. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
470. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
471. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
472. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
473. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
474. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
475. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
476. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
477. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
478. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
479. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
480. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
481. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
482. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
483. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
484. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
485. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
486. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
487. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
488. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
489. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
490. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
491. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
492. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
493. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
494. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
495. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
496. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
497. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
498. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
499. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
500. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
501. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
502. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
503. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
504. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
505. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
506. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
507. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
508. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
509. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
510. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
511. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
512. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
513. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
514. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
515. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
516. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
517. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
518. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
519. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
520. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
521. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
522. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
523. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
524. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
525. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
526. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
527. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
528. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
529. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
530. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
531. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
532. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
533. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
534. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
535. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
536. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
537. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
538. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
539. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
540. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
541. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
542. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
543. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
544. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
545. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
546. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
547. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
548. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
549. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
550. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
551. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
552. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
553. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
554. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
555. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
556. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
557. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
558. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
559. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
560. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
561. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
562. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
563. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
564. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
565. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
566. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
567. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
568. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
569. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
570. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
571. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
572. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
573. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
574. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
575. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
576. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
577. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
578. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
579. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
580. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
581. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
582. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
583. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
584. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
585. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
586. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
587. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
588. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
589. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
590. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
591. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
592. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
593. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
594. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
595. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
596. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
597. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
598. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
599. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
600. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
601. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
602. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
603. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
604. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
605. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
606. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
607. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
608. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
609. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
610. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
611. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
612. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
613. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
614. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
615. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
616. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
617. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
618. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
619. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
620. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
621. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
622. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
623. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
624. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
625. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
626. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
627. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
628. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
629. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
630. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
631. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
632. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
633. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
634. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
635. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
636. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
637. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
638. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
639. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
640. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
641. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
642. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
643. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
644. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
645. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
646. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
647. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
648. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
649. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
650. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
651. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
652. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
653. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
654. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
655. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
656. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
657. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
658. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
659. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
660. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
661. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
662. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
663. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
664. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
665. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
666. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
667. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
668. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
669. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
670. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
671. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
672. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
673. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
674. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
675. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
676. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
677. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
678. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
679. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
680. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
681. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
682. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
683. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
684. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
685. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
686. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
687. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
688. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
689. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
690. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
691. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
692. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
693. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
694. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
695. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
696. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
697. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
698. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
699. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
700. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
701. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
702. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
703. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
704. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
705. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
706. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
707. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
708. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
709. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
710. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
711. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
712. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
713. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
714. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
715. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
716. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
717. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
718. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
719. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
720. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
721. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
722. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
723. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
724. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
725. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
726. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
727. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
728. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
729. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
730. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
731. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
732. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
733. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
734. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
735. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
736. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
737. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
738. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
739. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
740. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
741. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
742. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
743. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
744. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
745. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
746. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
747. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
748. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
749. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
750. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
751. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
752. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
753. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
754. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
755. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
756. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
757. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
758. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
759. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
760. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
761. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
762. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
763. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
764. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
765. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
766. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
767. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
768. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
769. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
770. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
771. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
772. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
773. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
774. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
775. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
776. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
777. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
778. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
779. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
780. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
781. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
782. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
783. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
784. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
785. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
786. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
787. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
788. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
789. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
790. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
791. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
792. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
793. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
794. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
795. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
796. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
797. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
798. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
799. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
800. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
801. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
802. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
803. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
804. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
805. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
806. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
807. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
808. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
809. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
810. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
811. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
812. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
813. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
814. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
815. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
816. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
817. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
818. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
819. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
820. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
821. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
822. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
823. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
824. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
825. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
826. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
827. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
828. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
829. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
830. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
831. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
832. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
833. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
834. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
835. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
836. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
837. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
838. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
839. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
840. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
841. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
842. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
843. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
844. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
845. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
846. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
847. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
848. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
849. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
850. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
851. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
852. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
853. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
854. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
855. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
856. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
857. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
858. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
859. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
860. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
861. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
862. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
863. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
864. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
865. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
866. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
867. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
868. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
869. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
870. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
871. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
872. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
873. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
874. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
875. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
876. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
877. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
878. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
879. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
880. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
881. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
882. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
883. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
884. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
885. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
886. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
887. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
888. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
889. gbgen.idx - Index of the entries according to gene symbols.
890. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
891. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
892. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
893. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
894. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
895. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
896. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
897. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
898. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
899. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
900. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
901. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
902. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
903. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
904. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
905. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
906. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
907. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
908. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
909. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
910. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
911. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
912. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
913. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
914. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
915. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
916. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
917. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
918. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
919. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
920. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
921. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
922. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
923. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
924. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
925. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
926. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
927. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
928. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
929. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
930. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
931. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
932. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
933. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
934. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
935. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
936. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
937. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
938. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
939. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
940. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
941. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
942. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
943. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
944. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
945. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
946. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
947. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
948. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
949. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
950. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
951. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
952. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
953. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
954. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
955. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
956. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
957. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
958. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
959. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
960. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
961. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
962. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
963. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
964. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
965. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
966. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
967. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
968. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
969. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
970. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
971. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
972. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
973. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
974. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
975. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
976. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
977. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
978. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
979. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
980. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
981. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
982. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
983. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
984. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
985. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
986. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
987. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
988. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
989. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
990. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
991. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
992. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
993. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
994. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
995. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
996. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
997. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
998. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
999. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1000. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1001. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1002. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1003. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1004. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1005. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1006. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1007. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1008. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1009. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1010. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1011. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1012. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1013. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1014. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1015. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1016. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1017. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1018. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1019. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1020. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1021. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1022. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1023. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1024. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1025. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1026. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1027. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1028. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1029. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1030. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1031. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1032. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1033. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1034. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1035. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1036. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1037. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1038. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1039. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1040. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1041. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1042. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1043. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1044. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1045. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1046. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1047. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1048. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1049. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1050. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1051. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1052. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1053. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1054. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1055. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1056. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1057. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1058. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1059. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1060. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1061. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1062. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1063. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1064. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1065. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1066. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1067. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1068. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1069. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1070. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1071. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1072. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1073. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1074. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1075. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1076. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1077. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1078. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1079. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1080. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1081. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1082. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1083. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1084. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1085. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1086. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1087. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1088. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1089. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1090. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1091. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1092. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1093. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1094. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1095. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1096. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1097. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1098. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1099. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1100. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1101. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1102. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1103. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1104. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1105. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1106. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1107. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1108. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1109. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1110. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1111. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1112. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1113. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1114. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1115. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1116. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1117. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1118. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1119. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1120. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1121. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1122. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1123. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1124. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1125. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1126. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1127. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1128. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1129. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1130. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1131. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1132. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1133. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1134. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1135. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1136. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1137. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1138. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1139. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1140. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1141. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1142. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1143. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1144. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1145. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1146. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1147. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1148. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1149. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1150. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1151. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1152. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1153. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1154. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1155. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1156. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1157. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1158. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1159. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1160. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1161. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1162. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1163. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1164. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1165. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1166. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1167. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1168. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1169. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1170. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1171. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1172. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1173. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1174. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1175. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1176. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1177. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1178. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1179. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1180. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1181. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1182. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1183. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1184. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1185. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1186. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1187. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1188. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1189. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1190. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1191. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1192. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1193. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1194. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1195. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1196. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1197. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1198. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1199. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1200. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1201. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1202. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1203. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1204. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1205. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1206. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1207. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1208. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1209. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1210. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1211. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1212. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1213. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1214. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1215. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1216. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1217. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1218. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1219. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1220. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1221. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1222. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1223. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1224. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1225. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1226. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1227. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1228. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1229. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1230. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1231. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1232. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1233. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1234. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1235. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1236. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1237. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1238. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1239. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1240. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1241. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1242. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1243. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1244. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1245. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1246. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1247. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1248. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1249. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1250. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1251. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1252. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1253. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1254. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1255. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1256. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1257. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1258. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1259. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1260. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1261. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1262. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1263. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1264. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1265. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1266. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1267. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1268. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1269. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1270. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1271. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1272. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1273. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1274. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1275. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1276. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1277. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1278. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1279. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1280. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1281. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1282. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1283. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1284. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1285. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1286. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1287. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1288. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1289. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1290. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1291. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1292. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1293. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1294. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1295. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1296. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1297. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1298. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1299. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1300. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1301. gbinv1.seq - Invertebrate sequence entries, part 1.
1302. gbinv10.seq - Invertebrate sequence entries, part 10.
1303. gbinv11.seq - Invertebrate sequence entries, part 11.
1304. gbinv12.seq - Invertebrate sequence entries, part 12.
1305. gbinv13.seq - Invertebrate sequence entries, part 13.
1306. gbinv14.seq - Invertebrate sequence entries, part 14.
1307. gbinv15.seq - Invertebrate sequence entries, part 15.
1308. gbinv16.seq - Invertebrate sequence entries, part 16.
1309. gbinv17.seq - Invertebrate sequence entries, part 17.
1310. gbinv18.seq - Invertebrate sequence entries, part 18.
1311. gbinv19.seq - Invertebrate sequence entries, part 19.
1312. gbinv2.seq - Invertebrate sequence entries, part 2.
1313. gbinv20.seq - Invertebrate sequence entries, part 20.
1314. gbinv21.seq - Invertebrate sequence entries, part 21.
1315. gbinv22.seq - Invertebrate sequence entries, part 22.
1316. gbinv23.seq - Invertebrate sequence entries, part 23.
1317. gbinv24.seq - Invertebrate sequence entries, part 24.
1318. gbinv25.seq - Invertebrate sequence entries, part 25.
1319. gbinv26.seq - Invertebrate sequence entries, part 26.
1320. gbinv27.seq - Invertebrate sequence entries, part 27.
1321. gbinv28.seq - Invertebrate sequence entries, part 28.
1322. gbinv29.seq - Invertebrate sequence entries, part 29.
1323. gbinv3.seq - Invertebrate sequence entries, part 3.
1324. gbinv30.seq - Invertebrate sequence entries, part 30.
1325. gbinv31.seq - Invertebrate sequence entries, part 31.
1326. gbinv32.seq - Invertebrate sequence entries, part 32.
1327. gbinv4.seq - Invertebrate sequence entries, part 4.
1328. gbinv5.seq - Invertebrate sequence entries, part 5.
1329. gbinv6.seq - Invertebrate sequence entries, part 6.
1330. gbinv7.seq - Invertebrate sequence entries, part 7.
1331. gbinv8.seq - Invertebrate sequence entries, part 8.
1332. gbinv9.seq - Invertebrate sequence entries, part 9.
1333. gbjou1.idx - Index of the entries according to journal citation, part 1.
1334. gbjou10.idx - Index of the entries according to journal citation, part 10.
1335. gbjou11.idx - Index of the entries according to journal citation, part 11.
1336. gbjou12.idx - Index of the entries according to journal citation, part 12.
1337. gbjou13.idx - Index of the entries according to journal citation, part 13.
1338. gbjou2.idx - Index of the entries according to journal citation, part 2.
1339. gbjou3.idx - Index of the entries according to journal citation, part 3.
1340. gbjou4.idx - Index of the entries according to journal citation, part 4.
1341. gbjou5.idx - Index of the entries according to journal citation, part 5.
1342. gbjou6.idx - Index of the entries according to journal citation, part 6.
1343. gbjou7.idx - Index of the entries according to journal citation, part 7.
1344. gbjou8.idx - Index of the entries according to journal citation, part 8.
1345. gbjou9.idx - Index of the entries according to journal citation, part 9.
1346. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1347. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1348. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1349. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1350. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1351. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1352. gbkey7.idx - Index of the entries according to keyword phrase, part 7.
1353. gbmam1.seq - Other mammalian sequence entries, part 1.
1354. gbmam2.seq - Other mammalian sequence entries, part 2.
1355. gbmam3.seq - Other mammalian sequence entries, part 3.
1356. gbmam4.seq - Other mammalian sequence entries, part 4.
1357. gbmam5.seq - Other mammalian sequence entries, part 5.
1358. gbmam6.seq - Other mammalian sequence entries, part 6.
1359. gbmam7.seq - Other mammalian sequence entries, part 7.
1360. gbmam8.seq - Other mammalian sequence entries, part 8.
1361. gbnew.txt - Accession numbers of entries new since the previous release.
1362. gbpat1.seq - Patent sequence entries, part 1.
1363. gbpat10.seq - Patent sequence entries, part 10.
1364. gbpat100.seq - Patent sequence entries, part 100.
1365. gbpat101.seq - Patent sequence entries, part 101.
1366. gbpat102.seq - Patent sequence entries, part 102.
1367. gbpat103.seq - Patent sequence entries, part 103.
1368. gbpat104.seq - Patent sequence entries, part 104.
1369. gbpat105.seq - Patent sequence entries, part 105.
1370. gbpat106.seq - Patent sequence entries, part 106.
1371. gbpat107.seq - Patent sequence entries, part 107.
1372. gbpat108.seq - Patent sequence entries, part 108.
1373. gbpat109.seq - Patent sequence entries, part 109.
1374. gbpat11.seq - Patent sequence entries, part 11.
1375. gbpat110.seq - Patent sequence entries, part 110.
1376. gbpat111.seq - Patent sequence entries, part 111.
1377. gbpat112.seq - Patent sequence entries, part 112.
1378. gbpat113.seq - Patent sequence entries, part 113.
1379. gbpat114.seq - Patent sequence entries, part 114.
1380. gbpat115.seq - Patent sequence entries, part 115.
1381. gbpat116.seq - Patent sequence entries, part 116.
1382. gbpat117.seq - Patent sequence entries, part 117.
1383. gbpat118.seq - Patent sequence entries, part 118.
1384. gbpat119.seq - Patent sequence entries, part 119.
1385. gbpat12.seq - Patent sequence entries, part 12.
1386. gbpat120.seq - Patent sequence entries, part 120.
1387. gbpat121.seq - Patent sequence entries, part 121.
1388. gbpat122.seq - Patent sequence entries, part 122.
1389. gbpat123.seq - Patent sequence entries, part 123.
1390. gbpat124.seq - Patent sequence entries, part 124.
1391. gbpat125.seq - Patent sequence entries, part 125.
1392. gbpat126.seq - Patent sequence entries, part 126.
1393. gbpat127.seq - Patent sequence entries, part 127.
1394. gbpat128.seq - Patent sequence entries, part 128.
1395. gbpat129.seq - Patent sequence entries, part 129.
1396. gbpat13.seq - Patent sequence entries, part 13.
1397. gbpat130.seq - Patent sequence entries, part 130.
1398. gbpat131.seq - Patent sequence entries, part 131.
1399. gbpat132.seq - Patent sequence entries, part 132.
1400. gbpat133.seq - Patent sequence entries, part 133.
1401. gbpat134.seq - Patent sequence entries, part 134.
1402. gbpat135.seq - Patent sequence entries, part 135.
1403. gbpat136.seq - Patent sequence entries, part 136.
1404. gbpat137.seq - Patent sequence entries, part 137.
1405. gbpat138.seq - Patent sequence entries, part 138.
1406. gbpat139.seq - Patent sequence entries, part 139.
1407. gbpat14.seq - Patent sequence entries, part 14.
1408. gbpat140.seq - Patent sequence entries, part 140.
1409. gbpat141.seq - Patent sequence entries, part 141.
1410. gbpat142.seq - Patent sequence entries, part 142.
1411. gbpat143.seq - Patent sequence entries, part 143.
1412. gbpat144.seq - Patent sequence entries, part 144.
1413. gbpat145.seq - Patent sequence entries, part 145.
1414. gbpat146.seq - Patent sequence entries, part 146.
1415. gbpat147.seq - Patent sequence entries, part 147.
1416. gbpat148.seq - Patent sequence entries, part 148.
1417. gbpat149.seq - Patent sequence entries, part 149.
1418. gbpat15.seq - Patent sequence entries, part 15.
1419. gbpat150.seq - Patent sequence entries, part 150.
1420. gbpat151.seq - Patent sequence entries, part 151.
1421. gbpat152.seq - Patent sequence entries, part 152.
1422. gbpat153.seq - Patent sequence entries, part 153.
1423. gbpat154.seq - Patent sequence entries, part 154.
1424. gbpat155.seq - Patent sequence entries, part 155.
1425. gbpat156.seq - Patent sequence entries, part 156.
1426. gbpat157.seq - Patent sequence entries, part 157.
1427. gbpat158.seq - Patent sequence entries, part 158.
1428. gbpat159.seq - Patent sequence entries, part 159.
1429. gbpat16.seq - Patent sequence entries, part 16.
1430. gbpat160.seq - Patent sequence entries, part 160.
1431. gbpat161.seq - Patent sequence entries, part 161.
1432. gbpat162.seq - Patent sequence entries, part 162.
1433. gbpat163.seq - Patent sequence entries, part 163.
1434. gbpat164.seq - Patent sequence entries, part 164.
1435. gbpat165.seq - Patent sequence entries, part 165.
1436. gbpat166.seq - Patent sequence entries, part 166.
1437. gbpat167.seq - Patent sequence entries, part 167.
1438. gbpat168.seq - Patent sequence entries, part 168.
1439. gbpat169.seq - Patent sequence entries, part 169.
1440. gbpat17.seq - Patent sequence entries, part 17.
1441. gbpat170.seq - Patent sequence entries, part 170.
1442. gbpat171.seq - Patent sequence entries, part 171.
1443. gbpat172.seq - Patent sequence entries, part 172.
1444. gbpat173.seq - Patent sequence entries, part 173.
1445. gbpat174.seq - Patent sequence entries, part 174.
1446. gbpat175.seq - Patent sequence entries, part 175.
1447. gbpat176.seq - Patent sequence entries, part 176.
1448. gbpat177.seq - Patent sequence entries, part 177.
1449. gbpat178.seq - Patent sequence entries, part 178.
1450. gbpat179.seq - Patent sequence entries, part 179.
1451. gbpat18.seq - Patent sequence entries, part 18.
1452. gbpat180.seq - Patent sequence entries, part 180.
1453. gbpat181.seq - Patent sequence entries, part 181.
1454. gbpat182.seq - Patent sequence entries, part 182.
1455. gbpat19.seq - Patent sequence entries, part 19.
1456. gbpat2.seq - Patent sequence entries, part 2.
1457. gbpat20.seq - Patent sequence entries, part 20.
1458. gbpat21.seq - Patent sequence entries, part 21.
1459. gbpat22.seq - Patent sequence entries, part 22.
1460. gbpat23.seq - Patent sequence entries, part 23.
1461. gbpat24.seq - Patent sequence entries, part 24.
1462. gbpat25.seq - Patent sequence entries, part 25.
1463. gbpat26.seq - Patent sequence entries, part 26.
1464. gbpat27.seq - Patent sequence entries, part 27.
1465. gbpat28.seq - Patent sequence entries, part 28.
1466. gbpat29.seq - Patent sequence entries, part 29.
1467. gbpat3.seq - Patent sequence entries, part 3.
1468. gbpat30.seq - Patent sequence entries, part 30.
1469. gbpat31.seq - Patent sequence entries, part 31.
1470. gbpat32.seq - Patent sequence entries, part 32.
1471. gbpat33.seq - Patent sequence entries, part 33.
1472. gbpat34.seq - Patent sequence entries, part 34.
1473. gbpat35.seq - Patent sequence entries, part 35.
1474. gbpat36.seq - Patent sequence entries, part 36.
1475. gbpat37.seq - Patent sequence entries, part 37.
1476. gbpat38.seq - Patent sequence entries, part 38.
1477. gbpat39.seq - Patent sequence entries, part 39.
1478. gbpat4.seq - Patent sequence entries, part 4.
1479. gbpat40.seq - Patent sequence entries, part 40.
1480. gbpat41.seq - Patent sequence entries, part 41.
1481. gbpat42.seq - Patent sequence entries, part 42.
1482. gbpat43.seq - Patent sequence entries, part 43.
1483. gbpat44.seq - Patent sequence entries, part 44.
1484. gbpat45.seq - Patent sequence entries, part 45.
1485. gbpat46.seq - Patent sequence entries, part 46.
1486. gbpat47.seq - Patent sequence entries, part 47.
1487. gbpat48.seq - Patent sequence entries, part 48.
1488. gbpat49.seq - Patent sequence entries, part 49.
1489. gbpat5.seq - Patent sequence entries, part 5.
1490. gbpat50.seq - Patent sequence entries, part 50.
1491. gbpat51.seq - Patent sequence entries, part 51.
1492. gbpat52.seq - Patent sequence entries, part 52.
1493. gbpat53.seq - Patent sequence entries, part 53.
1494. gbpat54.seq - Patent sequence entries, part 54.
1495. gbpat55.seq - Patent sequence entries, part 55.
1496. gbpat56.seq - Patent sequence entries, part 56.
1497. gbpat57.seq - Patent sequence entries, part 57.
1498. gbpat58.seq - Patent sequence entries, part 58.
1499. gbpat59.seq - Patent sequence entries, part 59.
1500. gbpat6.seq - Patent sequence entries, part 6.
1501. gbpat60.seq - Patent sequence entries, part 60.
1502. gbpat61.seq - Patent sequence entries, part 61.
1503. gbpat62.seq - Patent sequence entries, part 62.
1504. gbpat63.seq - Patent sequence entries, part 63.
1505. gbpat64.seq - Patent sequence entries, part 64.
1506. gbpat65.seq - Patent sequence entries, part 65.
1507. gbpat66.seq - Patent sequence entries, part 66.
1508. gbpat67.seq - Patent sequence entries, part 67.
1509. gbpat68.seq - Patent sequence entries, part 68.
1510. gbpat69.seq - Patent sequence entries, part 69.
1511. gbpat7.seq - Patent sequence entries, part 7.
1512. gbpat70.seq - Patent sequence entries, part 70.
1513. gbpat71.seq - Patent sequence entries, part 71.
1514. gbpat72.seq - Patent sequence entries, part 72.
1515. gbpat73.seq - Patent sequence entries, part 73.
1516. gbpat74.seq - Patent sequence entries, part 74.
1517. gbpat75.seq - Patent sequence entries, part 75.
1518. gbpat76.seq - Patent sequence entries, part 76.
1519. gbpat77.seq - Patent sequence entries, part 77.
1520. gbpat78.seq - Patent sequence entries, part 78.
1521. gbpat79.seq - Patent sequence entries, part 79.
1522. gbpat8.seq - Patent sequence entries, part 8.
1523. gbpat80.seq - Patent sequence entries, part 80.
1524. gbpat81.seq - Patent sequence entries, part 81.
1525. gbpat82.seq - Patent sequence entries, part 82.
1526. gbpat83.seq - Patent sequence entries, part 83.
1527. gbpat84.seq - Patent sequence entries, part 84.
1528. gbpat85.seq - Patent sequence entries, part 85.
1529. gbpat86.seq - Patent sequence entries, part 86.
1530. gbpat87.seq - Patent sequence entries, part 87.
1531. gbpat88.seq - Patent sequence entries, part 88.
1532. gbpat89.seq - Patent sequence entries, part 89.
1533. gbpat9.seq - Patent sequence entries, part 9.
1534. gbpat90.seq - Patent sequence entries, part 90.
1535. gbpat91.seq - Patent sequence entries, part 91.
1536. gbpat92.seq - Patent sequence entries, part 92.
1537. gbpat93.seq - Patent sequence entries, part 93.
1538. gbpat94.seq - Patent sequence entries, part 94.
1539. gbpat95.seq - Patent sequence entries, part 95.
1540. gbpat96.seq - Patent sequence entries, part 96.
1541. gbpat97.seq - Patent sequence entries, part 97.
1542. gbpat98.seq - Patent sequence entries, part 98.
1543. gbpat99.seq - Patent sequence entries, part 99.
1544. gbphg1.seq - Phage sequence entries, part 1.
1545. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1546. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1547. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1548. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1549. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1550. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1551. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1552. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1553. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1554. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1555. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1556. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1557. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1558. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1559. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1560. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1561. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1562. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1563. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1564. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1565. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1566. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1567. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1568. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1569. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1570. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1571. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1572. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1573. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1574. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1575. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1576. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1577. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1578. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1579. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1580. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1581. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1582. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1583. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1584. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1585. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1586. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1587. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1588. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1589. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1590. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1591. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1592. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1593. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1594. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1595. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1596. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1597. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1598. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1599. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1600. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1601. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1602. gbpri1.seq - Primate sequence entries, part 1.
1603. gbpri10.seq - Primate sequence entries, part 10.
1604. gbpri11.seq - Primate sequence entries, part 11.
1605. gbpri12.seq - Primate sequence entries, part 12.
1606. gbpri13.seq - Primate sequence entries, part 13.
1607. gbpri14.seq - Primate sequence entries, part 14.
1608. gbpri15.seq - Primate sequence entries, part 15.
1609. gbpri16.seq - Primate sequence entries, part 16.
1610. gbpri17.seq - Primate sequence entries, part 17.
1611. gbpri18.seq - Primate sequence entries, part 18.
1612. gbpri19.seq - Primate sequence entries, part 19.
1613. gbpri2.seq - Primate sequence entries, part 2.
1614. gbpri20.seq - Primate sequence entries, part 20.
1615. gbpri21.seq - Primate sequence entries, part 21.
1616. gbpri22.seq - Primate sequence entries, part 22.
1617. gbpri23.seq - Primate sequence entries, part 23.
1618. gbpri24.seq - Primate sequence entries, part 24.
1619. gbpri25.seq - Primate sequence entries, part 25.
1620. gbpri26.seq - Primate sequence entries, part 26.
1621. gbpri27.seq - Primate sequence entries, part 27.
1622. gbpri28.seq - Primate sequence entries, part 28.
1623. gbpri29.seq - Primate sequence entries, part 29.
1624. gbpri3.seq - Primate sequence entries, part 3.
1625. gbpri30.seq - Primate sequence entries, part 30.
1626. gbpri31.seq - Primate sequence entries, part 31.
1627. gbpri32.seq - Primate sequence entries, part 32.
1628. gbpri33.seq - Primate sequence entries, part 33.
1629. gbpri34.seq - Primate sequence entries, part 34.
1630. gbpri35.seq - Primate sequence entries, part 35.
1631. gbpri36.seq - Primate sequence entries, part 36.
1632. gbpri37.seq - Primate sequence entries, part 37.
1633. gbpri38.seq - Primate sequence entries, part 38.
1634. gbpri39.seq - Primate sequence entries, part 39.
1635. gbpri4.seq - Primate sequence entries, part 4.
1636. gbpri40.seq - Primate sequence entries, part 40.
1637. gbpri41.seq - Primate sequence entries, part 41.
1638. gbpri42.seq - Primate sequence entries, part 42.
1639. gbpri43.seq - Primate sequence entries, part 43.
1640. gbpri44.seq - Primate sequence entries, part 44.
1641. gbpri45.seq - Primate sequence entries, part 45.
1642. gbpri5.seq - Primate sequence entries, part 5.
1643. gbpri6.seq - Primate sequence entries, part 6.
1644. gbpri7.seq - Primate sequence entries, part 7.
1645. gbpri8.seq - Primate sequence entries, part 8.
1646. gbpri9.seq - Primate sequence entries, part 9.
1647. gbrel.txt - Release notes (this document).
1648. gbrod1.seq - Rodent sequence entries, part 1.
1649. gbrod10.seq - Rodent sequence entries, part 10.
1650. gbrod11.seq - Rodent sequence entries, part 11.
1651. gbrod12.seq - Rodent sequence entries, part 12.
1652. gbrod13.seq - Rodent sequence entries, part 13.
1653. gbrod14.seq - Rodent sequence entries, part 14.
1654. gbrod15.seq - Rodent sequence entries, part 15.
1655. gbrod16.seq - Rodent sequence entries, part 16.
1656. gbrod17.seq - Rodent sequence entries, part 17.
1657. gbrod18.seq - Rodent sequence entries, part 18.
1658. gbrod19.seq - Rodent sequence entries, part 19.
1659. gbrod2.seq - Rodent sequence entries, part 2.
1660. gbrod20.seq - Rodent sequence entries, part 20.
1661. gbrod21.seq - Rodent sequence entries, part 21.
1662. gbrod22.seq - Rodent sequence entries, part 22.
1663. gbrod23.seq - Rodent sequence entries, part 23.
1664. gbrod24.seq - Rodent sequence entries, part 24.
1665. gbrod25.seq - Rodent sequence entries, part 25.
1666. gbrod26.seq - Rodent sequence entries, part 26.
1667. gbrod27.seq - Rodent sequence entries, part 27.
1668. gbrod28.seq - Rodent sequence entries, part 28.
1669. gbrod29.seq - Rodent sequence entries, part 29.
1670. gbrod3.seq - Rodent sequence entries, part 3.
1671. gbrod4.seq - Rodent sequence entries, part 4.
1672. gbrod5.seq - Rodent sequence entries, part 5.
1673. gbrod6.seq - Rodent sequence entries, part 6.
1674. gbrod7.seq - Rodent sequence entries, part 7.
1675. gbrod8.seq - Rodent sequence entries, part 8.
1676. gbrod9.seq - Rodent sequence entries, part 9.
1677. gbsdr1.txt - Short directory of the data bank, part 1.
1678. gbsdr2.txt - Short directory of the data bank, part 2.
1679. gbsdr3.txt - Short directory of the data bank, part 3.
1680. gbsec.idx - Index of the entries according to secondary accession number.
1681. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1682. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1683. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1684. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1685. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1686. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1687. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1688. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1689. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1690. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1691. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1692. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1693. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1694. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1695. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1696. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1697. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1698. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1699. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1700. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1701. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1702. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1703. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1704. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1705. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1706. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1707. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1708. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1709. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1710. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1711. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1712. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1713. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1714. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1715. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1716. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1717. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1718. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1719. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1720. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1721. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1722. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1723. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1724. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1725. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1726. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1727. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1728. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1729. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1730. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1731. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1732. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1733. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1734. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1735. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1736. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1737. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1738. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1739. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1740. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1741. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1742. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1743. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1744. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1745. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1746. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1747. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1748. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1749. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1750. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1751. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1752. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1753. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1754. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1755. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1756. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1757. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1758. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1759. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1760. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1761. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1762. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1763. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1764. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1765. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1766. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1767. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1768. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1769. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1770. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1771. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1772. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1773. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1774. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1775. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1776. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1777. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1778. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1779. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1780. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1781. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1782. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1783. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1784. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1785. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1786. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1787. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1788. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1789. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1790. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1791. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1792. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1793. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
1794. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
1795. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
1796. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1797. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
1798. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
1799. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
1800. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
1801. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
1802. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
1803. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
1804. gbuna1.seq - Unannotated sequence entries, part 1.
1805. gbvrl1.seq - Viral sequence entries, part 1.
1806. gbvrl10.seq - Viral sequence entries, part 10.
1807. gbvrl11.seq - Viral sequence entries, part 11.
1808. gbvrl12.seq - Viral sequence entries, part 12.
1809. gbvrl13.seq - Viral sequence entries, part 13.
1810. gbvrl14.seq - Viral sequence entries, part 14.
1811. gbvrl15.seq - Viral sequence entries, part 15.
1812. gbvrl16.seq - Viral sequence entries, part 16.
1813. gbvrl17.seq - Viral sequence entries, part 17.
1814. gbvrl18.seq - Viral sequence entries, part 18.
1815. gbvrl19.seq - Viral sequence entries, part 19.
1816. gbvrl2.seq - Viral sequence entries, part 2.
1817. gbvrl20.seq - Viral sequence entries, part 20.
1818. gbvrl21.seq - Viral sequence entries, part 21.
1819. gbvrl3.seq - Viral sequence entries, part 3.
1820. gbvrl4.seq - Viral sequence entries, part 4.
1821. gbvrl5.seq - Viral sequence entries, part 5.
1822. gbvrl6.seq - Viral sequence entries, part 6.
1823. gbvrl7.seq - Viral sequence entries, part 7.
1824. gbvrl8.seq - Viral sequence entries, part 8.
1825. gbvrl9.seq - Viral sequence entries, part 9.
1826. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1827. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1828. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1829. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1830. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1831. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1832. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1833. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1834. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1835. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1836. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1837. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1838. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1839. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1840. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1841. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1842. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1843. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1844. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1845. gbvrt27.seq - Other vertebrate sequence entries, part 27.
1846. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1847. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1848. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1849. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1850. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1851. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1852. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 191.0 flatfiles require roughly 561 GB (sequence
files only) or 604 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
2111226774 gbacc1.idx
2423011140 gbacc2.idx
855076371 gbacc3.idx
183869522 gbaut1.idx
193127298 gbaut10.idx
210762538 gbaut100.idx
32040840 gbaut101.idx
184824550 gbaut11.idx
184048031 gbaut12.idx
184283598 gbaut13.idx
183961085 gbaut14.idx
183959519 gbaut15.idx
184086831 gbaut16.idx
183857514 gbaut17.idx
210549333 gbaut18.idx
183981660 gbaut19.idx
184735234 gbaut2.idx
185180672 gbaut20.idx
247480826 gbaut21.idx
191212894 gbaut22.idx
190165185 gbaut23.idx
244507971 gbaut24.idx
188700764 gbaut25.idx
186125623 gbaut26.idx
186023345 gbaut27.idx
202987519 gbaut28.idx
186393415 gbaut29.idx
183897952 gbaut3.idx
185856975 gbaut30.idx
208183112 gbaut31.idx
201855874 gbaut32.idx
223623874 gbaut33.idx
228857855 gbaut34.idx
183902320 gbaut35.idx
184857907 gbaut36.idx
241929980 gbaut37.idx
185965813 gbaut38.idx
183915343 gbaut39.idx
240183327 gbaut4.idx
186700595 gbaut40.idx
216995885 gbaut41.idx
184055187 gbaut42.idx
186462087 gbaut43.idx
185729516 gbaut44.idx
184025209 gbaut45.idx
184373099 gbaut46.idx
193114976 gbaut47.idx
183902852 gbaut48.idx
234610257 gbaut49.idx
184062952 gbaut5.idx
184824976 gbaut50.idx
186565037 gbaut51.idx
184113103 gbaut52.idx
183865166 gbaut53.idx
234585369 gbaut54.idx
186229574 gbaut55.idx
183781226 gbaut56.idx
188219597 gbaut57.idx
201658423 gbaut58.idx
183831182 gbaut59.idx
186279033 gbaut6.idx
183850849 gbaut60.idx
188718492 gbaut61.idx
186683136 gbaut62.idx
186484862 gbaut63.idx
184680368 gbaut64.idx
185906071 gbaut65.idx
183957069 gbaut66.idx
189050118 gbaut67.idx
191599819 gbaut68.idx
203181038 gbaut69.idx
188817830 gbaut7.idx
185081735 gbaut70.idx
183944085 gbaut71.idx
184614371 gbaut72.idx
185724382 gbaut73.idx
186823328 gbaut74.idx
183907085 gbaut75.idx
185154112 gbaut76.idx
186326659 gbaut77.idx
184755408 gbaut78.idx
207177836 gbaut79.idx
189515725 gbaut8.idx
237072680 gbaut80.idx
224678438 gbaut81.idx
185422346 gbaut82.idx
184780344 gbaut83.idx
201454400 gbaut84.idx
184635449 gbaut85.idx
183899835 gbaut86.idx
236123014 gbaut87.idx
202757635 gbaut88.idx
251204359 gbaut89.idx
183875032 gbaut9.idx
183717165 gbaut90.idx
184520614 gbaut91.idx
186051486 gbaut92.idx
209973151 gbaut93.idx
185240640 gbaut94.idx
185441097 gbaut95.idx
185488772 gbaut96.idx
184107184 gbaut97.idx
251499141 gbaut98.idx
186556213 gbaut99.idx
249997748 gbbct1.seq
248276088 gbbct10.seq
234131801 gbbct11.seq
247698364 gbbct12.seq
247157794 gbbct13.seq
81481852 gbbct14.seq
243179586 gbbct15.seq
249797910 gbbct16.seq
245560130 gbbct17.seq
248629264 gbbct18.seq
248242507 gbbct19.seq
244933494 gbbct2.seq
249282329 gbbct20.seq
246199146 gbbct21.seq
245693884 gbbct22.seq
217807723 gbbct23.seq
242804075 gbbct24.seq
241841463 gbbct25.seq
248677875 gbbct26.seq
247875836 gbbct27.seq
249388745 gbbct28.seq
244186429 gbbct29.seq
249650734 gbbct3.seq
247337416 gbbct30.seq
249997167 gbbct31.seq
249762205 gbbct32.seq
249792757 gbbct33.seq
242887228 gbbct34.seq
241639400 gbbct35.seq
164818353 gbbct36.seq
243028616 gbbct37.seq
244322816 gbbct38.seq
249250113 gbbct39.seq
246205944 gbbct4.seq
247838111 gbbct40.seq
246706562 gbbct41.seq
248042643 gbbct42.seq
246778662 gbbct43.seq
240233511 gbbct44.seq
243873595 gbbct45.seq
240747283 gbbct46.seq
247072445 gbbct47.seq
231584896 gbbct48.seq
249922538 gbbct49.seq
213991730 gbbct5.seq
247105723 gbbct50.seq
241663263 gbbct51.seq
245558316 gbbct52.seq
244123708 gbbct53.seq
240009084 gbbct54.seq
248398058 gbbct55.seq
249304746 gbbct56.seq
249376350 gbbct57.seq
248726305 gbbct58.seq
241426846 gbbct59.seq
242141189 gbbct6.seq
238346377 gbbct60.seq
67122590 gbbct61.seq
244924489 gbbct62.seq
247520655 gbbct63.seq
244980990 gbbct64.seq
246778582 gbbct65.seq
248765600 gbbct66.seq
249549264 gbbct67.seq
207398495 gbbct68.seq
6888429 gbbct69.seq
244103322 gbbct7.seq
14097731 gbbct70.seq
23204828 gbbct71.seq
45103451 gbbct72.seq
87794941 gbbct73.seq
170198679 gbbct74.seq
249998392 gbbct75.seq
249997599 gbbct76.seq
244614721 gbbct77.seq
239403490 gbbct78.seq
247760742 gbbct79.seq
229641979 gbbct8.seq
248640558 gbbct80.seq
249988011 gbbct81.seq
249999053 gbbct82.seq
121901356 gbbct83.seq
249372671 gbbct84.seq
249998990 gbbct85.seq
249998519 gbbct86.seq
249999934 gbbct87.seq
249998543 gbbct88.seq
45621512 gbbct89.seq
245148549 gbbct9.seq
13744264 gbchg.txt
249997937 gbcon1.seq
249995122 gbcon10.seq
135141019 gbcon100.seq
249999018 gbcon101.seq
249995506 gbcon102.seq
249999938 gbcon103.seq
249996196 gbcon104.seq
249994668 gbcon105.seq
158184767 gbcon106.seq
249997662 gbcon107.seq
249996981 gbcon108.seq
249998026 gbcon109.seq
249991455 gbcon11.seq
249999534 gbcon110.seq
73726548 gbcon111.seq
213431083 gbcon112.seq
249999151 gbcon113.seq
249998618 gbcon114.seq
249995107 gbcon115.seq
249967397 gbcon116.seq
112571252 gbcon117.seq
249993276 gbcon118.seq
249997920 gbcon119.seq
249306530 gbcon12.seq
181287823 gbcon120.seq
249997376 gbcon121.seq
249999771 gbcon122.seq
250000264 gbcon123.seq
225434488 gbcon124.seq
249674671 gbcon125.seq
249966938 gbcon126.seq
249990910 gbcon127.seq
249997568 gbcon128.seq
250000073 gbcon129.seq
248941383 gbcon13.seq
249998203 gbcon130.seq
37398370 gbcon131.seq
249971298 gbcon132.seq
249997710 gbcon133.seq
249994690 gbcon134.seq
249959868 gbcon135.seq
249943571 gbcon136.seq
249999699 gbcon137.seq
249977443 gbcon138.seq
234884818 gbcon139.seq
248692463 gbcon14.seq
246632932 gbcon140.seq
247186189 gbcon141.seq
249991114 gbcon142.seq
249936667 gbcon143.seq
109243220 gbcon144.seq
249997820 gbcon145.seq
249844248 gbcon146.seq
249994703 gbcon147.seq
249999482 gbcon148.seq
249999953 gbcon149.seq
249997321 gbcon15.seq
249998586 gbcon150.seq
249998707 gbcon151.seq
249999291 gbcon152.seq
208228091 gbcon153.seq
249999735 gbcon154.seq
249998416 gbcon155.seq
249994743 gbcon156.seq
249959779 gbcon157.seq
249998736 gbcon158.seq
233046568 gbcon159.seq
91608699 gbcon16.seq
249999135 gbcon160.seq
249964275 gbcon161.seq
249998425 gbcon162.seq
249999395 gbcon163.seq
249997942 gbcon164.seq
249897000 gbcon165.seq
246199695 gbcon166.seq
249875336 gbcon167.seq
249988239 gbcon168.seq
249682385 gbcon169.seq
248418534 gbcon17.seq
249722211 gbcon170.seq
246016607 gbcon171.seq
18870472 gbcon172.seq
249996775 gbcon18.seq
249959053 gbcon19.seq
249297075 gbcon2.seq
58079501 gbcon20.seq
249994640 gbcon21.seq
249193119 gbcon22.seq
117444305 gbcon23.seq
249999763 gbcon24.seq
121171201 gbcon25.seq
249993709 gbcon26.seq
249727153 gbcon27.seq
249999220 gbcon28.seq
249996705 gbcon29.seq
249817269 gbcon3.seq
192075300 gbcon30.seq
249998917 gbcon31.seq
249996531 gbcon32.seq
249997326 gbcon33.seq
249998915 gbcon34.seq
249951770 gbcon35.seq
238917819 gbcon36.seq
249997270 gbcon37.seq
249999221 gbcon38.seq
249994732 gbcon39.seq
249977746 gbcon4.seq
249996897 gbcon40.seq
249997078 gbcon41.seq
249997414 gbcon42.seq
63412389 gbcon43.seq
249995423 gbcon44.seq
249997315 gbcon45.seq
249997250 gbcon46.seq
249997590 gbcon47.seq
249996159 gbcon48.seq
44928861 gbcon49.seq
249992070 gbcon5.seq
249994872 gbcon50.seq
249995799 gbcon51.seq
249997684 gbcon52.seq
249996690 gbcon53.seq
249997782 gbcon54.seq
38241897 gbcon55.seq
249998302 gbcon56.seq
249999150 gbcon57.seq
249998346 gbcon58.seq
249994564 gbcon59.seq
249999779 gbcon6.seq
249999492 gbcon60.seq
154672375 gbcon61.seq
249999016 gbcon62.seq
249996777 gbcon63.seq
249999159 gbcon64.seq
249995190 gbcon65.seq
185611272 gbcon66.seq
249996810 gbcon67.seq
249998700 gbcon68.seq
249997155 gbcon69.seq
249996243 gbcon7.seq
249997874 gbcon70.seq
247616447 gbcon71.seq
249998269 gbcon72.seq
249995941 gbcon73.seq
249998068 gbcon74.seq
249999277 gbcon75.seq
249999797 gbcon76.seq
98773033 gbcon77.seq
249997150 gbcon78.seq
249997442 gbcon79.seq
735104 gbcon8.seq
249995516 gbcon80.seq
249996111 gbcon81.seq
249995971 gbcon82.seq
64633499 gbcon83.seq
249998451 gbcon84.seq
249995859 gbcon85.seq
249994386 gbcon86.seq
249994858 gbcon87.seq
249998199 gbcon88.seq
23638323 gbcon89.seq
249993190 gbcon9.seq
249997115 gbcon90.seq
249995538 gbcon91.seq
249998987 gbcon92.seq
249999150 gbcon93.seq
199759401 gbcon94.seq
249994089 gbcon95.seq
249998565 gbcon96.seq
249998526 gbcon97.seq
249996032 gbcon98.seq
249999284 gbcon99.seq
66683 gbdel.txt
249997698 gbenv1.seq
249999538 gbenv10.seq
57810239 gbenv11.seq
249999978 gbenv12.seq
249999195 gbenv13.seq
250000136 gbenv14.seq
250000216 gbenv15.seq
249999796 gbenv16.seq
249999995 gbenv17.seq
250000028 gbenv18.seq
214371907 gbenv19.seq
249999868 gbenv2.seq
249999461 gbenv20.seq
249999890 gbenv21.seq
249999712 gbenv22.seq
249999941 gbenv23.seq
156915060 gbenv24.seq
249998189 gbenv25.seq
249992261 gbenv26.seq
249998997 gbenv27.seq
249999193 gbenv28.seq
249997993 gbenv29.seq
249999232 gbenv3.seq
184208891 gbenv30.seq
249999624 gbenv31.seq
249999051 gbenv32.seq
249998115 gbenv33.seq
249996871 gbenv34.seq
187073105 gbenv35.seq
249999958 gbenv36.seq
249999318 gbenv37.seq
249997508 gbenv38.seq
249997658 gbenv39.seq
250000233 gbenv4.seq
249996558 gbenv40.seq
249998338 gbenv41.seq
43075589 gbenv42.seq
250000217 gbenv43.seq
249999313 gbenv44.seq
250000126 gbenv45.seq
249998673 gbenv46.seq
174393566 gbenv47.seq
249996074 gbenv48.seq
250000040 gbenv49.seq
249998766 gbenv5.seq
249995335 gbenv50.seq
249999563 gbenv51.seq
249998630 gbenv52.seq
249998437 gbenv53.seq
249998176 gbenv54.seq
242793829 gbenv55.seq
249740297 gbenv6.seq
250000123 gbenv7.seq
249999849 gbenv8.seq
249999849 gbenv9.seq
524291258 gbest1.seq
524290574 gbest10.seq
524290454 gbest100.seq
524290713 gbest101.seq
524289850 gbest102.seq
524289904 gbest103.seq
360494697 gbest104.seq
524292288 gbest105.seq
524291533 gbest106.seq
524289922 gbest107.seq
385875937 gbest108.seq
389643195 gbest109.seq
524289698 gbest11.seq
383431335 gbest110.seq
384175352 gbest111.seq
381048230 gbest112.seq
385315426 gbest113.seq
390041916 gbest114.seq
388175753 gbest115.seq
387302891 gbest116.seq
383871806 gbest117.seq
407537234 gbest118.seq
510953227 gbest119.seq
524290692 gbest12.seq
524289568 gbest120.seq
524290202 gbest121.seq
524289950 gbest122.seq
524291006 gbest123.seq
430245620 gbest124.seq
524290381 gbest125.seq
524289622 gbest126.seq
524289688 gbest127.seq
524288741 gbest128.seq
524291273 gbest129.seq
157995929 gbest13.seq
524289207 gbest130.seq
524289362 gbest131.seq
524291756 gbest132.seq
524288996 gbest133.seq
524289660 gbest134.seq
524290383 gbest135.seq
524292875 gbest136.seq
301905047 gbest137.seq
524290464 gbest138.seq
524290515 gbest139.seq
524290262 gbest14.seq
524290983 gbest140.seq
524289154 gbest141.seq
524292934 gbest142.seq
524289733 gbest143.seq
524289484 gbest144.seq
524290165 gbest145.seq
524289818 gbest146.seq
524288975 gbest147.seq
524289444 gbest148.seq
524289474 gbest149.seq
524291584 gbest15.seq
524290754 gbest150.seq
466139680 gbest151.seq
524289802 gbest152.seq
524290154 gbest153.seq
524289301 gbest154.seq
524289356 gbest155.seq
524291006 gbest156.seq
524291098 gbest157.seq
524289164 gbest158.seq
524291722 gbest159.seq
524288801 gbest16.seq
524288869 gbest160.seq
524292623 gbest161.seq
524289690 gbest162.seq
524289462 gbest163.seq
247433320 gbest164.seq
524290998 gbest165.seq
524291121 gbest166.seq
524290129 gbest167.seq
524289333 gbest168.seq
524288769 gbest169.seq
524291403 gbest17.seq
524290763 gbest170.seq
524289532 gbest171.seq
524289449 gbest172.seq
524291578 gbest173.seq
524289399 gbest174.seq
524290407 gbest175.seq
524290647 gbest176.seq
524291784 gbest177.seq
114349642 gbest178.seq
524288875 gbest179.seq
524291236 gbest18.seq
524289374 gbest180.seq
524290354 gbest181.seq
524291074 gbest182.seq
524290562 gbest183.seq
524289611 gbest184.seq
524290921 gbest185.seq
524290773 gbest186.seq
524291850 gbest187.seq
524292493 gbest188.seq
524290031 gbest189.seq
524290127 gbest19.seq
524289277 gbest190.seq
469152976 gbest191.seq
524289565 gbest192.seq
524292225 gbest193.seq
524290858 gbest194.seq
524291676 gbest195.seq
524292616 gbest196.seq
524289020 gbest197.seq
524289815 gbest198.seq
524291447 gbest199.seq
524290885 gbest2.seq
524290769 gbest20.seq
524290347 gbest200.seq
524291266 gbest201.seq
524289804 gbest202.seq
524289897 gbest203.seq
524290508 gbest204.seq
78648677 gbest205.seq
524290635 gbest206.seq
524289971 gbest207.seq
524289040 gbest208.seq
524289083 gbest209.seq
524289021 gbest21.seq
524289161 gbest210.seq
524291316 gbest211.seq
524289881 gbest212.seq
524290103 gbest213.seq
524289905 gbest214.seq
524290056 gbest215.seq
423682100 gbest216.seq
524293163 gbest217.seq
524290939 gbest218.seq
524290627 gbest219.seq
512079353 gbest22.seq
524290203 gbest220.seq
524290955 gbest221.seq
524292480 gbest222.seq
524290312 gbest223.seq
524290733 gbest224.seq
524288936 gbest225.seq
524292388 gbest226.seq
524290999 gbest227.seq
524289285 gbest228.seq
524289816 gbest229.seq
500358821 gbest23.seq
350870038 gbest230.seq
524288832 gbest231.seq
524289071 gbest232.seq
524289115 gbest233.seq
524290536 gbest234.seq
524292423 gbest235.seq
524289677 gbest236.seq
524290113 gbest237.seq
524289413 gbest238.seq
524289432 gbest239.seq
509299214 gbest24.seq
524289365 gbest240.seq
524289497 gbest241.seq
524291568 gbest242.seq
524288969 gbest243.seq
524292128 gbest244.seq
57368125 gbest245.seq
524290782 gbest246.seq
524289653 gbest247.seq
524292232 gbest248.seq
524290697 gbest249.seq
319843806 gbest25.seq
524290399 gbest250.seq
524290832 gbest251.seq
524289795 gbest252.seq
524289364 gbest253.seq
524291373 gbest254.seq
524290837 gbest255.seq
524289516 gbest256.seq
262324419 gbest257.seq
524290651 gbest258.seq
524289252 gbest259.seq
524290962 gbest26.seq
524289552 gbest260.seq
524289295 gbest261.seq
524290025 gbest262.seq
524289056 gbest263.seq
524289340 gbest264.seq
524290273 gbest265.seq
524290692 gbest266.seq
524290593 gbest267.seq
304013408 gbest268.seq
524289118 gbest269.seq
524290823 gbest27.seq
524290386 gbest270.seq
524289338 gbest271.seq
524289093 gbest272.seq
524289191 gbest273.seq
524291274 gbest274.seq
524290320 gbest275.seq
524289441 gbest276.seq
524288720 gbest277.seq
524291786 gbest278.seq
524292357 gbest279.seq
524290986 gbest28.seq
303444702 gbest280.seq
524288806 gbest281.seq
524289465 gbest282.seq
524291427 gbest283.seq
524289043 gbest284.seq
524289273 gbest285.seq
524291921 gbest286.seq
524289560 gbest287.seq
524291096 gbest288.seq
524291595 gbest289.seq
524288873 gbest29.seq
524289521 gbest290.seq
524292345 gbest291.seq
230028401 gbest292.seq
524291443 gbest293.seq
524289210 gbest294.seq
524289376 gbest295.seq
524292344 gbest296.seq
524291052 gbest297.seq
524289205 gbest298.seq
524289507 gbest299.seq
497614745 gbest3.seq
524293425 gbest30.seq
524290651 gbest300.seq
477408747 gbest301.seq
485335496 gbest302.seq
487705325 gbest303.seq
324088175 gbest304.seq
524290622 gbest305.seq
524289347 gbest306.seq
524288739 gbest307.seq
524291455 gbest308.seq
524289193 gbest309.seq
524288990 gbest31.seq
524290707 gbest310.seq
524290194 gbest311.seq
524291512 gbest312.seq
524291328 gbest313.seq
524288963 gbest314.seq
524291085 gbest315.seq
524289293 gbest316.seq
512247904 gbest317.seq
524289717 gbest318.seq
524289980 gbest319.seq
524289250 gbest32.seq
524291519 gbest320.seq
524290352 gbest321.seq
524292211 gbest322.seq
524292067 gbest323.seq
524289903 gbest324.seq
524289793 gbest325.seq
524290614 gbest326.seq
523676537 gbest327.seq
524291720 gbest328.seq
524291358 gbest329.seq
524290812 gbest33.seq
524290916 gbest330.seq
256130098 gbest331.seq
524291473 gbest332.seq
524290448 gbest333.seq
524288765 gbest334.seq
524289071 gbest335.seq
501514475 gbest336.seq
524292250 gbest337.seq
524289781 gbest338.seq
524289493 gbest339.seq
520096417 gbest34.seq
524289459 gbest340.seq
524289296 gbest341.seq
524291258 gbest342.seq
524290520 gbest343.seq
524289241 gbest344.seq
352088251 gbest345.seq
524289878 gbest346.seq
524291635 gbest347.seq
524290464 gbest348.seq
524290429 gbest349.seq
492755506 gbest35.seq
524290603 gbest350.seq
524288921 gbest351.seq
524292363 gbest352.seq
524292050 gbest353.seq
524289388 gbest354.seq
524290841 gbest355.seq
524288827 gbest356.seq
524290980 gbest357.seq
524291056 gbest358.seq
524290178 gbest359.seq
494457393 gbest36.seq
28162295 gbest360.seq
524290789 gbest361.seq
524288850 gbest362.seq
524290707 gbest363.seq
524291607 gbest364.seq
524290436 gbest365.seq
524291330 gbest366.seq
524289980 gbest367.seq
524289856 gbest368.seq
524289392 gbest369.seq
493331108 gbest37.seq
524289999 gbest370.seq
393861390 gbest371.seq
524289473 gbest372.seq
524289235 gbest373.seq
524288858 gbest374.seq
524291147 gbest375.seq
524290120 gbest376.seq
524290134 gbest377.seq
524289761 gbest378.seq
524291888 gbest379.seq
487995595 gbest38.seq
524288810 gbest380.seq
524288739 gbest381.seq
524288874 gbest382.seq
347880742 gbest383.seq
524290089 gbest384.seq
524289614 gbest385.seq
524289804 gbest386.seq
524289949 gbest387.seq
524291224 gbest388.seq
524289312 gbest389.seq
493163256 gbest39.seq
524290523 gbest390.seq
524291207 gbest391.seq
524290058 gbest392.seq
524288854 gbest393.seq
524290878 gbest394.seq
9470193 gbest395.seq
524290463 gbest396.seq
524290848 gbest397.seq
524292048 gbest398.seq
524290041 gbest399.seq
524289662 gbest4.seq
113051462 gbest40.seq
524291225 gbest400.seq
524290603 gbest401.seq
524288979 gbest402.seq
524291463 gbest403.seq
524289750 gbest404.seq
524288748 gbest405.seq
524292003 gbest406.seq
524291353 gbest407.seq
510744193 gbest408.seq
524289160 gbest409.seq
524290480 gbest41.seq
524289249 gbest410.seq
524291855 gbest411.seq
524288743 gbest412.seq
524290951 gbest413.seq
524288763 gbest414.seq
524290994 gbest415.seq
524292141 gbest416.seq
524289822 gbest417.seq
524290920 gbest418.seq
524290495 gbest419.seq
524290973 gbest42.seq
524290708 gbest420.seq
524289655 gbest421.seq
1615669 gbest422.seq
524290650 gbest423.seq
524293084 gbest424.seq
524294089 gbest425.seq
524290343 gbest426.seq
524288764 gbest427.seq
524291194 gbest428.seq
524290702 gbest429.seq
524289229 gbest43.seq
524288911 gbest430.seq
524289310 gbest431.seq
524290674 gbest432.seq
524289885 gbest433.seq
524291489 gbest434.seq
524289367 gbest435.seq
524290778 gbest436.seq
99471304 gbest437.seq
524291032 gbest438.seq
524289088 gbest439.seq
524289545 gbest44.seq
524290745 gbest440.seq
524289423 gbest441.seq
524290129 gbest442.seq
524292094 gbest443.seq
524289685 gbest444.seq
524290730 gbest445.seq
524289158 gbest446.seq
524290523 gbest447.seq
524290347 gbest448.seq
448926530 gbest449.seq
524290769 gbest45.seq
524290868 gbest450.seq
524290680 gbest451.seq
524289782 gbest452.seq
524289302 gbest453.seq
524290549 gbest454.seq
524290097 gbest455.seq
524289542 gbest456.seq
524289292 gbest457.seq
524290473 gbest458.seq
524289097 gbest459.seq
524289986 gbest46.seq
524290616 gbest460.seq
220963691 gbest461.seq
524291320 gbest462.seq
524289550 gbest463.seq
524291062 gbest464.seq
524290235 gbest465.seq
454166198 gbest466.seq
524290140 gbest47.seq
524289860 gbest48.seq
524289953 gbest49.seq
524290143 gbest5.seq
524290738 gbest50.seq
524290875 gbest51.seq
524289810 gbest52.seq
524291209 gbest53.seq
254259872 gbest54.seq
524289037 gbest55.seq
524288886 gbest56.seq
524289337 gbest57.seq
524288769 gbest58.seq
524291772 gbest59.seq
524289793 gbest6.seq
524289548 gbest60.seq
524290418 gbest61.seq
524291456 gbest62.seq
524291057 gbest63.seq
524288771 gbest64.seq
524291140 gbest65.seq
524289937 gbest66.seq
464556890 gbest67.seq
524291162 gbest68.seq
524289808 gbest69.seq
524290279 gbest7.seq
524290591 gbest70.seq
524290628 gbest71.seq
524290204 gbest72.seq
524290002 gbest73.seq
524289809 gbest74.seq
524292150 gbest75.seq
524292057 gbest76.seq
524290008 gbest77.seq
524292038 gbest78.seq
524292213 gbest79.seq
524290687 gbest8.seq
192323249 gbest80.seq
524288774 gbest81.seq
524290921 gbest82.seq
524290327 gbest83.seq
524290563 gbest84.seq
524289592 gbest85.seq
524291383 gbest86.seq
524289519 gbest87.seq
524290029 gbest88.seq
524288742 gbest89.seq
524288917 gbest9.seq
524289390 gbest90.seq
524290309 gbest91.seq
463202912 gbest92.seq
524289112 gbest93.seq
524291750 gbest94.seq
524290922 gbest95.seq
524290562 gbest96.seq
524289364 gbest97.seq
524291422 gbest98.seq
524290470 gbest99.seq
192416273 gbgen.idx
524291268 gbgss1.seq
524289844 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524290642 gbgss103.seq
418357212 gbgss104.seq
524290482 gbgss105.seq
524289251 gbgss106.seq
524291219 gbgss107.seq
524289781 gbgss108.seq
524289085 gbgss109.seq
524291170 gbgss11.seq
524290880 gbgss110.seq
524290939 gbgss111.seq
524289900 gbgss112.seq
524289661 gbgss113.seq
524291245 gbgss114.seq
524289712 gbgss115.seq
55614320 gbgss116.seq
524288977 gbgss117.seq
524291250 gbgss118.seq
524289058 gbgss119.seq
524291525 gbgss12.seq
524289335 gbgss120.seq
524288722 gbgss121.seq
524291210 gbgss122.seq
524288737 gbgss123.seq
524289962 gbgss124.seq
524289662 gbgss125.seq
524290929 gbgss126.seq
524290417 gbgss127.seq
524292083 gbgss128.seq
202072024 gbgss129.seq
524290301 gbgss13.seq
524288727 gbgss130.seq
524291361 gbgss131.seq
524289314 gbgss132.seq
524290882 gbgss133.seq
524290446 gbgss134.seq
524288874 gbgss135.seq
524290572 gbgss136.seq
524291579 gbgss137.seq
524290542 gbgss138.seq
516030223 gbgss139.seq
524290538 gbgss14.seq
516013390 gbgss140.seq
152921702 gbgss141.seq
524289602 gbgss142.seq
524290383 gbgss143.seq
524290643 gbgss144.seq
524289848 gbgss145.seq
524289245 gbgss146.seq
524291649 gbgss147.seq
524290423 gbgss148.seq
524291229 gbgss149.seq
524290893 gbgss15.seq
524289724 gbgss150.seq
524290800 gbgss151.seq
322567846 gbgss152.seq
524291914 gbgss153.seq
279359655 gbgss154.seq
249999034 gbgss155.seq
250000148 gbgss156.seq
250000086 gbgss157.seq
249998834 gbgss158.seq
28885095 gbgss159.seq
524291157 gbgss16.seq
249997137 gbgss160.seq
250000033 gbgss161.seq
249998542 gbgss162.seq
249998333 gbgss163.seq
224919493 gbgss164.seq
249998415 gbgss165.seq
249998761 gbgss166.seq
249999722 gbgss167.seq
249999888 gbgss168.seq
191344183 gbgss169.seq
524289284 gbgss17.seq
249997564 gbgss170.seq
249996752 gbgss171.seq
249999513 gbgss172.seq
249997874 gbgss173.seq
249999326 gbgss174.seq
77035229 gbgss175.seq
249999230 gbgss176.seq
2090297 gbgss177.seq
79542394 gbgss178.seq
249998428 gbgss179.seq
524290445 gbgss18.seq
249999593 gbgss180.seq
87205952 gbgss181.seq
249999685 gbgss182.seq
249998355 gbgss183.seq
249998984 gbgss184.seq
202702168 gbgss185.seq
249999232 gbgss186.seq
249998752 gbgss187.seq
250000079 gbgss188.seq
246010499 gbgss189.seq
315738815 gbgss19.seq
249997836 gbgss190.seq
249998110 gbgss191.seq
249999870 gbgss192.seq
243311140 gbgss193.seq
249999336 gbgss194.seq
249999298 gbgss195.seq
249998180 gbgss196.seq
249999024 gbgss197.seq
122621192 gbgss198.seq
249998013 gbgss199.seq
524291236 gbgss2.seq
524288931 gbgss20.seq
249999792 gbgss200.seq
249998459 gbgss201.seq
249998343 gbgss202.seq
95905540 gbgss203.seq
249999742 gbgss204.seq
249999443 gbgss205.seq
249998384 gbgss206.seq
249999963 gbgss207.seq
183118490 gbgss208.seq
249999236 gbgss209.seq
524288871 gbgss21.seq
249997993 gbgss210.seq
249998006 gbgss211.seq
249999353 gbgss212.seq
95926739 gbgss213.seq
249999461 gbgss214.seq
249999350 gbgss215.seq
249998406 gbgss216.seq
249998619 gbgss217.seq
249999398 gbgss218.seq
249998555 gbgss219.seq
524290551 gbgss22.seq
37426508 gbgss220.seq
249999424 gbgss221.seq
249999963 gbgss222.seq
249997369 gbgss223.seq
43648880 gbgss224.seq
52925443 gbgss225.seq
249997818 gbgss226.seq
249998543 gbgss227.seq
249997629 gbgss228.seq
249998343 gbgss229.seq
524289209 gbgss23.seq
32070531 gbgss230.seq
249997670 gbgss231.seq
249997588 gbgss232.seq
249999018 gbgss233.seq
250000000 gbgss234.seq
28042636 gbgss235.seq
249997661 gbgss236.seq
250000032 gbgss237.seq
249999621 gbgss238.seq
249998725 gbgss239.seq
524290237 gbgss24.seq
250000203 gbgss240.seq
249997935 gbgss241.seq
179555991 gbgss242.seq
249999812 gbgss243.seq
249998926 gbgss244.seq
249999095 gbgss245.seq
220154622 gbgss246.seq
250000034 gbgss247.seq
249997956 gbgss248.seq
250000074 gbgss249.seq
524289518 gbgss25.seq
249999182 gbgss250.seq
249997864 gbgss251.seq
249999567 gbgss252.seq
249998654 gbgss253.seq
141523450 gbgss254.seq
249999562 gbgss255.seq
249998752 gbgss256.seq
249999600 gbgss257.seq
249999029 gbgss258.seq
249999913 gbgss259.seq
524289126 gbgss26.seq
31601752 gbgss260.seq
524291882 gbgss27.seq
524289238 gbgss28.seq
524290063 gbgss29.seq
524291209 gbgss3.seq
524291675 gbgss30.seq
39710031 gbgss31.seq
524289648 gbgss32.seq
524290113 gbgss33.seq
524289714 gbgss34.seq
524289477 gbgss35.seq
524289253 gbgss36.seq
524289803 gbgss37.seq
524290304 gbgss38.seq
509235276 gbgss39.seq
524291248 gbgss4.seq
524291637 gbgss40.seq
524290032 gbgss41.seq
524290785 gbgss42.seq
27290698 gbgss43.seq
524288946 gbgss44.seq
524289968 gbgss45.seq
524288819 gbgss46.seq
524290756 gbgss47.seq
210287820 gbgss48.seq
524288819 gbgss49.seq
168382749 gbgss5.seq
524291634 gbgss50.seq
524290649 gbgss51.seq
524289644 gbgss52.seq
524290504 gbgss53.seq
524289673 gbgss54.seq
524289302 gbgss55.seq
524289323 gbgss56.seq
524289163 gbgss57.seq
524291431 gbgss58.seq
524290523 gbgss59.seq
524290951 gbgss6.seq
9017915 gbgss60.seq
524289679 gbgss61.seq
524290709 gbgss62.seq
524290953 gbgss63.seq
457241977 gbgss64.seq
524290913 gbgss65.seq
524290824 gbgss66.seq
524289288 gbgss67.seq
524290050 gbgss68.seq
524289299 gbgss69.seq
524288756 gbgss7.seq
524291837 gbgss70.seq
524291200 gbgss71.seq
524290900 gbgss72.seq
524290251 gbgss73.seq
524290885 gbgss74.seq
524291499 gbgss75.seq
524288863 gbgss76.seq
37611772 gbgss77.seq
524289713 gbgss78.seq
524291088 gbgss79.seq
524291665 gbgss8.seq
524289188 gbgss80.seq
524289725 gbgss81.seq
524289653 gbgss82.seq
524292093 gbgss83.seq
524289596 gbgss84.seq
524288916 gbgss85.seq
524288845 gbgss86.seq
524292186 gbgss87.seq
524290629 gbgss88.seq
376669558 gbgss89.seq
524290499 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
249991368 gbhtc1.seq
249999254 gbhtc10.seq
249995730 gbhtc11.seq
33328961 gbhtc12.seq
249997337 gbhtc13.seq
249997331 gbhtc14.seq
65975720 gbhtc15.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
84096736 gbhtc8.seq
249996193 gbhtc9.seq
249907861 gbhtg1.seq
249801162 gbhtg10.seq
249917503 gbhtg100.seq
249844960 gbhtg101.seq
249902534 gbhtg102.seq
249987236 gbhtg103.seq
5671243 gbhtg104.seq
249937698 gbhtg105.seq
249890707 gbhtg106.seq
249627730 gbhtg107.seq
249987618 gbhtg108.seq
249997717 gbhtg109.seq
1643239 gbhtg11.seq
249849347 gbhtg110.seq
249960622 gbhtg111.seq
249849747 gbhtg112.seq
249828930 gbhtg113.seq
164547921 gbhtg114.seq
249674352 gbhtg115.seq
249844567 gbhtg116.seq
249991810 gbhtg117.seq
249938336 gbhtg118.seq
249984745 gbhtg119.seq
249888438 gbhtg12.seq
31428922 gbhtg120.seq
249935899 gbhtg121.seq
249834856 gbhtg122.seq
249978158 gbhtg123.seq
249875691 gbhtg124.seq
249782400 gbhtg125.seq
134760056 gbhtg126.seq
249837708 gbhtg127.seq
249847144 gbhtg128.seq
249810959 gbhtg129.seq
249970556 gbhtg13.seq
249845531 gbhtg130.seq
249837450 gbhtg131.seq
249860594 gbhtg132.seq
249888950 gbhtg133.seq
249946060 gbhtg134.seq
249955802 gbhtg135.seq
79177816 gbhtg136.seq
249587437 gbhtg14.seq
249775919 gbhtg15.seq
249742391 gbhtg16.seq
249169910 gbhtg17.seq
249983662 gbhtg18.seq
249677588 gbhtg19.seq
249988506 gbhtg2.seq
249988774 gbhtg20.seq
237145184 gbhtg21.seq
249760635 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761262 gbhtg26.seq
249891641 gbhtg27.seq
249961480 gbhtg28.seq
249842167 gbhtg29.seq
249988698 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249920778 gbhtg33.seq
249929470 gbhtg34.seq
249919058 gbhtg35.seq
249858216 gbhtg36.seq
249814780 gbhtg37.seq
249767485 gbhtg38.seq
249627604 gbhtg39.seq
249766042 gbhtg4.seq
249839726 gbhtg40.seq
224363181 gbhtg41.seq
249889409 gbhtg42.seq
249786859 gbhtg43.seq
249974474 gbhtg44.seq
249775813 gbhtg45.seq
249912495 gbhtg46.seq
249597884 gbhtg47.seq
249994351 gbhtg48.seq
249827710 gbhtg49.seq
249989014 gbhtg5.seq
249881058 gbhtg50.seq
234821578 gbhtg51.seq
249732627 gbhtg52.seq
249917788 gbhtg53.seq
249773218 gbhtg54.seq
249971346 gbhtg55.seq
249962497 gbhtg56.seq
18795863 gbhtg57.seq
249861261 gbhtg58.seq
249823462 gbhtg59.seq
249770427 gbhtg6.seq
249990576 gbhtg60.seq
249921220 gbhtg61.seq
225131043 gbhtg62.seq
249853668 gbhtg63.seq
249787648 gbhtg64.seq
249883720 gbhtg65.seq
249980269 gbhtg66.seq
249833261 gbhtg67.seq
16614633 gbhtg68.seq
249960711 gbhtg69.seq
249852195 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249976832 gbhtg72.seq
225068329 gbhtg73.seq
249811078 gbhtg74.seq
249874983 gbhtg75.seq
249800272 gbhtg76.seq
249959810 gbhtg77.seq
244236596 gbhtg78.seq
249884075 gbhtg79.seq
249758873 gbhtg8.seq
249989775 gbhtg80.seq
249840148 gbhtg81.seq
249838461 gbhtg82.seq
216751403 gbhtg83.seq
249966974 gbhtg84.seq
249803238 gbhtg85.seq
249757894 gbhtg86.seq
249849119 gbhtg87.seq
220831501 gbhtg88.seq
249970341 gbhtg89.seq
249968894 gbhtg9.seq
249954488 gbhtg90.seq
249999471 gbhtg91.seq
249963741 gbhtg92.seq
208664273 gbhtg93.seq
249870413 gbhtg94.seq
249944582 gbhtg95.seq
249904036 gbhtg96.seq
249769960 gbhtg97.seq
167889800 gbhtg98.seq
249744704 gbhtg99.seq
249997994 gbinv1.seq
249998779 gbinv10.seq
249997147 gbinv11.seq
181211291 gbinv12.seq
249998571 gbinv13.seq
249997698 gbinv14.seq
250000222 gbinv15.seq
159576868 gbinv16.seq
249998979 gbinv17.seq
249937190 gbinv18.seq
249998620 gbinv19.seq
249820761 gbinv2.seq
250000063 gbinv20.seq
249999708 gbinv21.seq
8325474 gbinv22.seq
223386781 gbinv23.seq
175506967 gbinv24.seq
249998586 gbinv25.seq
250000147 gbinv26.seq
95435064 gbinv27.seq
250000137 gbinv28.seq
249997830 gbinv29.seq
228922623 gbinv3.seq
249996993 gbinv30.seq
249996645 gbinv31.seq
151252255 gbinv32.seq
249995524 gbinv4.seq
249999391 gbinv5.seq
249669363 gbinv6.seq
249998755 gbinv7.seq
25492259 gbinv8.seq
249998824 gbinv9.seq
139740207 gbjou1.idx
307006662 gbjou10.idx
269993860 gbjou11.idx
279962146 gbjou12.idx
88048570 gbjou13.idx
139586757 gbjou2.idx
206596190 gbjou3.idx
167967740 gbjou4.idx
269708758 gbjou5.idx
278548852 gbjou6.idx
283359684 gbjou7.idx
274356026 gbjou8.idx
302235094 gbjou9.idx
352024546 gbkey1.idx
180083269 gbkey2.idx
179443187 gbkey3.idx
241334063 gbkey4.idx
189291223 gbkey5.idx
183447654 gbkey6.idx
118219642 gbkey7.idx
249989011 gbmam1.seq
249999873 gbmam2.seq
249853602 gbmam3.seq
249999107 gbmam4.seq
250000063 gbmam5.seq
249999760 gbmam6.seq
249998460 gbmam7.seq
48855452 gbmam8.seq
37399512 gbnew.txt
249997686 gbpat1.seq
249999417 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192957204 gbpat107.seq
250000153 gbpat108.seq
249999625 gbpat109.seq
179605660 gbpat11.seq
249995093 gbpat110.seq
80149323 gbpat111.seq
249999706 gbpat112.seq
249999145 gbpat113.seq
249992347 gbpat114.seq
250000102 gbpat115.seq
249868822 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
249999635 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
249999107 gbpat13.seq
249997452 gbpat130.seq
66832984 gbpat131.seq
249992315 gbpat132.seq
249999867 gbpat133.seq
250000197 gbpat134.seq
249999821 gbpat135.seq
249998337 gbpat136.seq
18437114 gbpat137.seq
249999655 gbpat138.seq
249998828 gbpat139.seq
249999899 gbpat14.seq
249999803 gbpat140.seq
249999630 gbpat141.seq
249999242 gbpat142.seq
71930533 gbpat143.seq
249998039 gbpat144.seq
250000068 gbpat145.seq
250000067 gbpat146.seq
86028783 gbpat147.seq
249999922 gbpat148.seq
249999791 gbpat149.seq
249999657 gbpat15.seq
250000047 gbpat150.seq
63545113 gbpat151.seq
249999561 gbpat152.seq
249997572 gbpat153.seq
250000074 gbpat154.seq
249999246 gbpat155.seq
249999515 gbpat156.seq
250000164 gbpat157.seq
222294841 gbpat158.seq
250000249 gbpat159.seq
249999146 gbpat16.seq
249999893 gbpat160.seq
249999893 gbpat161.seq
220539897 gbpat162.seq
249999753 gbpat163.seq
249998700 gbpat164.seq
249999436 gbpat165.seq
12392193 gbpat166.seq
249997274 gbpat167.seq
249998906 gbpat168.seq
250000046 gbpat169.seq
65942979 gbpat17.seq
249998713 gbpat170.seq
35425686 gbpat171.seq
249998924 gbpat172.seq
249998987 gbpat173.seq
249999240 gbpat174.seq
249999114 gbpat175.seq
249999239 gbpat176.seq
249999751 gbpat177.seq
83399607 gbpat178.seq
250000132 gbpat179.seq
250000027 gbpat18.seq
249999617 gbpat180.seq
249998297 gbpat181.seq
140780844 gbpat182.seq
249999801 gbpat19.seq
249997564 gbpat2.seq
250000170 gbpat20.seq
249994457 gbpat21.seq
186148505 gbpat22.seq
250000226 gbpat23.seq
249965771 gbpat24.seq
250000021 gbpat25.seq
249999899 gbpat26.seq
71267866 gbpat27.seq
249992472 gbpat28.seq
249999281 gbpat29.seq
249999687 gbpat3.seq
249998562 gbpat30.seq
249999169 gbpat31.seq
249999668 gbpat32.seq
180220217 gbpat33.seq
249999085 gbpat34.seq
249999204 gbpat35.seq
249999854 gbpat36.seq
249998515 gbpat37.seq
130550573 gbpat38.seq
249997033 gbpat39.seq
249995996 gbpat4.seq
249995003 gbpat40.seq
249998829 gbpat41.seq
249999347 gbpat42.seq
249994544 gbpat43.seq
249899127 gbpat44.seq
249999190 gbpat45.seq
249999007 gbpat46.seq
171471303 gbpat47.seq
249998371 gbpat48.seq
249997524 gbpat49.seq
71719615 gbpat5.seq
249999853 gbpat50.seq
249999528 gbpat51.seq
222937739 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164995174 gbpat56.seq
249886561 gbpat57.seq
249999993 gbpat58.seq
250000063 gbpat59.seq
249999527 gbpat6.seq
250000158 gbpat60.seq
135004984 gbpat61.seq
249998945 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999682 gbpat67.seq
144886744 gbpat68.seq
250000135 gbpat69.seq
250000106 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244400042 gbpat72.seq
248969066 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999925 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249994100 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
249996792 gbpat82.seq
249999999 gbpat83.seq
93339777 gbpat84.seq
249156430 gbpat85.seq
249999629 gbpat86.seq
249999561 gbpat87.seq
249999368 gbpat88.seq
249999290 gbpat89.seq
249999825 gbpat9.seq
249999957 gbpat90.seq
145297619 gbpat91.seq
249999467 gbpat92.seq
249998980 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196964910 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
204391061 gbphg1.seq
249997289 gbpln1.seq
249998624 gbpln10.seq
249999177 gbpln11.seq
249996314 gbpln12.seq
249878239 gbpln13.seq
214583978 gbpln14.seq
249969765 gbpln15.seq
249989406 gbpln16.seq
249992843 gbpln17.seq
249927146 gbpln18.seq
249993801 gbpln19.seq
249789662 gbpln2.seq
249952454 gbpln20.seq
249993183 gbpln21.seq
33983540 gbpln22.seq
249996898 gbpln23.seq
97740629 gbpln24.seq
249996192 gbpln25.seq
249998130 gbpln26.seq
249822988 gbpln27.seq
221260740 gbpln28.seq
181007284 gbpln29.seq
249972721 gbpln3.seq
249962159 gbpln30.seq
249999937 gbpln31.seq
249996998 gbpln32.seq
249726673 gbpln33.seq
249999617 gbpln34.seq
121994485 gbpln35.seq
249999436 gbpln36.seq
249998874 gbpln37.seq
249997293 gbpln38.seq
249998580 gbpln39.seq
249938569 gbpln4.seq
143837735 gbpln40.seq
249908388 gbpln41.seq
249928598 gbpln42.seq
249999097 gbpln43.seq
249998190 gbpln44.seq
244951649 gbpln45.seq
218760808 gbpln46.seq
249998480 gbpln47.seq
249998913 gbpln48.seq
249997243 gbpln49.seq
249892773 gbpln5.seq
249999193 gbpln50.seq
234337109 gbpln51.seq
249999809 gbpln52.seq
249999259 gbpln53.seq
249998876 gbpln54.seq
249997706 gbpln55.seq
249999895 gbpln56.seq
230009562 gbpln57.seq
249937073 gbpln6.seq
249726262 gbpln7.seq
250000107 gbpln8.seq
85984779 gbpln9.seq
148964268 gbpri1.seq
249995439 gbpri10.seq
130148157 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902715 gbpri16.seq
249876249 gbpri17.seq
249992266 gbpri18.seq
249904039 gbpri19.seq
249974672 gbpri2.seq
249955187 gbpri20.seq
249970172 gbpri21.seq
249999032 gbpri22.seq
52238038 gbpri23.seq
177491553 gbpri24.seq
249998613 gbpri25.seq
211357951 gbpri26.seq
249986508 gbpri27.seq
249988068 gbpri28.seq
249948643 gbpri29.seq
249819692 gbpri3.seq
249935305 gbpri30.seq
249896084 gbpri31.seq
249967755 gbpri32.seq
249968207 gbpri33.seq
249985609 gbpri34.seq
99003565 gbpri35.seq
249993971 gbpri36.seq
249997177 gbpri37.seq
249923472 gbpri38.seq
249994486 gbpri39.seq
249982802 gbpri4.seq
249998147 gbpri40.seq
183823873 gbpri41.seq
250000250 gbpri42.seq
250000123 gbpri43.seq
249987456 gbpri44.seq
63418592 gbpri45.seq
249741329 gbpri5.seq
249854494 gbpri6.seq
249967390 gbpri7.seq
249797768 gbpri8.seq
249977029 gbpri9.seq
329828 gbrel.txt
249760784 gbrod1.seq
249890064 gbrod10.seq
63086316 gbrod11.seq
249871284 gbrod12.seq
249783783 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249885197 gbrod17.seq
249706828 gbrod18.seq
247511646 gbrod19.seq
249927954 gbrod2.seq
249768824 gbrod20.seq
249924095 gbrod21.seq
230194968 gbrod22.seq
249999848 gbrod23.seq
249997092 gbrod24.seq
249953950 gbrod25.seq
249874716 gbrod26.seq
249999436 gbrod27.seq
249998663 gbrod28.seq
223550372 gbrod29.seq
249846934 gbrod3.seq
249801207 gbrod4.seq
249878898 gbrod5.seq
249894478 gbrod6.seq
249944880 gbrod7.seq
249973808 gbrod8.seq
249999120 gbrod9.seq
4442769309 gbsdr1.txt
5884035056 gbsdr2.txt
2757232054 gbsdr3.txt
148404862 gbsec.idx
249996472 gbsts1.seq
249997720 gbsts10.seq
210919464 gbsts11.seq
249996524 gbsts12.seq
249998812 gbsts13.seq
249999881 gbsts14.seq
249999569 gbsts15.seq
24453604 gbsts16.seq
249999107 gbsts17.seq
249999726 gbsts18.seq
249998944 gbsts19.seq
249998310 gbsts2.seq
148773003 gbsts20.seq
250000245 gbsts3.seq
249996479 gbsts4.seq
39285911 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249999304 gbsts9.seq
249998417 gbsyn1.seq
249996075 gbsyn2.seq
249992504 gbsyn3.seq
249992730 gbsyn4.seq
249976202 gbsyn5.seq
249962268 gbsyn6.seq
140691964 gbsyn7.seq
249998949 gbtsa1.seq
39481017 gbtsa10.seq
249997488 gbtsa11.seq
249995952 gbtsa12.seq
249999450 gbtsa13.seq
249999867 gbtsa14.seq
238037462 gbtsa15.seq
249998569 gbtsa16.seq
249998880 gbtsa17.seq
249999066 gbtsa18.seq
249993881 gbtsa19.seq
249997872 gbtsa2.seq
175705543 gbtsa20.seq
249999624 gbtsa21.seq
250000148 gbtsa22.seq
249999827 gbtsa23.seq
249999941 gbtsa24.seq
249997979 gbtsa25.seq
249998502 gbtsa26.seq
40016328 gbtsa27.seq
249998953 gbtsa28.seq
250000012 gbtsa29.seq
249998023 gbtsa3.seq
249999898 gbtsa30.seq
249998409 gbtsa31.seq
249999390 gbtsa32.seq
249999600 gbtsa33.seq
249999882 gbtsa34.seq
4192477 gbtsa35.seq
249996808 gbtsa36.seq
249999333 gbtsa37.seq
249999623 gbtsa38.seq
249996941 gbtsa39.seq
249998575 gbtsa4.seq
62862028 gbtsa40.seq
249998923 gbtsa41.seq
249999080 gbtsa42.seq
249998601 gbtsa43.seq
249998012 gbtsa44.seq
74419671 gbtsa45.seq
249999615 gbtsa46.seq
249997841 gbtsa47.seq
249997974 gbtsa48.seq
249999733 gbtsa49.seq
89226644 gbtsa5.seq
250000051 gbtsa50.seq
249998951 gbtsa51.seq
249998367 gbtsa52.seq
162692273 gbtsa53.seq
249999165 gbtsa54.seq
249999807 gbtsa55.seq
250000157 gbtsa56.seq
249997931 gbtsa57.seq
249997382 gbtsa58.seq
249999902 gbtsa59.seq
249998268 gbtsa6.seq
211805636 gbtsa60.seq
249999394 gbtsa61.seq
249998952 gbtsa62.seq
249999194 gbtsa63.seq
249997286 gbtsa64.seq
249994947 gbtsa65.seq
249999039 gbtsa66.seq
249999769 gbtsa67.seq
241066495 gbtsa68.seq
249998385 gbtsa69.seq
249999386 gbtsa7.seq
249999307 gbtsa70.seq
249998418 gbtsa71.seq
249999196 gbtsa72.seq
250000195 gbtsa73.seq
249998576 gbtsa74.seq
220923327 gbtsa75.seq
249998956 gbtsa76.seq
249998196 gbtsa77.seq
249999461 gbtsa78.seq
239607201 gbtsa79.seq
250000131 gbtsa8.seq
249998447 gbtsa80.seq
249998843 gbtsa81.seq
249999713 gbtsa82.seq
249998691 gbtsa83.seq
244524991 gbtsa84.seq
249998567 gbtsa85.seq
249999625 gbtsa86.seq
249999647 gbtsa87.seq
249997596 gbtsa88.seq
223760067 gbtsa89.seq
250000161 gbtsa9.seq
249999535 gbtsa90.seq
249998914 gbtsa91.seq
250000173 gbtsa92.seq
249999583 gbtsa93.seq
249999643 gbtsa94.seq
249999044 gbtsa95.seq
199437195 gbtsa96.seq
496438 gbuna1.seq
249995862 gbvrl1.seq
249997976 gbvrl10.seq
223493200 gbvrl11.seq
249994824 gbvrl12.seq
249998100 gbvrl13.seq
249998623 gbvrl14.seq
249998854 gbvrl15.seq
155773879 gbvrl16.seq
249993876 gbvrl17.seq
249998098 gbvrl18.seq
249885152 gbvrl19.seq
249997531 gbvrl2.seq
249997360 gbvrl20.seq
230771280 gbvrl21.seq
249997456 gbvrl3.seq
249995796 gbvrl4.seq
196748139 gbvrl5.seq
249999515 gbvrl6.seq
249998362 gbvrl7.seq
249985287 gbvrl8.seq
249997221 gbvrl9.seq
249874317 gbvrt1.seq
249855727 gbvrt10.seq
249950363 gbvrt11.seq
185412106 gbvrt12.seq
249994619 gbvrt13.seq
249897444 gbvrt14.seq
249972959 gbvrt15.seq
249998719 gbvrt16.seq
249998845 gbvrt17.seq
249998625 gbvrt18.seq
99005938 gbvrt19.seq
249763404 gbvrt2.seq
249993758 gbvrt20.seq
249998351 gbvrt21.seq
249995660 gbvrt22.seq
249998411 gbvrt23.seq
249999533 gbvrt24.seq
249999942 gbvrt25.seq
249998483 gbvrt26.seq
67203972 gbvrt27.seq
249925189 gbvrt3.seq
249971864 gbvrt4.seq
108369374 gbvrt5.seq
249999162 gbvrt6.seq
249995379 gbvrt7.seq
249866684 gbvrt8.seq
249793190 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 64023 86300155
BCT10 66 116730258
BCT11 73 110421436
BCT12 116 114824687
BCT13 43 115610209
BCT14 16098 29879523
BCT15 53933 85390803
BCT16 93 110189094
BCT17 151 93915681
BCT18 61 112455059
BCT19 52 112042350
BCT2 7028 108523942
BCT20 46 114233015
BCT21 58 114931588
BCT22 67 111284815
BCT23 36 96325907
BCT24 40 106881287
BCT25 58 105533856
BCT26 74 111675186
BCT27 55 110045255
BCT28 63 106845575
BCT29 55 109391288
BCT3 52 112760544
BCT30 53 108650404
BCT31 46 110496749
BCT32 95 109522868
BCT33 59 110966729
BCT34 67 108616570
BCT35 124 106350090
BCT36 37 71643089
BCT37 200 108779787
BCT38 53 109969009
BCT39 38 108760252
BCT4 56 109240941
BCT40 58 108566760
BCT41 56 107056790
BCT42 45 111019867
BCT43 76 108801182
BCT44 59 105114885
BCT45 45 107106306
BCT46 59 105661869
BCT47 80 110031975
BCT48 76 103598262
BCT49 68 110616305
BCT5 38315 81650251
BCT50 66 105738712
BCT51 49 103628191
BCT52 53 107838942
BCT53 54 106293899
BCT54 66 108084602
BCT55 62 106537062
BCT56 51 108151942
BCT57 61 114343592
BCT58 72 111881349
BCT59 52 106635495
BCT6 39042 82648391
BCT60 55 109631466
BCT61 24 29766607
BCT62 37 108301494
BCT63 51 114579812
BCT64 51 110641147
BCT65 94 115116012
BCT66 87 116727452
BCT67 224 103978750
BCT68 378 79770713
BCT69 1589 2511877
BCT7 5518 94828825
BCT70 3179 5215895
BCT71 6347 7902811
BCT72 12648 15076979
BCT73 25628 27748204
BCT74 50524 54025639
BCT75 76196 77916541
BCT76 71347 77183377
BCT77 9861 94273623
BCT78 5443 100112703
BCT79 3204 106888908
BCT8 13774 81523996
BCT80 38 115045720
BCT81 2906 111081668
BCT82 9382 104505691
BCT83 36434 36376690
BCT84 68473 83704518
BCT85 21460 116768471
BCT86 76018 79077590
BCT87 76898 78787780
BCT88 56583 88457247
BCT89 8707 16032019
BCT9 6838 96099579
ENV1 94157 70620469
ENV10 83206 87346718
ENV11 20753 17759630
ENV12 84731 80836816
ENV13 118374 43043542
ENV14 89191 77243957
ENV15 96516 67725185
ENV16 96174 63451257
ENV17 110608 66897332
ENV18 116009 68435975
ENV19 55188 74519286
ENV2 94588 68178071
ENV20 67984 87506640
ENV21 91110 74607046
ENV22 128245 34579383
ENV23 123050 29085485
ENV24 77951 17879768
ENV25 123125 49854998
ENV26 97612 67850071
ENV27 115923 56090834
ENV28 136462 52689159
ENV29 108233 61860390
ENV3 84870 76331335
ENV30 67628 50497266
ENV31 62536 84995133
ENV32 88979 73398903
ENV33 102630 44139292
ENV34 96840 56263320
ENV35 70682 54665936
ENV36 111348 47246661
ENV37 101239 61328081
ENV38 107377 63802320
ENV39 63529 90706905
ENV4 81825 83753532
ENV40 72612 78784068
ENV41 62033 84252434
ENV42 10676 14557450
ENV43 71796 79120799
ENV44 108689 48868393
ENV45 112195 56839537
ENV46 104940 61108997
ENV47 71208 37730853
ENV48 100296 43940158
ENV49 42748 53871722
ENV5 88276 85772107
ENV50 42393 55126018
ENV51 61118 57433289
ENV52 100749 58836729
ENV53 99224 60906557
ENV54 78157 84056952
ENV55 85400 68747440
ENV6 102003 64851633
ENV7 131426 31030828
ENV8 86281 70412298
ENV9 93252 72994590
EST1 158919 61572670
EST10 167139 71988367
EST100 231728 140759569
EST101 237801 124862161
EST102 190125 104227327
EST103 184379 101957621
EST104 103261 71909704
EST105 160239 119708147
EST106 172277 105508441
EST107 134982 84815980
EST108 64410 24031603
EST109 63776 22431101
EST11 169721 74099220
EST110 64299 23288677
EST111 64315 27069250
EST112 64824 23107445
EST113 65040 24790630
EST114 63924 27180737
EST115 64305 26429609
EST116 64500 27444790
EST117 64330 25257006
EST118 61686 34908256
EST119 143119 68966800
EST12 166645 70031758
EST120 160888 84978304
EST121 176958 92875029
EST122 149343 96402797
EST123 156321 91867642
EST124 120438 78337241
EST125 189413 90793267
EST126 156145 83080662
EST127 157306 84448927
EST128 156483 84633958
EST129 151624 85035499
EST13 73170 35019205
EST130 172887 92812017
EST131 183357 116989628
EST132 202615 102418677
EST133 159032 87132031
EST134 163127 82940607
EST135 142121 83541380
EST136 144981 89677687
EST137 100783 53708840
EST138 173428 97947123
EST139 245172 113120967
EST14 217762 109290584
EST140 154604 83537274
EST141 167336 92309071
EST142 150626 88071169
EST143 133615 81724435
EST144 154277 96721519
EST145 155909 85640307
EST146 124542 63436663
EST147 121488 65223250
EST148 127999 58055303
EST149 127406 51314130
EST15 168655 105349955
EST150 128755 51319039
EST151 114837 42807339
EST152 163817 82670544
EST153 176181 73813138
EST154 162328 110225101
EST155 199962 122662852
EST156 214261 121762969
EST157 175421 97157634
EST158 154757 108204674
EST159 141933 95124899
EST16 179296 112569356
EST160 154695 96138112
EST161 157562 82566102
EST162 139288 78415936
EST163 167588 93187425
EST164 72140 44758761
EST165 150024 91750788
EST166 191856 110266805
EST167 145719 83906641
EST168 142842 72416347
EST169 148917 87011046
EST17 195484 113305036
EST170 190780 104720629
EST171 156407 95939391
EST172 168547 82345406
EST173 125072 86535552
EST174 169942 99561534
EST175 173296 100700285
EST176 122553 68069085
EST177 157101 90321335
EST178 36887 21447512
EST179 169723 102566855
EST18 190689 121250690
EST180 180464 118982955
EST181 143356 116914512
EST182 196498 100138569
EST183 153047 103333944
EST184 154522 101382113
EST185 141221 81639672
EST186 175991 71262570
EST187 150655 84670067
EST188 157789 99613782
EST189 155722 96122423
EST19 159213 114020404
EST190 139680 83099771
EST191 163230 98669848
EST192 145538 93176883
EST193 129268 90353568
EST194 144223 88150140
EST195 135853 88473654
EST196 129805 92785273
EST197 162728 86807149
EST198 173959 95600247
EST199 173380 96534986
EST2 161834 61542584
EST20 186760 99319386
EST200 171666 95206579
EST201 168840 95366744
EST202 171392 95593144
EST203 173219 95038890
EST204 173942 95721578
EST205 26180 14203519
EST206 188671 105136467
EST207 204803 104615997
EST208 172190 101986311
EST209 180084 101649739
EST21 216941 106358784
EST210 201541 123057061
EST211 194262 112145991
EST212 193147 123702308
EST213 157157 103905937
EST214 218808 141912449
EST215 235844 114373628
EST216 146330 103402447
EST217 162283 109338394
EST218 147437 94925068
EST219 177637 98545831
EST22 198878 65987328
EST220 189807 118129067
EST221 111631 87725636
EST222 134719 121245690
EST223 160091 93040853
EST224 148057 95112847
EST225 194896 107670998
EST226 166401 104029401
EST227 134166 92480302
EST228 142052 105266602
EST229 121259 87259918
EST23 140948 40079855
EST230 89564 60495311
EST231 144756 89901526
EST232 132134 93883405
EST233 142363 101348184
EST234 120291 86696241
EST235 125399 84261145
EST236 153462 106153945
EST237 160147 115715857
EST238 118657 122169529
EST239 148257 89260403
EST24 103791 28101789
EST240 183038 118548215
EST241 151183 92542662
EST242 170653 107961119
EST243 166906 121558135
EST244 146756 107297476
EST245 15207 11283307
EST246 155091 99909073
EST247 210601 97235690
EST248 188435 111507702
EST249 151707 87159473
EST25 121292 50795226
EST250 220321 27323623
EST251 221201 90124604
EST252 163550 120656457
EST253 174887 102436142
EST254 161850 107587017
EST255 175548 115323814
EST256 156669 114553096
EST257 100111 54409670
EST258 184698 97080252
EST259 177237 103967491
EST26 213500 97049458
EST260 165698 119891172
EST261 212708 102652858
EST262 271077 118307010
EST263 210856 121524905
EST264 182227 41698625
EST265 243468 111141786
EST266 170359 98312871
EST267 168002 105176770
EST268 93669 58665790
EST269 165524 113939504
EST27 218821 110002855
EST270 198843 103230021
EST271 155496 105949402
EST272 195505 115046936
EST273 197207 50021956
EST274 208525 42270051
EST275 181450 103150334
EST276 169715 114902505
EST277 185967 115664199
EST278 181669 109075674
EST279 156923 101674564
EST28 190222 88557556
EST280 108016 37489039
EST281 143438 86863446
EST282 119048 79228177
EST283 155888 106003528
EST284 246811 37265763
EST285 263884 24184990
EST286 168681 90618179
EST287 167316 109826584
EST288 161011 104208316
EST289 147332 91885738
EST29 158134 68950708
EST290 263250 38100500
EST291 175512 96532760
EST292 66272 49969506
EST293 193918 110576399
EST294 143091 78600748
EST295 182707 119513079
EST296 183812 112244338
EST297 153383 111911082
EST298 191551 106971546
EST299 178091 99988659
EST3 153587 54414675
EST30 171771 69726547
EST300 174360 110359114
EST301 189004 63459702
EST302 187071 68925169
EST303 187624 72914872
EST304 126701 45877615
EST305 191186 89789810
EST306 179959 126342388
EST307 159074 93171886
EST308 155080 90650973
EST309 127508 98608836
EST31 148797 63215044
EST310 148586 98740908
EST311 164316 100202429
EST312 165391 92670857
EST313 171382 103154641
EST314 150012 98425268
EST315 149765 101360164
EST316 164019 107347796
EST317 153293 106108676
EST318 180015 152085522
EST319 173069 113569587
EST32 168204 76007457
EST320 141864 76093338
EST321 143267 97633029
EST322 144940 99524668
EST323 132580 89339481
EST324 149017 99301101
EST325 149370 101464336
EST326 177912 111574766
EST327 151539 83344017
EST328 150623 86430767
EST329 152009 106654162
EST33 173590 66342519
EST330 155605 97750124
EST331 78190 47046178
EST332 142938 90533374
EST333 142785 89580287
EST334 208523 112186140
EST335 131114 72332785
EST336 92124 55354642
EST337 131208 86750698
EST338 137757 87403456
EST339 124459 79399589
EST34 123630 43748008
EST340 163475 85784712
EST341 214584 84217029
EST342 168122 87446104
EST343 173486 104249423
EST344 163053 97361603
EST345 85636 57128214
EST346 132838 88506987
EST347 136171 89007999
EST348 188778 121616312
EST349 156801 96050905
EST35 97392 29902012
EST350 161988 80812428
EST351 186196 130527859
EST352 111720 76416614
EST353 73442 43711500
EST354 140989 78231962
EST355 130268 77824324
EST356 149481 54909609
EST357 158537 32630477
EST358 158527 32642395
EST359 183121 110647129
EST36 97797 30573877
EST360 10250 6991814
EST361 228691 116964140
EST362 250968 114628779
EST363 198095 103873366
EST364 146808 94519207
EST365 136109 87033193
EST366 146552 86974859
EST367 183706 113625571
EST368 225548 78495744
EST369 187723 99984010
EST37 96709 29349638
EST370 213516 119326353
EST371 157578 87421421
EST372 141951 67349447
EST373 205653 122282110
EST374 146226 92870965
EST375 183586 135518404
EST376 181450 141135185
EST377 160974 101687333
EST378 163810 102115724
EST379 185244 109372563
EST38 98626 29830415
EST380 186009 108385342
EST381 203489 108141702
EST382 178879 108266580
EST383 142728 84610036
EST384 187268 125000491
EST385 203697 137424548
EST386 226807 130044242
EST387 202907 136766304
EST388 208703 168554231
EST389 210956 131861759
EST39 99404 31247076
EST390 166979 103696464
EST391 184889 89450447
EST392 168479 13181383
EST393 157194 13613768
EST394 157840 29133329
EST395 2853 614114
EST396 158883 31792957
EST397 158595 32477090
EST398 148173 85844790
EST399 181441 107502464
EST4 170787 67086973
EST40 23403 5963435
EST400 163635 113119579
EST401 166856 97307686
EST402 153768 106201311
EST403 140153 97690172
EST404 145218 96224748
EST405 168402 113796691
EST406 145087 102095438
EST407 173694 102686577
EST408 167866 40683476
EST409 165547 51532130
EST41 101029 52983886
EST410 156956 108554392
EST411 163014 101869502
EST412 164410 107606660
EST413 147013 88313056
EST414 196885 119421467
EST415 148342 101305834
EST416 132948 91230993
EST417 149581 93278217
EST418 156855 94366497
EST419 172239 93195067
EST42 119521 50857311
EST420 164963 97160954
EST421 160486 94146100
EST422 673 304270
EST423 174001 106173030
EST424 141673 88488064
EST425 101906 72734553
EST426 80722 62089908
EST427 102934 68130742
EST428 158252 87358726
EST429 126134 76291358
EST43 165793 91722936
EST430 138720 90884435
EST431 141337 83158336
EST432 163291 96792766
EST433 156136 86128304
EST434 196508 116080345
EST435 126593 85154181
EST436 187356 98955956
EST437 29541 10548709
EST438 186196 98100931
EST439 154065 83939835
EST44 170223 72275932
EST440 167860 97556007
EST441 218392 128256777
EST442 161991 110280228
EST443 168965 102538178
EST444 140160 91992718
EST445 135626 91965412
EST446 176847 77678042
EST447 189332 82280456
EST448 206169 86518307
EST449 173468 73158362
EST45 167188 84798545
EST450 189198 95751169
EST451 179355 105187217
EST452 188896 88917094
EST453 185345 84936426
EST454 211759 121067096
EST455 172982 110361705
EST456 182519 108190694
EST457 202515 118813917
EST458 134492 100187068
EST459 147699 89461489
EST46 168563 86873694
EST460 193608 99577652
EST461 63317 35634708
EST462 156582 86613484
EST463 158704 82744926
EST464 178165 87321226
EST465 168655 59192174
EST466 140747 55007416
EST47 163202 87803502
EST48 162154 83297368
EST49 160118 91074838
EST5 168952 66190553
EST50 161551 88079945
EST51 157123 98918672
EST52 159530 69786594
EST53 145757 81585881
EST54 78248 50659900
EST55 167004 69859769
EST56 164692 74783033
EST57 164330 90722931
EST58 159162 97161813
EST59 156479 101499332
EST6 171459 66908856
EST60 164595 98911060
EST61 160084 108009513
EST62 171075 81433531
EST63 173111 92401904
EST64 155484 84166361
EST65 148901 81874464
EST66 158740 98434651
EST67 136342 77286323
EST68 149420 91681634
EST69 194824 108042916
EST7 169819 72790359
EST70 180871 95053131
EST71 221041 121169337
EST72 185576 110619219
EST73 203840 121313745
EST74 163292 90035123
EST75 134013 61454330
EST76 139681 68743367
EST77 154485 93935567
EST78 157730 100224222
EST79 141898 78481824
EST8 179312 72807406
EST80 53314 24842814
EST81 164056 100445757
EST82 211918 114778154
EST83 223622 123686716
EST84 200498 94290611
EST85 211038 93323964
EST86 162190 92841516
EST87 144113 86867191
EST88 164214 81063373
EST89 158059 79860827
EST9 168640 69363511
EST90 152890 102069413
EST91 152102 88933690
EST92 135245 87208674
EST93 156061 113043996
EST94 142346 104167361
EST95 143182 102384042
EST96 141144 97523162
EST97 147023 80990119
EST98 178711 111264699
EST99 224239 135790483
GSS1 200049 87610619
GSS10 132038 60282099
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167238 128921102
GSS104 149783 82569304
GSS105 191526 120853400
GSS106 167739 112119335
GSS107 197325 115523214
GSS108 204973 134770012
GSS109 209813 138224231
GSS11 137026 73963370
GSS110 207578 140849159
GSS111 206236 142443289
GSS112 205249 143740479
GSS113 205178 143934182
GSS114 202120 146641207
GSS115 182321 139892606
GSS116 18426 10881931
GSS117 132846 84050698
GSS118 169072 79781623
GSS119 184204 79238716
GSS12 147892 75892995
GSS120 170230 148231065
GSS121 177342 120228560
GSS122 180008 146282290
GSS123 187336 120423257
GSS124 187090 139433568
GSS125 192188 127013290
GSS126 191924 93005866
GSS127 167706 156841329
GSS128 163313 113710801
GSS129 62172 37870488
GSS13 145394 68606312
GSS130 171035 155492836
GSS131 172358 154451939
GSS132 172393 155154973
GSS133 173792 154156214
GSS134 171958 154859390
GSS135 181184 139199308
GSS136 178330 146221282
GSS137 166000 119339079
GSS138 190342 95481284
GSS139 265734 40968643
GSS14 169793 84763419
GSS140 265732 40957724
GSS141 78778 12099649
GSS142 254320 58600070
GSS143 260133 56300171
GSS144 191914 86087031
GSS145 196593 66971541
GSS146 186705 148709868
GSS147 182550 151069668
GSS148 168001 155188007
GSS149 171122 157880040
GSS15 161094 97661031
GSS150 235918 71543717
GSS151 227234 80563555
GSS152 135510 55573887
GSS153 178882 71469419
GSS154 78517 48535763
GSS155 87101 63965498
GSS156 83558 62804555
GSS157 103650 48608393
GSS158 68607 58482786
GSS159 7739 7073908
GSS16 172835 87034673
GSS160 68591 57924394
GSS161 69224 56650935
GSS162 69460 56187403
GSS163 71202 55998401
GSS164 68561 51865315
GSS165 75915 58209304
GSS166 87237 74898207
GSS167 81504 44375177
GSS168 92239 44894040
GSS169 63973 47973862
GSS17 183363 113392831
GSS170 77367 61295678
GSS171 69656 58696022
GSS172 67712 62704471
GSS173 61920 53368409
GSS174 95643 42963254
GSS175 21165 4933990
GSS176 112938 70877522
GSS177 822 559311
GSS178 23226 28867035
GSS179 109092 70683886
GSS18 192347 114304499
GSS180 84555 34682016
GSS181 35744 22177639
GSS182 103304 62490220
GSS183 102329 63761256
GSS184 104268 67656826
GSS185 82099 41276456
GSS186 83102 54651503
GSS187 95684 61343347
GSS188 107373 78577773
GSS189 106314 76646515
GSS19 114273 52228513
GSS190 106101 79982459
GSS191 104015 80025091
GSS192 76402 51055333
GSS193 104482 63232426
GSS194 109868 66415305
GSS195 106206 59314004
GSS196 68379 37446316
GSS197 69530 38713112
GSS198 37187 17797457
GSS199 85481 46023427
GSS2 182295 92190515
GSS20 181787 101769657
GSS200 96935 55799967
GSS201 95009 49632000
GSS202 95897 55649530
GSS203 42678 23961360
GSS204 114055 43442995
GSS205 116422 39251295
GSS206 108882 55041759
GSS207 101472 78371349
GSS208 72643 46689469
GSS209 95891 36542252
GSS21 166208 114174113
GSS210 95417 37268709
GSS211 96671 35161518
GSS212 94285 39167432
GSS213 37736 17626556
GSS214 103939 66277823
GSS215 94551 61190929
GSS216 95128 60357048
GSS217 94773 60868501
GSS218 75675 70017159
GSS219 76647 71905251
GSS22 169505 97608334
GSS220 10134 14862506
GSS221 83736 28233267
GSS222 84219 27346468
GSS223 84926 25909272
GSS224 14851 4422302
GSS225 16547 7508221
GSS226 92128 59308050
GSS227 84494 52388719
GSS228 94098 50827589
GSS229 88585 48343496
GSS23 187250 126684076
GSS230 11366 6197879
GSS231 90648 56882510
GSS232 89662 61882079
GSS233 88553 63641206
GSS234 89283 62505584
GSS235 9890 7129098
GSS236 87995 63795538
GSS237 90151 62444409
GSS238 94552 59902397
GSS239 74253 62877141
GSS24 194054 130219272
GSS240 84212 78927630
GSS241 83059 80543045
GSS242 70720 52883996
GSS243 117650 64297121
GSS244 108874 55446727
GSS245 107533 52125503
GSS246 96658 43251344
GSS247 109801 49060015
GSS248 98194 46325477
GSS249 73059 72225597
GSS25 177482 105208945
GSS250 77252 72611065
GSS251 92153 71186606
GSS252 92497 70716768
GSS253 91113 68310278
GSS254 53385 32873257
GSS255 94787 57200301
GSS256 93517 59081345
GSS257 93900 58510429
GSS258 94714 57307691
GSS259 94197 58070562
GSS26 185732 107675520
GSS260 12741 6343956
GSS27 170506 151234083
GSS28 190511 146386306
GSS29 151054 106332306
GSS3 174946 87828983
GSS30 192536 132230345
GSS31 13906 8947947
GSS32 195895 127234153
GSS33 216654 116238131
GSS34 218577 113597712
GSS35 219716 112030658
GSS36 213973 121865192
GSS37 198560 156440039
GSS38 194985 146794861
GSS39 197291 73457394
GSS4 167157 85100788
GSS40 185038 97613049
GSS41 189714 125917418
GSS42 170994 159189605
GSS43 8594 5601792
GSS44 183999 100320381
GSS45 172878 121569559
GSS46 184887 124543257
GSS47 190865 122371435
GSS48 71059 62801344
GSS49 171798 101962849
GSS5 53455 31623154
GSS50 167647 103037071
GSS51 167798 102616250
GSS52 184193 121476304
GSS53 184567 116494932
GSS54 181405 122335974
GSS55 187007 113499944
GSS56 189584 134960167
GSS57 178535 104507484
GSS58 195825 120606407
GSS59 180005 133176132
GSS6 161617 84471320
GSS60 2942 2617861
GSS61 172843 138947742
GSS62 161635 111553216
GSS63 161673 111573033
GSS64 158828 107593228
GSS65 156725 129035036
GSS66 170186 142548970
GSS67 179830 117087269
GSS68 204915 127984702
GSS69 193334 110750279
GSS7 165321 79360873
GSS70 243920 125962415
GSS71 160221 106344582
GSS72 158987 119491159
GSS73 162110 124115907
GSS74 162075 124178387
GSS75 174784 108842816
GSS76 190577 140143222
GSS77 14678 8894629
GSS78 199135 126616367
GSS79 170360 111594897
GSS8 165782 88979534
GSS80 200697 131497570
GSS81 211558 85861841
GSS82 187859 98638965
GSS83 131805 92017452
GSS84 146987 118084732
GSS85 139587 116995274
GSS86 142817 114059806
GSS87 144009 119847617
GSS88 141840 115691511
GSS89 106746 88951103
GSS9 137999 67157719
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 55897 70697619
HTC11 80042 70775818
HTC12 7833 9351822
HTC13 66993 60073171
HTC14 68563 69502858
HTC15 24394 16582662
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 60957 77955151
HTG1 1318 188771164
HTG10 1297 186285876
HTG100 990 189440077
HTG101 996 189331054
HTG102 985 189419172
HTG103 1161 190585510
HTG104 30 4314892
HTG105 1087 189854687
HTG106 1046 189729798
HTG107 1386 191260179
HTG108 1296 190949055
HTG109 1639 191195132
HTG11 9 1245953
HTG110 1337 191968355
HTG111 1314 192036268
HTG112 1362 189911244
HTG113 1058 186003265
HTG114 765 123625687
HTG115 1507 182635389
HTG116 1010 191662213
HTG117 1027 187693809
HTG118 1066 193766406
HTG119 1103 193215949
HTG12 1452 184004673
HTG120 127 24335712
HTG121 1029 189520679
HTG122 1054 192676832
HTG123 1164 192121620
HTG124 1083 192945775
HTG125 1083 192937725
HTG126 590 104030016
HTG127 1122 192576031
HTG128 1080 192404979
HTG129 1078 192326016
HTG13 875 191786413
HTG130 1166 191911933
HTG131 1558 191794330
HTG132 1069 192223091
HTG133 1070 192335254
HTG134 1129 191836509
HTG135 1415 187961138
HTG136 416 55843124
HTG14 753 191921309
HTG15 745 191963148
HTG16 785 191933231
HTG17 796 191351096
HTG18 775 192103394
HTG19 2069 170638342
HTG2 2468 186022324
HTG20 1096 187413748
HTG21 887 180042173
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190515178
HTG29 939 189959636
HTG3 2515 185223642
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189501635
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191702609
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2549 188262266
HTG40 1049 189067591
HTG41 1089 167537350
HTG42 1256 188119418
HTG43 1169 188010117
HTG44 1150 188080035
HTG45 1117 191232412
HTG46 1269 190634433
HTG47 1176 190820695
HTG48 1128 191324694
HTG49 1046 191269623
HTG5 1283 185544093
HTG50 1030 189589096
HTG51 1041 178589404
HTG52 968 190052338
HTG53 1105 190148899
HTG54 1046 190158403
HTG55 1014 189831932
HTG56 969 189170679
HTG57 81 14306584
HTG58 1010 189338312
HTG59 1029 189903667
HTG6 1273 185016781
HTG60 1078 187304761
HTG61 1125 188308213
HTG62 987 170842440
HTG63 1085 189487801
HTG64 1064 189415560
HTG65 1169 188798107
HTG66 1179 187545797
HTG67 1282 184397923
HTG68 94 12194080
HTG69 1221 185314622
HTG7 1275 185326125
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187688486
HTG73 1019 170126516
HTG74 1118 188293510
HTG75 1103 190775743
HTG76 1135 190789237
HTG77 1182 190871034
HTG78 1096 185997580
HTG79 1171 190202119
HTG8 1459 184462575
HTG80 1115 190063261
HTG81 1213 189874691
HTG82 1120 189645029
HTG83 959 164682536
HTG84 1229 188409093
HTG85 1250 187741728
HTG86 1141 189879061
HTG87 1144 189686641
HTG88 978 167870813
HTG89 1182 189961005
HTG9 1200 186951993
HTG90 1104 190233697
HTG91 1146 190217975
HTG92 1109 190471215
HTG93 961 159222190
HTG94 1056 190754252
HTG95 1160 191011164
HTG96 1031 189156227
HTG97 1071 189497493
HTG98 684 127508859
HTG99 1018 189641315
INV1 93710 48149379
INV10 57048 86472222
INV11 82660 65190288
INV12 60564 47658135
INV13 84615 65948455
INV14 80807 66814741
INV15 78786 66598902
INV16 47728 45596844
INV17 28422 113216941
INV18 8395 143017433
INV19 42693 111932587
INV2 25604 148242029
INV20 77321 56389462
INV21 73088 62436200
INV22 2196 1432329
INV23 21065 125978647
INV24 6 133712559
INV25 53828 99132549
INV26 78385 53587131
INV27 29140 21582111
INV28 79195 57182614
INV29 77372 59761206
INV3 1669 170114785
INV30 73007 55005776
INV31 75565 55008510
INV32 21268 62908891
INV4 3854 133939858
INV5 78656 73294037
INV6 55791 94943908
INV7 52827 88207534
INV8 7704 8078752
INV9 80302 71524112
MAM1 15978 161631160
MAM2 19601 157960796
MAM3 59191 82318171
MAM4 7677 184681986
MAM5 79456 74653477
MAM6 49982 123699146
MAM7 73556 63393653
MAM8 14721 14698483
PAT1 222551 70117059
PAT10 124441 102578063
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224730 34113420
PAT109 250080 15844360
PAT11 98661 64110448
PAT110 180676 63661713
PAT111 51652 26061632
PAT112 114176 110461877
PAT113 137694 83273592
PAT114 164178 99338868
PAT115 158860 103334939
PAT116 137435 114993907
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142059 62828666
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105889 59875047
PAT130 44618 171217879
PAT131 9167 47581637
PAT132 33645 178334734
PAT133 153558 109675196
PAT134 178705 90913377
PAT135 136049 115324159
PAT136 120392 123342367
PAT137 8527 8992390
PAT138 155429 101473147
PAT139 184764 88815933
PAT14 103639 50158899
PAT140 182409 85292093
PAT141 174403 93928365
PAT142 125174 122942590
PAT143 75688 7342969
PAT144 203662 47737230
PAT145 277828 9627968
PAT146 220409 46465135
PAT147 106719 2881142
PAT148 270386 21672571
PAT149 186749 61237793
PAT15 121136 53309242
PAT150 109797 106057638
PAT151 47522 9551625
PAT152 87296 88239857
PAT153 78456 95569971
PAT154 145126 77720617
PAT155 167516 71362939
PAT156 121462 92949984
PAT157 103016 85343211
PAT158 165600 46071419
PAT159 270022 5130418
PAT16 113129 61271009
PAT160 269978 5129582
PAT161 269978 5129582
PAT162 237888 4519872
PAT163 269396 5118524
PAT164 235479 25574351
PAT165 203725 47154834
PAT166 12043 422907
PAT167 165317 74871979
PAT168 91686 126656173
PAT169 172585 71662774
PAT17 39187 16248324
PAT170 137841 72230790
PAT171 9556 14012460
PAT172 93111 87244841
PAT173 91680 79829497
PAT174 83213 91466816
PAT175 109148 53718640
PAT176 119767 63745357
PAT177 156331 19195880
PAT178 77192 19195381
PAT179 86862 129980830
PAT18 146771 52594264
PAT180 159196 78756411
PAT181 211906 48209823
PAT182 93359 41229190
PAT19 153705 78039102
PAT2 194513 84656825
PAT20 104751 118096823
PAT21 133743 95365390
PAT22 84649 79535519
PAT23 123507 103387008
PAT24 119471 105674778
PAT25 145424 86657649
PAT26 175151 64309592
PAT27 71447 1786175
PAT28 102171 77387698
PAT29 93951 87640330
PAT3 171983 95896583
PAT30 119941 61674794
PAT31 96634 78969836
PAT32 128390 55023697
PAT33 92223 51126479
PAT34 111296 78150585
PAT35 138098 29120154
PAT36 158504 24081221
PAT37 114675 49019980
PAT38 44875 54580173
PAT39 95732 83191686
PAT4 153749 106054879
PAT40 100232 70984798
PAT41 136205 39303239
PAT42 143773 35446818
PAT43 123732 64730827
PAT44 104362 81213845
PAT45 93445 74211542
PAT46 113254 66591441
PAT47 65219 54831918
PAT48 135192 108000182
PAT49 167081 97031566
PAT5 57141 23924741
PAT50 116396 127556602
PAT51 196341 76723288
PAT52 80306 127991232
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92802 89391390
PAT59 106504 74790004
PAT6 170642 91909261
PAT60 122362 64031281
PAT61 67447 30302020
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154764 88226846
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131220 96904061
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94632 88056898
PAT83 93686 93467861
PAT84 34076 33981506
PAT85 83459 93185861
PAT86 15570 180450165
PAT87 164895 19209843
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129357 101143197
PAT90 175305 3330795
PAT91 101394 1926486
PAT92 169171 12412246
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140780 2674820
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6612 84079451
PLN1 59896 93463967
PLN10 73057 75862628
PLN11 37374 49291780
PLN12 40287 65712463
PLN13 22488 123975100
PLN14 21103 99490647
PLN15 17566 144768265
PLN16 17622 146203357
PLN17 17550 146317118
PLN18 24673 128747914
PLN19 5999 149130224
PLN2 46958 106863009
PLN20 1268 170558125
PLN21 13938 156108673
PLN22 7326 8521642
PLN23 67246 69729753
PLN24 29382 31604637
PLN25 76931 76348053
PLN26 64744 80336917
PLN27 61754 100526505
PLN28 76 95744252
PLN29 3 61743175
PLN3 1367 174788753
PLN30 866 124507183
PLN31 19553 133482252
PLN32 19176 132662782
PLN33 77514 74519103
PLN34 94760 61452074
PLN35 39858 32525301
PLN36 80354 71636537
PLN37 77840 75856665
PLN38 80049 70452091
PLN39 82072 75441565
PLN4 1794 185164686
PLN40 58133 31952345
PLN41 98608 55062825
PLN42 82013 68933542
PLN43 45870 98596344
PLN44 19079 132069325
PLN45 30914 126696382
PLN46 62182 69901826
PLN47 81434 72239467
PLN48 63214 82386801
PLN49 36777 105085915
PLN5 1880 193606194
PLN50 84332 64098423
PLN51 89151 54717621
PLN52 76991 72433985
PLN53 71094 84124899
PLN54 76372 69165597
PLN55 72636 73945135
PLN56 77682 65426818
PLN57 50862 84034703
PLN6 1692 194502170
PLN7 1501 179946925
PLN8 72249 84219303
PLN9 26119 24786392
PRI1 23018 59654044
PRI10 1272 179395210
PRI11 778 94342363
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193666240
PRI18 1099 194310776
PRI19 1166 193657185
PRI2 18509 149121371
PRI20 1737 191818169
PRI21 2646 189795035
PRI22 11045 175339288
PRI23 9906 22933121
PRI24 31572 84615190
PRI25 61951 78207697
PRI26 31350 70628098
PRI27 8521 161801360
PRI28 2251 180645625
PRI29 1618 181509288
PRI3 1432 175165681
PRI30 2007 181705860
PRI31 1957 180697490
PRI32 13185 156514786
PRI33 1328 183749995
PRI34 41218 106774346
PRI35 23502 34414975
PRI36 32189 63608729
PRI37 20152 117784920
PRI38 18563 147331908
PRI39 66684 86887520
PRI4 1282 185548571
PRI40 49543 89484398
PRI41 40247 74813579
PRI42 45355 95623522
PRI43 18497 108336501
PRI44 72365 79705815
PRI45 5561 39071238
PRI5 1325 184269325
PRI6 1180 179951778
PRI7 1245 180985147
PRI8 1213 178408437
PRI9 1367 174689932
ROD1 33125 139383708
ROD10 989 181485158
ROD11 240 45576056
ROD12 1034 185475616
ROD13 940 182703335
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185811349
ROD18 1189 190422909
ROD19 16774 155343582
ROD2 916 175542994
ROD20 20349 148361192
ROD21 1132 182075942
ROD22 1079 168189648
ROD23 12240 164895229
ROD24 39630 69427578
ROD25 22367 102345594
ROD26 1533 187689982
ROD27 131995 39944399
ROD28 85506 70248737
ROD29 61801 66168542
ROD3 905 173326813
ROD4 901 173780081
ROD5 920 174266650
ROD6 966 178082195
ROD7 970 179708672
ROD8 979 181294026
ROD9 993 181869376
STS1 85257 36750501
STS10 57907 44420267
STS11 48910 37503235
STS12 57924 43637361
STS13 64283 42850336
STS14 93614 34186498
STS15 104286 26517058
STS16 10109 2739230
STS17 103611 27476228
STS18 86926 34447437
STS19 99725 33367017
STS2 84327 49855709
STS20 54963 21020152
STS3 66836 26359108
STS4 77030 36944377
STS5 8484 4973721
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55716 37767321
SYN1 42743 77285482
SYN2 49429 68017951
SYN3 11333 159477453
SYN4 4599 176561065
SYN5 4596 176482713
SYN6 4600 176575084
SYN7 6114 93800290
TSA1 119977 38112352
TSA10 12846 14458686
TSA11 104981 27321556
TSA12 63093 36049176
TSA13 78048 76369363
TSA14 108605 44529741
TSA15 114370 41370569
TSA16 85951 70204975
TSA17 120164 38802704
TSA18 134981 34131922
TSA19 61572 79385070
TSA2 113082 41399259
TSA20 41183 55937127
TSA21 70040 97061853
TSA22 99950 57210299
TSA23 110053 52104020
TSA24 103102 51799165
TSA25 101858 53620884
TSA26 101686 46128771
TSA27 13589 8598813
TSA28 66220 59270523
TSA29 92710 68066368
TSA3 109975 40913799
TSA30 91369 64643058
TSA31 78775 86284206
TSA32 103058 45918331
TSA33 113025 34990868
TSA34 93746 70323871
TSA35 1570 1101186
TSA36 94687 35571775
TSA37 78654 36313539
TSA38 109342 44676214
TSA39 116438 47145157
TSA4 110065 45516394
TSA40 22607 16956112
TSA41 105982 50234310
TSA42 100521 54488647
TSA43 89586 68305082
TSA44 90610 73541586
TSA45 35029 10846458
TSA46 90399 71322568
TSA47 97546 54457852
TSA48 62949 108079873
TSA49 89272 78140782
TSA5 45429 11644788
TSA50 88125 65246302
TSA51 86194 67762175
TSA52 77217 79589707
TSA53 42625 64548218
TSA54 90659 66659366
TSA55 75915 84448762
TSA56 75448 75795718
TSA57 70815 62253595
TSA58 86796 78390657
TSA59 83918 82050306
TSA6 111608 58989548
TSA60 64105 89501542
TSA61 83190 73972725
TSA62 94586 46478070
TSA63 93415 57217802
TSA64 81911 61986266
TSA65 91953 75378690
TSA66 97253 73901722
TSA67 86288 55661177
TSA68 102410 54948021
TSA69 109335 48669792
TSA7 95472 65433174
TSA70 77363 90687544
TSA71 90364 68959254
TSA72 90310 46987101
TSA73 94723 53136584
TSA74 80183 75233809
TSA75 55304 68873319
TSA76 70124 113089686
TSA77 91984 73409780
TSA78 113387 56477169
TSA79 109216 52543226
TSA8 105034 69035742
TSA80 109175 49378845
TSA81 67049 70014304
TSA82 80457 88837063
TSA83 72637 76131544
TSA84 55393 121084573
TSA85 72977 66848466
TSA86 85239 74155317
TSA87 87966 67478305
TSA88 91304 52572550
TSA89 59408 54656946
TSA9 106293 63251904
TSA90 64087 65481741
TSA91 62776 67314514
TSA92 62796 68082050
TSA93 83597 81259826
TSA94 80901 66046271
TSA95 75665 66697134
TSA96 73587 59631026
UNA1 244 127803
VRL1 67819 69199598
VRL10 66738 68567372
VRL11 49390 65674528
VRL12 62819 71064019
VRL13 57371 72799083
VRL14 63326 65125364
VRL15 56728 73407772
VRL16 36770 44669912
VRL17 54785 72424401
VRL18 59298 71187763
VRL19 55608 73671167
VRL2 72972 64641902
VRL20 54790 74370012
VRL21 62647 65277634
VRL3 70178 60497453
VRL4 68648 69687853
VRL5 51283 53659358
VRL6 48168 77535236
VRL7 46998 72885417
VRL8 61320 69810929
VRL9 61020 73308013
VRT1 43702 119977451
VRT10 1256 189217442
VRT11 8274 177839690
VRT12 3993 136596069
VRT13 13101 170790688
VRT14 5342 182610424
VRT15 3936 186026494
VRT16 37577 134621116
VRT17 79791 68463908
VRT18 78225 66383592
VRT19 31070 25053068
VRT2 1137 194215832
VRT20 71383 77240698
VRT21 46664 121689262
VRT22 77673 63084785
VRT23 78653 62390793
VRT24 80480 57399744
VRT25 103986 65739951
VRT26 83768 54308649
VRT27 20789 18856424
VRT3 72618 78162527
VRT4 8284 172139250
VRT5 31530 31398001
VRT6 73014 66723456
VRT7 31769 63581671
VRT8 30614 112215697
VRT9 1201 189867913
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 191.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
20031278 16310774187 Homo sapiens
9697507 9974977889 Mus musculus
2188117 6521253272 Rattus norvegicus
2200915 5386258455 Bos taurus
3934412 5062731057 Zea mays
3286633 4887861860 Sus scrofa
1722826 3120857462 Danio rerio
257584 1435236534 Strongylocentrotus purpuratus
453167 1256203101 Macaca mulatta
1348553 1255686573 Oryza sativa Japonica Group
1588278 1249938611 Xenopus (Silurana) tropicalis
1774357 1197357811 Nicotiana tabacum
2329786 1144226616 Arabidopsis thaliana
1253074 1119965220 Drosophila melanogaster
216613 1008323292 Pan troglodytes
766851 999010073 Vitis vinifera
1455863 951238343 Canis lupus familiaris
1902878 906638854 Glycine max
815360 899631338 Gallus gallus
1426899 898689329 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 191.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
June 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
bits-request@ncbi.nlm.nih.gov
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to
indicate the GenBank release number (e.g., Release 191.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Ilya Dondoshansky, WonHee Jang, Jonathan Kans, Leonid Khotomliansky,
Michael Kimelman, Jim Ostell, Denis Sinyakov, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
