Release Notes For GenBank Release 192

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2012

               NCBI-GenBank Flat File Release 192.0

                    Distribution Release Notes

 157889737 loci, 145430961262 bases, from 157889737 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 192.0
1.2 Cutoff Date
1.3 Important Changes in Release 192.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 192.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 192.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 192.0, incorporates data available to the collaborating
databases as of October 08, 2012 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 192.0

1.3.1 Organizational changes

The total number of sequence data files increased by 33 with this release:

  - the BCT division is now composed of  91 files (+2)
  - the CON division is now composed of 176 files (+4)
  - the ENV division is now composed of  57 files (+2)
  - the HTG division is now composed of 141 files (+5)
  - the INV division is now composed of  33 files (+1)
  - the PLN division is now composed of  59 files (+2)
  - the TSA division is now composed of 112 files (+16)
  - the VRL division is now composed of  22 files (+1)

The total number of 'index' files increased by 2 with this release:

  - the AUT (author name) index is now composed of 102 files (+1)
  - the JOU (journal)     index is now composed of  14 files (+1)

1.3.2 New qualifier : /altitude

  Altitude information is an important component of an accurate environmental
sample description (see related qualifiers /lat_lon and /collection_date).
To capture altitude data, a new source-feature qualifier is now legal as of
October 15 2012 (GenBank 192.0) :

Qualifier       /altitude=
Definition      geographical altitude of the location from which the sample
                was collected
Value format    "text"
Example         /altitude="-256 m."
                /altitude="330.12 m."
Cardinality     1
Comment         Values indicate altitudes above or below nominal sea level 
                provided in metres

1.3.3 Modification of the /anticodon qualifier

  As of GenBank Release 192.0 in October 2012, the /anticodon qualifier
of tRNA features has been modified to include the sequence of the anticodon:

Qualifier       /anticodon=
Definition      location of the anticodon of tRNA and the amino acid for which
                it codes
Value format    (pos:<location>,aa:<amino_acid>,seq:<text>) where location
                is the position of the anticodon, amino_acid is the 
                abbreviation for the amino acid encoded and seq is the 
                sequence of the anticodon
Example         /anticodon=(pos:34..36,aa:Phe,seq:aaa)
                /anticodon=(pos:join(5,495..496),aa:Leu,seq:taa)
                /anticodon=(pos:complement(4156..4158),aa:Gln,seq:ttg)

Currently, only the 'pos' and 'aa' elements are supported. The addition
of 'seq' should make it more convenient for database users to process
tRNA features: It will no longer be necessary to analyze the 'pos' element
in order to obtain the anticodon sequence.

1.3.4 Expansion of the /linkage_evidence controlled vocabulary

  Genome centers sometimes have knowledge from PCR evidence that two contigs
are linked, and thus should be part of a CON-division/scaffold record, however
none of the values in the linkage_evidence controlled vocabulary are appropriate.

So, as of this GenBank Release 192.0 of October 2012, the value "pcr" is now
a legal value for the /linkage_evidence qualifier:

Qualifier       /linkage_evidence=
Value format    "paired-ends", "align genus", "align xgenus", "align trnscpt",
                "within clone", "clone contig", "map", "strobe", "pcr", and
                "unspecified"

1.3.5 /frequency qualifier deprecated

  Note: This change was not announced in the August 2012 GenBank Release notes
  due to an oversight. Our apologies for the omission. 

  At the 2012 annual INSDC meeting, it was noted that the /frequency qualifier
was very rarely used, on fewer than 9000 records. It was also noted
that the qualifier has limited utility, given that relative frequencies will
evolve as additional sequencing of a given population occurs. Databases that
are dedicated to variation (dbSNP, DGVa, dbVAR, etc) provide far more accurate
frequency information than a little-used and never-updated text qualifier.

  So as of the October 2012 GenBank release, the /frequency qualifier has
been deprecated. Existing values for the qualifier are now presented via the
/note qualifier of source features, and GenBank submission tools are being
updated to cease support of /frequency. Here is an example of a record for
which frequency information is now presented via /note :

LOCUS       AJ631998                 673 bp    DNA     linear   BCT 10-JUN-2005
DEFINITION  Spiroplasma sp. MSRO partial 16S rRNA gene, strain MSRO.
ACCESSION   AJ631998
VERSION     AJ631998.1  GI:45720448
....
     source          1..673
                     /organism="Spiroplasma sp. MSRO"
                     /mol_type="genomic DNA"
                     /strain="MSRO"
                     /host="Drosophila melanogaster"
                     /db_xref="taxon:265049"
                     /country="Brazil:Campinas"
                     /note="natural symbiont of Drosophila melanogaster that
                     causes embryonic male lethality;
                     frequency: .23"

1.3.6 Changes in the content of index files

  As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.

  The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.

  Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.

  The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.

  These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:

a) Cease support of the 'index' file products altogether.

b) Provide new products that present some of the most useful data from
   the legacy 'index' files, and cease support for other types of index data.

  If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:

   info@ncbi.nlm.nih.gov

  Our apologies for any inconvenience that these changes may cause.

1.3.7 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for
106 of the GSS flatfiles in Release 192.0. Consider gbgss155.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                          October 15 2012

                NCBI-GenBank Flat File Release 192.0

                           GSS Sequences (Part 1)

   87101 loci,    63965498 bases, from    87101 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "155" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

  No changes impacting the flatfile format are expected between the
October 2012 and February 2013 GenBank releases.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 1887 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut100.idx - Index of the entries according to author name, part 100.
7. gbaut101.idx - Index of the entries according to author name, part 101.
8. gbaut102.idx - Index of the entries according to author name, part 102.
9. gbaut11.idx - Index of the entries according to author name, part 11.
10. gbaut12.idx - Index of the entries according to author name, part 12.
11. gbaut13.idx - Index of the entries according to author name, part 13.
12. gbaut14.idx - Index of the entries according to author name, part 14.
13. gbaut15.idx - Index of the entries according to author name, part 15.
14. gbaut16.idx - Index of the entries according to author name, part 16.
15. gbaut17.idx - Index of the entries according to author name, part 17.
16. gbaut18.idx - Index of the entries according to author name, part 18.
17. gbaut19.idx - Index of the entries according to author name, part 19.
18. gbaut2.idx - Index of the entries according to author name, part 2.
19. gbaut20.idx - Index of the entries according to author name, part 20.
20. gbaut21.idx - Index of the entries according to author name, part 21.
21. gbaut22.idx - Index of the entries according to author name, part 22.
22. gbaut23.idx - Index of the entries according to author name, part 23.
23. gbaut24.idx - Index of the entries according to author name, part 24.
24. gbaut25.idx - Index of the entries according to author name, part 25.
25. gbaut26.idx - Index of the entries according to author name, part 26.
26. gbaut27.idx - Index of the entries according to author name, part 27.
27. gbaut28.idx - Index of the entries according to author name, part 28.
28. gbaut29.idx - Index of the entries according to author name, part 29.
29. gbaut3.idx - Index of the entries according to author name, part 3.
30. gbaut30.idx - Index of the entries according to author name, part 30.
31. gbaut31.idx - Index of the entries according to author name, part 31.
32. gbaut32.idx - Index of the entries according to author name, part 32.
33. gbaut33.idx - Index of the entries according to author name, part 33.
34. gbaut34.idx - Index of the entries according to author name, part 34.
35. gbaut35.idx - Index of the entries according to author name, part 35.
36. gbaut36.idx - Index of the entries according to author name, part 36.
37. gbaut37.idx - Index of the entries according to author name, part 37.
38. gbaut38.idx - Index of the entries according to author name, part 38.
39. gbaut39.idx - Index of the entries according to author name, part 39.
40. gbaut4.idx - Index of the entries according to author name, part 4.
41. gbaut40.idx - Index of the entries according to author name, part 40.
42. gbaut41.idx - Index of the entries according to author name, part 41.
43. gbaut42.idx - Index of the entries according to author name, part 42.
44. gbaut43.idx - Index of the entries according to author name, part 43.
45. gbaut44.idx - Index of the entries according to author name, part 44.
46. gbaut45.idx - Index of the entries according to author name, part 45.
47. gbaut46.idx - Index of the entries according to author name, part 46.
48. gbaut47.idx - Index of the entries according to author name, part 47.
49. gbaut48.idx - Index of the entries according to author name, part 48.
50. gbaut49.idx - Index of the entries according to author name, part 49.
51. gbaut5.idx - Index of the entries according to author name, part 5.
52. gbaut50.idx - Index of the entries according to author name, part 50.
53. gbaut51.idx - Index of the entries according to author name, part 51.
54. gbaut52.idx - Index of the entries according to author name, part 52.
55. gbaut53.idx - Index of the entries according to author name, part 53.
56. gbaut54.idx - Index of the entries according to author name, part 54.
57. gbaut55.idx - Index of the entries according to author name, part 55.
58. gbaut56.idx - Index of the entries according to author name, part 56.
59. gbaut57.idx - Index of the entries according to author name, part 57.
60. gbaut58.idx - Index of the entries according to author name, part 58.
61. gbaut59.idx - Index of the entries according to author name, part 59.
62. gbaut6.idx - Index of the entries according to author name, part 6.
63. gbaut60.idx - Index of the entries according to author name, part 60.
64. gbaut61.idx - Index of the entries according to author name, part 61.
65. gbaut62.idx - Index of the entries according to author name, part 62.
66. gbaut63.idx - Index of the entries according to author name, part 63.
67. gbaut64.idx - Index of the entries according to author name, part 64.
68. gbaut65.idx - Index of the entries according to author name, part 65.
69. gbaut66.idx - Index of the entries according to author name, part 66.
70. gbaut67.idx - Index of the entries according to author name, part 67.
71. gbaut68.idx - Index of the entries according to author name, part 68.
72. gbaut69.idx - Index of the entries according to author name, part 69.
73. gbaut7.idx - Index of the entries according to author name, part 7.
74. gbaut70.idx - Index of the entries according to author name, part 70.
75. gbaut71.idx - Index of the entries according to author name, part 71.
76. gbaut72.idx - Index of the entries according to author name, part 72.
77. gbaut73.idx - Index of the entries according to author name, part 73.
78. gbaut74.idx - Index of the entries according to author name, part 74.
79. gbaut75.idx - Index of the entries according to author name, part 75.
80. gbaut76.idx - Index of the entries according to author name, part 76.
81. gbaut77.idx - Index of the entries according to author name, part 77.
82. gbaut78.idx - Index of the entries according to author name, part 78.
83. gbaut79.idx - Index of the entries according to author name, part 79.
84. gbaut8.idx - Index of the entries according to author name, part 8.
85. gbaut80.idx - Index of the entries according to author name, part 80.
86. gbaut81.idx - Index of the entries according to author name, part 81.
87. gbaut82.idx - Index of the entries according to author name, part 82.
88. gbaut83.idx - Index of the entries according to author name, part 83.
89. gbaut84.idx - Index of the entries according to author name, part 84.
90. gbaut85.idx - Index of the entries according to author name, part 85.
91. gbaut86.idx - Index of the entries according to author name, part 86.
92. gbaut87.idx - Index of the entries according to author name, part 87.
93. gbaut88.idx - Index of the entries according to author name, part 88.
94. gbaut89.idx - Index of the entries according to author name, part 89.
95. gbaut9.idx - Index of the entries according to author name, part 9.
96. gbaut90.idx - Index of the entries according to author name, part 90.
97. gbaut91.idx - Index of the entries according to author name, part 91.
98. gbaut92.idx - Index of the entries according to author name, part 92.
99. gbaut93.idx - Index of the entries according to author name, part 93.
100. gbaut94.idx - Index of the entries according to author name, part 94.
101. gbaut95.idx - Index of the entries according to author name, part 95.
102. gbaut96.idx - Index of the entries according to author name, part 96.
103. gbaut97.idx - Index of the entries according to author name, part 97.
104. gbaut98.idx - Index of the entries according to author name, part 98.
105. gbaut99.idx - Index of the entries according to author name, part 99.
106. gbbct1.seq - Bacterial sequence entries, part 1.
107. gbbct10.seq - Bacterial sequence entries, part 10.
108. gbbct11.seq - Bacterial sequence entries, part 11.
109. gbbct12.seq - Bacterial sequence entries, part 12.
110. gbbct13.seq - Bacterial sequence entries, part 13.
111. gbbct14.seq - Bacterial sequence entries, part 14.
112. gbbct15.seq - Bacterial sequence entries, part 15.
113. gbbct16.seq - Bacterial sequence entries, part 16.
114. gbbct17.seq - Bacterial sequence entries, part 17.
115. gbbct18.seq - Bacterial sequence entries, part 18.
116. gbbct19.seq - Bacterial sequence entries, part 19.
117. gbbct2.seq - Bacterial sequence entries, part 2.
118. gbbct20.seq - Bacterial sequence entries, part 20.
119. gbbct21.seq - Bacterial sequence entries, part 21.
120. gbbct22.seq - Bacterial sequence entries, part 22.
121. gbbct23.seq - Bacterial sequence entries, part 23.
122. gbbct24.seq - Bacterial sequence entries, part 24.
123. gbbct25.seq - Bacterial sequence entries, part 25.
124. gbbct26.seq - Bacterial sequence entries, part 26.
125. gbbct27.seq - Bacterial sequence entries, part 27.
126. gbbct28.seq - Bacterial sequence entries, part 28.
127. gbbct29.seq - Bacterial sequence entries, part 29.
128. gbbct3.seq - Bacterial sequence entries, part 3.
129. gbbct30.seq - Bacterial sequence entries, part 30.
130. gbbct31.seq - Bacterial sequence entries, part 31.
131. gbbct32.seq - Bacterial sequence entries, part 32.
132. gbbct33.seq - Bacterial sequence entries, part 33.
133. gbbct34.seq - Bacterial sequence entries, part 34.
134. gbbct35.seq - Bacterial sequence entries, part 35.
135. gbbct36.seq - Bacterial sequence entries, part 36.
136. gbbct37.seq - Bacterial sequence entries, part 37.
137. gbbct38.seq - Bacterial sequence entries, part 38.
138. gbbct39.seq - Bacterial sequence entries, part 39.
139. gbbct4.seq - Bacterial sequence entries, part 4.
140. gbbct40.seq - Bacterial sequence entries, part 40.
141. gbbct41.seq - Bacterial sequence entries, part 41.
142. gbbct42.seq - Bacterial sequence entries, part 42.
143. gbbct43.seq - Bacterial sequence entries, part 43.
144. gbbct44.seq - Bacterial sequence entries, part 44.
145. gbbct45.seq - Bacterial sequence entries, part 45.
146. gbbct46.seq - Bacterial sequence entries, part 46.
147. gbbct47.seq - Bacterial sequence entries, part 47.
148. gbbct48.seq - Bacterial sequence entries, part 48.
149. gbbct49.seq - Bacterial sequence entries, part 49.
150. gbbct5.seq - Bacterial sequence entries, part 5.
151. gbbct50.seq - Bacterial sequence entries, part 50.
152. gbbct51.seq - Bacterial sequence entries, part 51.
153. gbbct52.seq - Bacterial sequence entries, part 52.
154. gbbct53.seq - Bacterial sequence entries, part 53.
155. gbbct54.seq - Bacterial sequence entries, part 54.
156. gbbct55.seq - Bacterial sequence entries, part 55.
157. gbbct56.seq - Bacterial sequence entries, part 56.
158. gbbct57.seq - Bacterial sequence entries, part 57.
159. gbbct58.seq - Bacterial sequence entries, part 58.
160. gbbct59.seq - Bacterial sequence entries, part 59.
161. gbbct6.seq - Bacterial sequence entries, part 6.
162. gbbct60.seq - Bacterial sequence entries, part 60.
163. gbbct61.seq - Bacterial sequence entries, part 61.
164. gbbct62.seq - Bacterial sequence entries, part 62.
165. gbbct63.seq - Bacterial sequence entries, part 63.
166. gbbct64.seq - Bacterial sequence entries, part 64.
167. gbbct65.seq - Bacterial sequence entries, part 65.
168. gbbct66.seq - Bacterial sequence entries, part 66.
169. gbbct67.seq - Bacterial sequence entries, part 67.
170. gbbct68.seq - Bacterial sequence entries, part 68.
171. gbbct69.seq - Bacterial sequence entries, part 69.
172. gbbct7.seq - Bacterial sequence entries, part 7.
173. gbbct70.seq - Bacterial sequence entries, part 70.
174. gbbct71.seq - Bacterial sequence entries, part 71.
175. gbbct72.seq - Bacterial sequence entries, part 72.
176. gbbct73.seq - Bacterial sequence entries, part 73.
177. gbbct74.seq - Bacterial sequence entries, part 74.
178. gbbct75.seq - Bacterial sequence entries, part 75.
179. gbbct76.seq - Bacterial sequence entries, part 76.
180. gbbct77.seq - Bacterial sequence entries, part 77.
181. gbbct78.seq - Bacterial sequence entries, part 78.
182. gbbct79.seq - Bacterial sequence entries, part 79.
183. gbbct8.seq - Bacterial sequence entries, part 8.
184. gbbct80.seq - Bacterial sequence entries, part 80.
185. gbbct81.seq - Bacterial sequence entries, part 81.
186. gbbct82.seq - Bacterial sequence entries, part 82.
187. gbbct83.seq - Bacterial sequence entries, part 83.
188. gbbct84.seq - Bacterial sequence entries, part 84.
189. gbbct85.seq - Bacterial sequence entries, part 85.
190. gbbct86.seq - Bacterial sequence entries, part 86.
191. gbbct87.seq - Bacterial sequence entries, part 87.
192. gbbct88.seq - Bacterial sequence entries, part 88.
193. gbbct89.seq - Bacterial sequence entries, part 89.
194. gbbct9.seq - Bacterial sequence entries, part 9.
195. gbbct90.seq - Bacterial sequence entries, part 90.
196. gbbct91.seq - Bacterial sequence entries, part 91.
197. gbchg.txt - Accession numbers of entries updated since the previous release.
198. gbcon1.seq - Constructed sequence entries, part 1.
199. gbcon10.seq - Constructed sequence entries, part 10.
200. gbcon100.seq - Constructed sequence entries, part 100.
201. gbcon101.seq - Constructed sequence entries, part 101.
202. gbcon102.seq - Constructed sequence entries, part 102.
203. gbcon103.seq - Constructed sequence entries, part 103.
204. gbcon104.seq - Constructed sequence entries, part 104.
205. gbcon105.seq - Constructed sequence entries, part 105.
206. gbcon106.seq - Constructed sequence entries, part 106.
207. gbcon107.seq - Constructed sequence entries, part 107.
208. gbcon108.seq - Constructed sequence entries, part 108.
209. gbcon109.seq - Constructed sequence entries, part 109.
210. gbcon11.seq - Constructed sequence entries, part 11.
211. gbcon110.seq - Constructed sequence entries, part 110.
212. gbcon111.seq - Constructed sequence entries, part 111.
213. gbcon112.seq - Constructed sequence entries, part 112.
214. gbcon113.seq - Constructed sequence entries, part 113.
215. gbcon114.seq - Constructed sequence entries, part 114.
216. gbcon115.seq - Constructed sequence entries, part 115.
217. gbcon116.seq - Constructed sequence entries, part 116.
218. gbcon117.seq - Constructed sequence entries, part 117.
219. gbcon118.seq - Constructed sequence entries, part 118.
220. gbcon119.seq - Constructed sequence entries, part 119.
221. gbcon12.seq - Constructed sequence entries, part 12.
222. gbcon120.seq - Constructed sequence entries, part 120.
223. gbcon121.seq - Constructed sequence entries, part 121.
224. gbcon122.seq - Constructed sequence entries, part 122.
225. gbcon123.seq - Constructed sequence entries, part 123.
226. gbcon124.seq - Constructed sequence entries, part 124.
227. gbcon125.seq - Constructed sequence entries, part 125.
228. gbcon126.seq - Constructed sequence entries, part 126.
229. gbcon127.seq - Constructed sequence entries, part 127.
230. gbcon128.seq - Constructed sequence entries, part 128.
231. gbcon129.seq - Constructed sequence entries, part 129.
232. gbcon13.seq - Constructed sequence entries, part 13.
233. gbcon130.seq - Constructed sequence entries, part 130.
234. gbcon131.seq - Constructed sequence entries, part 131.
235. gbcon132.seq - Constructed sequence entries, part 132.
236. gbcon133.seq - Constructed sequence entries, part 133.
237. gbcon134.seq - Constructed sequence entries, part 134.
238. gbcon135.seq - Constructed sequence entries, part 135.
239. gbcon136.seq - Constructed sequence entries, part 136.
240. gbcon137.seq - Constructed sequence entries, part 137.
241. gbcon138.seq - Constructed sequence entries, part 138.
242. gbcon139.seq - Constructed sequence entries, part 139.
243. gbcon14.seq - Constructed sequence entries, part 14.
244. gbcon140.seq - Constructed sequence entries, part 140.
245. gbcon141.seq - Constructed sequence entries, part 141.
246. gbcon142.seq - Constructed sequence entries, part 142.
247. gbcon143.seq - Constructed sequence entries, part 143.
248. gbcon144.seq - Constructed sequence entries, part 144.
249. gbcon145.seq - Constructed sequence entries, part 145.
250. gbcon146.seq - Constructed sequence entries, part 146.
251. gbcon147.seq - Constructed sequence entries, part 147.
252. gbcon148.seq - Constructed sequence entries, part 148.
253. gbcon149.seq - Constructed sequence entries, part 149.
254. gbcon15.seq - Constructed sequence entries, part 15.
255. gbcon150.seq - Constructed sequence entries, part 150.
256. gbcon151.seq - Constructed sequence entries, part 151.
257. gbcon152.seq - Constructed sequence entries, part 152.
258. gbcon153.seq - Constructed sequence entries, part 153.
259. gbcon154.seq - Constructed sequence entries, part 154.
260. gbcon155.seq - Constructed sequence entries, part 155.
261. gbcon156.seq - Constructed sequence entries, part 156.
262. gbcon157.seq - Constructed sequence entries, part 157.
263. gbcon158.seq - Constructed sequence entries, part 158.
264. gbcon159.seq - Constructed sequence entries, part 159.
265. gbcon16.seq - Constructed sequence entries, part 16.
266. gbcon160.seq - Constructed sequence entries, part 160.
267. gbcon161.seq - Constructed sequence entries, part 161.
268. gbcon162.seq - Constructed sequence entries, part 162.
269. gbcon163.seq - Constructed sequence entries, part 163.
270. gbcon164.seq - Constructed sequence entries, part 164.
271. gbcon165.seq - Constructed sequence entries, part 165.
272. gbcon166.seq - Constructed sequence entries, part 166.
273. gbcon167.seq - Constructed sequence entries, part 167.
274. gbcon168.seq - Constructed sequence entries, part 168.
275. gbcon169.seq - Constructed sequence entries, part 169.
276. gbcon17.seq - Constructed sequence entries, part 17.
277. gbcon170.seq - Constructed sequence entries, part 170.
278. gbcon171.seq - Constructed sequence entries, part 171.
279. gbcon172.seq - Constructed sequence entries, part 172.
280. gbcon173.seq - Constructed sequence entries, part 173.
281. gbcon174.seq - Constructed sequence entries, part 174.
282. gbcon175.seq - Constructed sequence entries, part 175.
283. gbcon176.seq - Constructed sequence entries, part 176.
284. gbcon18.seq - Constructed sequence entries, part 18.
285. gbcon19.seq - Constructed sequence entries, part 19.
286. gbcon2.seq - Constructed sequence entries, part 2.
287. gbcon20.seq - Constructed sequence entries, part 20.
288. gbcon21.seq - Constructed sequence entries, part 21.
289. gbcon22.seq - Constructed sequence entries, part 22.
290. gbcon23.seq - Constructed sequence entries, part 23.
291. gbcon24.seq - Constructed sequence entries, part 24.
292. gbcon25.seq - Constructed sequence entries, part 25.
293. gbcon26.seq - Constructed sequence entries, part 26.
294. gbcon27.seq - Constructed sequence entries, part 27.
295. gbcon28.seq - Constructed sequence entries, part 28.
296. gbcon29.seq - Constructed sequence entries, part 29.
297. gbcon3.seq - Constructed sequence entries, part 3.
298. gbcon30.seq - Constructed sequence entries, part 30.
299. gbcon31.seq - Constructed sequence entries, part 31.
300. gbcon32.seq - Constructed sequence entries, part 32.
301. gbcon33.seq - Constructed sequence entries, part 33.
302. gbcon34.seq - Constructed sequence entries, part 34.
303. gbcon35.seq - Constructed sequence entries, part 35.
304. gbcon36.seq - Constructed sequence entries, part 36.
305. gbcon37.seq - Constructed sequence entries, part 37.
306. gbcon38.seq - Constructed sequence entries, part 38.
307. gbcon39.seq - Constructed sequence entries, part 39.
308. gbcon4.seq - Constructed sequence entries, part 4.
309. gbcon40.seq - Constructed sequence entries, part 40.
310. gbcon41.seq - Constructed sequence entries, part 41.
311. gbcon42.seq - Constructed sequence entries, part 42.
312. gbcon43.seq - Constructed sequence entries, part 43.
313. gbcon44.seq - Constructed sequence entries, part 44.
314. gbcon45.seq - Constructed sequence entries, part 45.
315. gbcon46.seq - Constructed sequence entries, part 46.
316. gbcon47.seq - Constructed sequence entries, part 47.
317. gbcon48.seq - Constructed sequence entries, part 48.
318. gbcon49.seq - Constructed sequence entries, part 49.
319. gbcon5.seq - Constructed sequence entries, part 5.
320. gbcon50.seq - Constructed sequence entries, part 50.
321. gbcon51.seq - Constructed sequence entries, part 51.
322. gbcon52.seq - Constructed sequence entries, part 52.
323. gbcon53.seq - Constructed sequence entries, part 53.
324. gbcon54.seq - Constructed sequence entries, part 54.
325. gbcon55.seq - Constructed sequence entries, part 55.
326. gbcon56.seq - Constructed sequence entries, part 56.
327. gbcon57.seq - Constructed sequence entries, part 57.
328. gbcon58.seq - Constructed sequence entries, part 58.
329. gbcon59.seq - Constructed sequence entries, part 59.
330. gbcon6.seq - Constructed sequence entries, part 6.
331. gbcon60.seq - Constructed sequence entries, part 60.
332. gbcon61.seq - Constructed sequence entries, part 61.
333. gbcon62.seq - Constructed sequence entries, part 62.
334. gbcon63.seq - Constructed sequence entries, part 63.
335. gbcon64.seq - Constructed sequence entries, part 64.
336. gbcon65.seq - Constructed sequence entries, part 65.
337. gbcon66.seq - Constructed sequence entries, part 66.
338. gbcon67.seq - Constructed sequence entries, part 67.
339. gbcon68.seq - Constructed sequence entries, part 68.
340. gbcon69.seq - Constructed sequence entries, part 69.
341. gbcon7.seq - Constructed sequence entries, part 7.
342. gbcon70.seq - Constructed sequence entries, part 70.
343. gbcon71.seq - Constructed sequence entries, part 71.
344. gbcon72.seq - Constructed sequence entries, part 72.
345. gbcon73.seq - Constructed sequence entries, part 73.
346. gbcon74.seq - Constructed sequence entries, part 74.
347. gbcon75.seq - Constructed sequence entries, part 75.
348. gbcon76.seq - Constructed sequence entries, part 76.
349. gbcon77.seq - Constructed sequence entries, part 77.
350. gbcon78.seq - Constructed sequence entries, part 78.
351. gbcon79.seq - Constructed sequence entries, part 79.
352. gbcon8.seq - Constructed sequence entries, part 8.
353. gbcon80.seq - Constructed sequence entries, part 80.
354. gbcon81.seq - Constructed sequence entries, part 81.
355. gbcon82.seq - Constructed sequence entries, part 82.
356. gbcon83.seq - Constructed sequence entries, part 83.
357. gbcon84.seq - Constructed sequence entries, part 84.
358. gbcon85.seq - Constructed sequence entries, part 85.
359. gbcon86.seq - Constructed sequence entries, part 86.
360. gbcon87.seq - Constructed sequence entries, part 87.
361. gbcon88.seq - Constructed sequence entries, part 88.
362. gbcon89.seq - Constructed sequence entries, part 89.
363. gbcon9.seq - Constructed sequence entries, part 9.
364. gbcon90.seq - Constructed sequence entries, part 90.
365. gbcon91.seq - Constructed sequence entries, part 91.
366. gbcon92.seq - Constructed sequence entries, part 92.
367. gbcon93.seq - Constructed sequence entries, part 93.
368. gbcon94.seq - Constructed sequence entries, part 94.
369. gbcon95.seq - Constructed sequence entries, part 95.
370. gbcon96.seq - Constructed sequence entries, part 96.
371. gbcon97.seq - Constructed sequence entries, part 97.
372. gbcon98.seq - Constructed sequence entries, part 98.
373. gbcon99.seq - Constructed sequence entries, part 99.
374. gbdel.txt - Accession numbers of entries deleted since the previous release.
375. gbenv1.seq - Environmental sampling sequence entries, part 1.
376. gbenv10.seq - Environmental sampling sequence entries, part 10.
377. gbenv11.seq - Environmental sampling sequence entries, part 11.
378. gbenv12.seq - Environmental sampling sequence entries, part 12.
379. gbenv13.seq - Environmental sampling sequence entries, part 13.
380. gbenv14.seq - Environmental sampling sequence entries, part 14.
381. gbenv15.seq - Environmental sampling sequence entries, part 15.
382. gbenv16.seq - Environmental sampling sequence entries, part 16.
383. gbenv17.seq - Environmental sampling sequence entries, part 17.
384. gbenv18.seq - Environmental sampling sequence entries, part 18.
385. gbenv19.seq - Environmental sampling sequence entries, part 19.
386. gbenv2.seq - Environmental sampling sequence entries, part 2.
387. gbenv20.seq - Environmental sampling sequence entries, part 20.
388. gbenv21.seq - Environmental sampling sequence entries, part 21.
389. gbenv22.seq - Environmental sampling sequence entries, part 22.
390. gbenv23.seq - Environmental sampling sequence entries, part 23.
391. gbenv24.seq - Environmental sampling sequence entries, part 24.
392. gbenv25.seq - Environmental sampling sequence entries, part 25.
393. gbenv26.seq - Environmental sampling sequence entries, part 26.
394. gbenv27.seq - Environmental sampling sequence entries, part 27.
395. gbenv28.seq - Environmental sampling sequence entries, part 28.
396. gbenv29.seq - Environmental sampling sequence entries, part 29.
397. gbenv3.seq - Environmental sampling sequence entries, part 3.
398. gbenv30.seq - Environmental sampling sequence entries, part 30.
399. gbenv31.seq - Environmental sampling sequence entries, part 31.
400. gbenv32.seq - Environmental sampling sequence entries, part 32.
401. gbenv33.seq - Environmental sampling sequence entries, part 33.
402. gbenv34.seq - Environmental sampling sequence entries, part 34.
403. gbenv35.seq - Environmental sampling sequence entries, part 35.
404. gbenv36.seq - Environmental sampling sequence entries, part 36.
405. gbenv37.seq - Environmental sampling sequence entries, part 37.
406. gbenv38.seq - Environmental sampling sequence entries, part 38.
407. gbenv39.seq - Environmental sampling sequence entries, part 39.
408. gbenv4.seq - Environmental sampling sequence entries, part 4.
409. gbenv40.seq - Environmental sampling sequence entries, part 40.
410. gbenv41.seq - Environmental sampling sequence entries, part 41.
411. gbenv42.seq - Environmental sampling sequence entries, part 42.
412. gbenv43.seq - Environmental sampling sequence entries, part 43.
413. gbenv44.seq - Environmental sampling sequence entries, part 44.
414. gbenv45.seq - Environmental sampling sequence entries, part 45.
415. gbenv46.seq - Environmental sampling sequence entries, part 46.
416. gbenv47.seq - Environmental sampling sequence entries, part 47.
417. gbenv48.seq - Environmental sampling sequence entries, part 48.
418. gbenv49.seq - Environmental sampling sequence entries, part 49.
419. gbenv5.seq - Environmental sampling sequence entries, part 5.
420. gbenv50.seq - Environmental sampling sequence entries, part 50.
421. gbenv51.seq - Environmental sampling sequence entries, part 51.
422. gbenv52.seq - Environmental sampling sequence entries, part 52.
423. gbenv53.seq - Environmental sampling sequence entries, part 53.
424. gbenv54.seq - Environmental sampling sequence entries, part 54.
425. gbenv55.seq - Environmental sampling sequence entries, part 55.
426. gbenv56.seq - Environmental sampling sequence entries, part 56.
427. gbenv57.seq - Environmental sampling sequence entries, part 57.
428. gbenv6.seq - Environmental sampling sequence entries, part 6.
429. gbenv7.seq - Environmental sampling sequence entries, part 7.
430. gbenv8.seq - Environmental sampling sequence entries, part 8.
431. gbenv9.seq - Environmental sampling sequence entries, part 9.
432. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
433. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
434. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
435. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
436. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
437. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
438. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
439. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
440. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
441. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
442. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
443. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
444. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
445. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
446. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
447. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
448. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
449. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
450. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
451. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
452. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
453. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
454. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
455. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
456. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
457. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
458. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
459. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
460. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
461. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
462. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
463. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
464. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
465. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
466. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
467. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
468. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
469. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
470. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
471. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
472. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
473. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
474. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
475. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
476. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
477. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
478. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
479. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
480. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
481. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
482. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
483. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
484. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
485. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
486. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
487. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
488. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
489. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
490. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
491. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
492. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
493. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
494. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
495. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
496. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
497. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
498. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
499. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
500. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
501. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
502. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
503. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
504. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
505. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
506. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
507. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
508. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
509. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
510. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
511. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
512. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
513. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
514. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
515. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
516. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
517. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
518. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
519. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
520. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
521. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
522. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
523. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
524. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
525. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
526. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
527. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
528. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
529. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
530. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
531. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
532. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
533. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
534. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
535. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
536. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
537. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
538. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
539. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
540. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
541. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
542. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
543. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
544. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
545. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
546. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
547. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
548. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
549. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
550. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
551. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
552. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
553. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
554. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
555. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
556. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
557. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
558. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
559. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
560. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
561. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
562. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
563. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
564. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
565. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
566. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
567. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
568. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
569. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
570. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
571. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
572. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
573. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
574. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
575. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
576. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
577. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
578. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
579. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
580. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
581. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
582. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
583. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
584. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
585. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
586. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
587. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
588. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
589. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
590. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
591. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
592. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
593. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
594. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
595. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
596. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
597. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
598. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
599. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
600. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
601. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
602. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
603. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
604. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
605. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
606. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
607. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
608. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
609. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
610. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
611. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
612. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
613. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
614. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
615. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
616. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
617. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
618. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
619. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
620. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
621. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
622. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
623. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
624. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
625. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
626. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
627. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
628. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
629. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
630. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
631. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
632. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
633. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
634. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
635. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
636. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
637. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
638. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
639. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
640. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
641. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
642. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
643. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
644. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
645. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
646. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
647. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
648. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
649. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
650. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
651. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
652. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
653. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
654. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
655. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
656. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
657. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
658. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
659. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
660. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
661. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
662. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
663. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
664. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
665. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
666. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
667. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
668. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
669. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
670. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
671. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
672. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
673. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
674. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
675. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
676. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
677. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
678. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
679. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
680. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
681. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
682. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
683. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
684. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
685. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
686. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
687. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
688. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
689. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
690. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
691. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
692. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
693. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
694. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
695. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
696. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
697. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
698. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
699. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
700. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
701. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
702. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
703. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
704. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
705. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
706. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
707. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
708. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
709. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
710. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
711. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
712. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
713. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
714. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
715. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
716. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
717. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
718. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
719. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
720. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
721. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
722. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
723. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
724. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
725. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
726. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
727. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
728. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
729. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
730. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
731. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
732. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
733. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
734. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
735. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
736. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
737. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
738. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
739. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
740. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
741. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
742. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
743. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
744. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
745. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
746. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
747. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
748. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
749. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
750. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
751. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
752. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
753. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
754. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
755. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
756. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
757. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
758. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
759. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
760. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
761. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
762. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
763. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
764. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
765. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
766. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
767. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
768. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
769. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
770. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
771. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
772. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
773. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
774. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
775. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
776. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
777. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
778. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
779. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
780. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
781. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
782. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
783. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
784. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
785. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
786. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
787. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
788. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
789. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
790. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
791. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
792. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
793. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
794. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
795. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
796. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
797. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
798. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
799. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
800. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
801. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
802. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
803. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
804. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
805. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
806. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
807. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
808. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
809. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
810. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
811. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
812. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
813. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
814. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
815. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
816. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
817. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
818. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
819. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
820. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
821. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
822. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
823. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
824. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
825. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
826. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
827. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
828. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
829. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
830. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
831. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
832. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
833. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
834. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
835. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
836. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
837. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
838. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
839. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
840. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
841. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
842. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
843. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
844. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
845. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
846. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
847. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
848. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
849. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
850. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
851. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
852. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
853. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
854. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
855. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
856. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
857. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
858. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
859. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
860. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
861. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
862. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
863. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
864. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
865. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
866. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
867. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
868. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
869. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
870. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
871. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
872. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
873. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
874. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
875. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
876. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
877. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
878. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
879. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
880. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
881. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
882. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
883. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
884. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
885. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
886. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
887. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
888. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
889. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
890. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
891. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
892. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
893. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
894. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
895. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
896. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
897. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
898. gbgen.idx - Index of the entries according to gene symbols.
899. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
900. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
901. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
902. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
903. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
904. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
905. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
906. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
907. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
908. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
909. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
910. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
911. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
912. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
913. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
914. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
915. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
916. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
917. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
918. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
919. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
920. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
921. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
922. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
923. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
924. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
925. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
926. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
927. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
928. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
929. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
930. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
931. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
932. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
933. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
934. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
935. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
936. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
937. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
938. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
939. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
940. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
941. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
942. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
943. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
944. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
945. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
946. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
947. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
948. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
949. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
950. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
951. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
952. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
953. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
954. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
955. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
956. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
957. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
958. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
959. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
960. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
961. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
962. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
963. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
964. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
965. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
966. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
967. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
968. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
969. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
970. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
971. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
972. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
973. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
974. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
975. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
976. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
977. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
978. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
979. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
980. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
981. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
982. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
983. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
984. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
985. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
986. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
987. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
988. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
989. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
990. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
991. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
992. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
993. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
994. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
995. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
996. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
997. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
998. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
999. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1000. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1001. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1002. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1003. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1004. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1005. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1006. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1007. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1008. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1009. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1010. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1011. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1012. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1013. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1014. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1015. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1016. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1017. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1018. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1019. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1020. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1021. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1022. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1023. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1024. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1025. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1026. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1027. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1028. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1029. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1030. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1031. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1032. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1033. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1034. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1035. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1036. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1037. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1038. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1039. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1040. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1041. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1042. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1043. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1044. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1045. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1046. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1047. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1048. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1049. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1050. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1051. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1052. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1053. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1054. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1055. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1056. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1057. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1058. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1059. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1060. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1061. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1062. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1063. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1064. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1065. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1066. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1067. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1068. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1069. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1070. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1071. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1072. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1073. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1074. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1075. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1076. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1077. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1078. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1079. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1080. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1081. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1082. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1083. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1084. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1085. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1086. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1087. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1088. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1089. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1090. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1091. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1092. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1093. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1094. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1095. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1096. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1097. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1098. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1099. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1100. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1101. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1102. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1103. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1104. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1105. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1106. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1107. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1108. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1109. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1110. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1111. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1112. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1113. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1114. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1115. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1116. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1117. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1118. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1119. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1120. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1121. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1122. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1123. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1124. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1125. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1126. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1127. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1128. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1129. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1130. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1131. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1132. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1133. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1134. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1135. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1136. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1137. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1138. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1139. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1140. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1141. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1142. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1143. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1144. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1145. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1146. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1147. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1148. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1149. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1150. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1151. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1152. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1153. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1154. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1155. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1156. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1157. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1158. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1159. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1160. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1161. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1162. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1163. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1164. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1165. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1166. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1167. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1168. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1169. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1170. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1171. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1172. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1173. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1174. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1175. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1176. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1177. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1178. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1179. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1180. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1181. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1182. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1183. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1184. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1185. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1186. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1187. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1188. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1189. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1190. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1191. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1192. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1193. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1194. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1195. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1196. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1197. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1198. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1199. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1200. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1201. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1202. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1203. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1204. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1205. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1206. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1207. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1208. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1209. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1210. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1211. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1212. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1213. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1214. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1215. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1216. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1217. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1218. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1219. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1220. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1221. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1222. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1223. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1224. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1225. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1226. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1227. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1228. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1229. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1230. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1231. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1232. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1233. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1234. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1235. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1236. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1237. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1238. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1239. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1240. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1241. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1242. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1243. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1244. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1245. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1246. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1247. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1248. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1249. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1250. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1251. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1252. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1253. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1254. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1255. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1256. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1257. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1258. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1259. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1260. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1261. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1262. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1263. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1264. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1265. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1266. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1267. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1268. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1269. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1270. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1271. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1272. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1273. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1274. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1275. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1276. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1277. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1278. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1279. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1280. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1281. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1282. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1283. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1284. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1285. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1286. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1287. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1288. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1289. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1290. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1291. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1292. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1293. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1294. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1295. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1296. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1297. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1298. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1299. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1300. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1301. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1302. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1303. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1304. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1305. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1306. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1307. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1308. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1309. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1310. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1311. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1312. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1313. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1314. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1315. gbinv1.seq - Invertebrate sequence entries, part 1.
1316. gbinv10.seq - Invertebrate sequence entries, part 10.
1317. gbinv11.seq - Invertebrate sequence entries, part 11.
1318. gbinv12.seq - Invertebrate sequence entries, part 12.
1319. gbinv13.seq - Invertebrate sequence entries, part 13.
1320. gbinv14.seq - Invertebrate sequence entries, part 14.
1321. gbinv15.seq - Invertebrate sequence entries, part 15.
1322. gbinv16.seq - Invertebrate sequence entries, part 16.
1323. gbinv17.seq - Invertebrate sequence entries, part 17.
1324. gbinv18.seq - Invertebrate sequence entries, part 18.
1325. gbinv19.seq - Invertebrate sequence entries, part 19.
1326. gbinv2.seq - Invertebrate sequence entries, part 2.
1327. gbinv20.seq - Invertebrate sequence entries, part 20.
1328. gbinv21.seq - Invertebrate sequence entries, part 21.
1329. gbinv22.seq - Invertebrate sequence entries, part 22.
1330. gbinv23.seq - Invertebrate sequence entries, part 23.
1331. gbinv24.seq - Invertebrate sequence entries, part 24.
1332. gbinv25.seq - Invertebrate sequence entries, part 25.
1333. gbinv26.seq - Invertebrate sequence entries, part 26.
1334. gbinv27.seq - Invertebrate sequence entries, part 27.
1335. gbinv28.seq - Invertebrate sequence entries, part 28.
1336. gbinv29.seq - Invertebrate sequence entries, part 29.
1337. gbinv3.seq - Invertebrate sequence entries, part 3.
1338. gbinv30.seq - Invertebrate sequence entries, part 30.
1339. gbinv31.seq - Invertebrate sequence entries, part 31.
1340. gbinv32.seq - Invertebrate sequence entries, part 32.
1341. gbinv33.seq - Invertebrate sequence entries, part 33.
1342. gbinv4.seq - Invertebrate sequence entries, part 4.
1343. gbinv5.seq - Invertebrate sequence entries, part 5.
1344. gbinv6.seq - Invertebrate sequence entries, part 6.
1345. gbinv7.seq - Invertebrate sequence entries, part 7.
1346. gbinv8.seq - Invertebrate sequence entries, part 8.
1347. gbinv9.seq - Invertebrate sequence entries, part 9.
1348. gbjou1.idx - Index of the entries according to journal citation, part 1.
1349. gbjou10.idx - Index of the entries according to journal citation, part 10.
1350. gbjou11.idx - Index of the entries according to journal citation, part 11.
1351. gbjou12.idx - Index of the entries according to journal citation, part 12.
1352. gbjou13.idx - Index of the entries according to journal citation, part 13.
1353. gbjou14.idx - Index of the entries according to journal citation, part 14.
1354. gbjou2.idx - Index of the entries according to journal citation, part 2.
1355. gbjou3.idx - Index of the entries according to journal citation, part 3.
1356. gbjou4.idx - Index of the entries according to journal citation, part 4.
1357. gbjou5.idx - Index of the entries according to journal citation, part 5.
1358. gbjou6.idx - Index of the entries according to journal citation, part 6.
1359. gbjou7.idx - Index of the entries according to journal citation, part 7.
1360. gbjou8.idx - Index of the entries according to journal citation, part 8.
1361. gbjou9.idx - Index of the entries according to journal citation, part 9.
1362. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1363. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1364. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1365. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1366. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1367. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1368. gbkey7.idx - Index of the entries according to keyword phrase, part 7.
1369. gbmam1.seq - Other mammalian sequence entries, part 1.
1370. gbmam2.seq - Other mammalian sequence entries, part 2.
1371. gbmam3.seq - Other mammalian sequence entries, part 3.
1372. gbmam4.seq - Other mammalian sequence entries, part 4.
1373. gbmam5.seq - Other mammalian sequence entries, part 5.
1374. gbmam6.seq - Other mammalian sequence entries, part 6.
1375. gbmam7.seq - Other mammalian sequence entries, part 7.
1376. gbmam8.seq - Other mammalian sequence entries, part 8.
1377. gbnew.txt - Accession numbers of entries new since the previous release.
1378. gbpat1.seq - Patent sequence entries, part 1.
1379. gbpat10.seq - Patent sequence entries, part 10.
1380. gbpat100.seq - Patent sequence entries, part 100.
1381. gbpat101.seq - Patent sequence entries, part 101.
1382. gbpat102.seq - Patent sequence entries, part 102.
1383. gbpat103.seq - Patent sequence entries, part 103.
1384. gbpat104.seq - Patent sequence entries, part 104.
1385. gbpat105.seq - Patent sequence entries, part 105.
1386. gbpat106.seq - Patent sequence entries, part 106.
1387. gbpat107.seq - Patent sequence entries, part 107.
1388. gbpat108.seq - Patent sequence entries, part 108.
1389. gbpat109.seq - Patent sequence entries, part 109.
1390. gbpat11.seq - Patent sequence entries, part 11.
1391. gbpat110.seq - Patent sequence entries, part 110.
1392. gbpat111.seq - Patent sequence entries, part 111.
1393. gbpat112.seq - Patent sequence entries, part 112.
1394. gbpat113.seq - Patent sequence entries, part 113.
1395. gbpat114.seq - Patent sequence entries, part 114.
1396. gbpat115.seq - Patent sequence entries, part 115.
1397. gbpat116.seq - Patent sequence entries, part 116.
1398. gbpat117.seq - Patent sequence entries, part 117.
1399. gbpat118.seq - Patent sequence entries, part 118.
1400. gbpat119.seq - Patent sequence entries, part 119.
1401. gbpat12.seq - Patent sequence entries, part 12.
1402. gbpat120.seq - Patent sequence entries, part 120.
1403. gbpat121.seq - Patent sequence entries, part 121.
1404. gbpat122.seq - Patent sequence entries, part 122.
1405. gbpat123.seq - Patent sequence entries, part 123.
1406. gbpat124.seq - Patent sequence entries, part 124.
1407. gbpat125.seq - Patent sequence entries, part 125.
1408. gbpat126.seq - Patent sequence entries, part 126.
1409. gbpat127.seq - Patent sequence entries, part 127.
1410. gbpat128.seq - Patent sequence entries, part 128.
1411. gbpat129.seq - Patent sequence entries, part 129.
1412. gbpat13.seq - Patent sequence entries, part 13.
1413. gbpat130.seq - Patent sequence entries, part 130.
1414. gbpat131.seq - Patent sequence entries, part 131.
1415. gbpat132.seq - Patent sequence entries, part 132.
1416. gbpat133.seq - Patent sequence entries, part 133.
1417. gbpat134.seq - Patent sequence entries, part 134.
1418. gbpat135.seq - Patent sequence entries, part 135.
1419. gbpat136.seq - Patent sequence entries, part 136.
1420. gbpat137.seq - Patent sequence entries, part 137.
1421. gbpat138.seq - Patent sequence entries, part 138.
1422. gbpat139.seq - Patent sequence entries, part 139.
1423. gbpat14.seq - Patent sequence entries, part 14.
1424. gbpat140.seq - Patent sequence entries, part 140.
1425. gbpat141.seq - Patent sequence entries, part 141.
1426. gbpat142.seq - Patent sequence entries, part 142.
1427. gbpat143.seq - Patent sequence entries, part 143.
1428. gbpat144.seq - Patent sequence entries, part 144.
1429. gbpat145.seq - Patent sequence entries, part 145.
1430. gbpat146.seq - Patent sequence entries, part 146.
1431. gbpat147.seq - Patent sequence entries, part 147.
1432. gbpat148.seq - Patent sequence entries, part 148.
1433. gbpat149.seq - Patent sequence entries, part 149.
1434. gbpat15.seq - Patent sequence entries, part 15.
1435. gbpat150.seq - Patent sequence entries, part 150.
1436. gbpat151.seq - Patent sequence entries, part 151.
1437. gbpat152.seq - Patent sequence entries, part 152.
1438. gbpat153.seq - Patent sequence entries, part 153.
1439. gbpat154.seq - Patent sequence entries, part 154.
1440. gbpat155.seq - Patent sequence entries, part 155.
1441. gbpat156.seq - Patent sequence entries, part 156.
1442. gbpat157.seq - Patent sequence entries, part 157.
1443. gbpat158.seq - Patent sequence entries, part 158.
1444. gbpat159.seq - Patent sequence entries, part 159.
1445. gbpat16.seq - Patent sequence entries, part 16.
1446. gbpat160.seq - Patent sequence entries, part 160.
1447. gbpat161.seq - Patent sequence entries, part 161.
1448. gbpat162.seq - Patent sequence entries, part 162.
1449. gbpat163.seq - Patent sequence entries, part 163.
1450. gbpat164.seq - Patent sequence entries, part 164.
1451. gbpat165.seq - Patent sequence entries, part 165.
1452. gbpat166.seq - Patent sequence entries, part 166.
1453. gbpat167.seq - Patent sequence entries, part 167.
1454. gbpat168.seq - Patent sequence entries, part 168.
1455. gbpat169.seq - Patent sequence entries, part 169.
1456. gbpat17.seq - Patent sequence entries, part 17.
1457. gbpat170.seq - Patent sequence entries, part 170.
1458. gbpat171.seq - Patent sequence entries, part 171.
1459. gbpat172.seq - Patent sequence entries, part 172.
1460. gbpat173.seq - Patent sequence entries, part 173.
1461. gbpat174.seq - Patent sequence entries, part 174.
1462. gbpat175.seq - Patent sequence entries, part 175.
1463. gbpat176.seq - Patent sequence entries, part 176.
1464. gbpat177.seq - Patent sequence entries, part 177.
1465. gbpat178.seq - Patent sequence entries, part 178.
1466. gbpat179.seq - Patent sequence entries, part 179.
1467. gbpat18.seq - Patent sequence entries, part 18.
1468. gbpat180.seq - Patent sequence entries, part 180.
1469. gbpat181.seq - Patent sequence entries, part 181.
1470. gbpat182.seq - Patent sequence entries, part 182.
1471. gbpat19.seq - Patent sequence entries, part 19.
1472. gbpat2.seq - Patent sequence entries, part 2.
1473. gbpat20.seq - Patent sequence entries, part 20.
1474. gbpat21.seq - Patent sequence entries, part 21.
1475. gbpat22.seq - Patent sequence entries, part 22.
1476. gbpat23.seq - Patent sequence entries, part 23.
1477. gbpat24.seq - Patent sequence entries, part 24.
1478. gbpat25.seq - Patent sequence entries, part 25.
1479. gbpat26.seq - Patent sequence entries, part 26.
1480. gbpat27.seq - Patent sequence entries, part 27.
1481. gbpat28.seq - Patent sequence entries, part 28.
1482. gbpat29.seq - Patent sequence entries, part 29.
1483. gbpat3.seq - Patent sequence entries, part 3.
1484. gbpat30.seq - Patent sequence entries, part 30.
1485. gbpat31.seq - Patent sequence entries, part 31.
1486. gbpat32.seq - Patent sequence entries, part 32.
1487. gbpat33.seq - Patent sequence entries, part 33.
1488. gbpat34.seq - Patent sequence entries, part 34.
1489. gbpat35.seq - Patent sequence entries, part 35.
1490. gbpat36.seq - Patent sequence entries, part 36.
1491. gbpat37.seq - Patent sequence entries, part 37.
1492. gbpat38.seq - Patent sequence entries, part 38.
1493. gbpat39.seq - Patent sequence entries, part 39.
1494. gbpat4.seq - Patent sequence entries, part 4.
1495. gbpat40.seq - Patent sequence entries, part 40.
1496. gbpat41.seq - Patent sequence entries, part 41.
1497. gbpat42.seq - Patent sequence entries, part 42.
1498. gbpat43.seq - Patent sequence entries, part 43.
1499. gbpat44.seq - Patent sequence entries, part 44.
1500. gbpat45.seq - Patent sequence entries, part 45.
1501. gbpat46.seq - Patent sequence entries, part 46.
1502. gbpat47.seq - Patent sequence entries, part 47.
1503. gbpat48.seq - Patent sequence entries, part 48.
1504. gbpat49.seq - Patent sequence entries, part 49.
1505. gbpat5.seq - Patent sequence entries, part 5.
1506. gbpat50.seq - Patent sequence entries, part 50.
1507. gbpat51.seq - Patent sequence entries, part 51.
1508. gbpat52.seq - Patent sequence entries, part 52.
1509. gbpat53.seq - Patent sequence entries, part 53.
1510. gbpat54.seq - Patent sequence entries, part 54.
1511. gbpat55.seq - Patent sequence entries, part 55.
1512. gbpat56.seq - Patent sequence entries, part 56.
1513. gbpat57.seq - Patent sequence entries, part 57.
1514. gbpat58.seq - Patent sequence entries, part 58.
1515. gbpat59.seq - Patent sequence entries, part 59.
1516. gbpat6.seq - Patent sequence entries, part 6.
1517. gbpat60.seq - Patent sequence entries, part 60.
1518. gbpat61.seq - Patent sequence entries, part 61.
1519. gbpat62.seq - Patent sequence entries, part 62.
1520. gbpat63.seq - Patent sequence entries, part 63.
1521. gbpat64.seq - Patent sequence entries, part 64.
1522. gbpat65.seq - Patent sequence entries, part 65.
1523. gbpat66.seq - Patent sequence entries, part 66.
1524. gbpat67.seq - Patent sequence entries, part 67.
1525. gbpat68.seq - Patent sequence entries, part 68.
1526. gbpat69.seq - Patent sequence entries, part 69.
1527. gbpat7.seq - Patent sequence entries, part 7.
1528. gbpat70.seq - Patent sequence entries, part 70.
1529. gbpat71.seq - Patent sequence entries, part 71.
1530. gbpat72.seq - Patent sequence entries, part 72.
1531. gbpat73.seq - Patent sequence entries, part 73.
1532. gbpat74.seq - Patent sequence entries, part 74.
1533. gbpat75.seq - Patent sequence entries, part 75.
1534. gbpat76.seq - Patent sequence entries, part 76.
1535. gbpat77.seq - Patent sequence entries, part 77.
1536. gbpat78.seq - Patent sequence entries, part 78.
1537. gbpat79.seq - Patent sequence entries, part 79.
1538. gbpat8.seq - Patent sequence entries, part 8.
1539. gbpat80.seq - Patent sequence entries, part 80.
1540. gbpat81.seq - Patent sequence entries, part 81.
1541. gbpat82.seq - Patent sequence entries, part 82.
1542. gbpat83.seq - Patent sequence entries, part 83.
1543. gbpat84.seq - Patent sequence entries, part 84.
1544. gbpat85.seq - Patent sequence entries, part 85.
1545. gbpat86.seq - Patent sequence entries, part 86.
1546. gbpat87.seq - Patent sequence entries, part 87.
1547. gbpat88.seq - Patent sequence entries, part 88.
1548. gbpat89.seq - Patent sequence entries, part 89.
1549. gbpat9.seq - Patent sequence entries, part 9.
1550. gbpat90.seq - Patent sequence entries, part 90.
1551. gbpat91.seq - Patent sequence entries, part 91.
1552. gbpat92.seq - Patent sequence entries, part 92.
1553. gbpat93.seq - Patent sequence entries, part 93.
1554. gbpat94.seq - Patent sequence entries, part 94.
1555. gbpat95.seq - Patent sequence entries, part 95.
1556. gbpat96.seq - Patent sequence entries, part 96.
1557. gbpat97.seq - Patent sequence entries, part 97.
1558. gbpat98.seq - Patent sequence entries, part 98.
1559. gbpat99.seq - Patent sequence entries, part 99.
1560. gbphg1.seq - Phage sequence entries, part 1.
1561. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1562. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1563. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1564. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1565. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1566. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1567. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1568. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1569. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1570. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1571. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1572. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1573. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1574. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1575. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1576. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1577. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1578. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1579. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1580. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1581. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1582. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1583. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1584. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1585. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1586. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1587. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1588. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1589. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1590. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1591. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1592. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1593. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1594. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1595. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1596. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1597. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1598. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1599. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1600. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1601. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1602. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1603. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1604. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1605. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1606. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1607. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1608. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1609. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1610. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1611. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1612. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1613. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1614. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1615. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1616. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1617. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1618. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1619. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1620. gbpri1.seq - Primate sequence entries, part 1.
1621. gbpri10.seq - Primate sequence entries, part 10.
1622. gbpri11.seq - Primate sequence entries, part 11.
1623. gbpri12.seq - Primate sequence entries, part 12.
1624. gbpri13.seq - Primate sequence entries, part 13.
1625. gbpri14.seq - Primate sequence entries, part 14.
1626. gbpri15.seq - Primate sequence entries, part 15.
1627. gbpri16.seq - Primate sequence entries, part 16.
1628. gbpri17.seq - Primate sequence entries, part 17.
1629. gbpri18.seq - Primate sequence entries, part 18.
1630. gbpri19.seq - Primate sequence entries, part 19.
1631. gbpri2.seq - Primate sequence entries, part 2.
1632. gbpri20.seq - Primate sequence entries, part 20.
1633. gbpri21.seq - Primate sequence entries, part 21.
1634. gbpri22.seq - Primate sequence entries, part 22.
1635. gbpri23.seq - Primate sequence entries, part 23.
1636. gbpri24.seq - Primate sequence entries, part 24.
1637. gbpri25.seq - Primate sequence entries, part 25.
1638. gbpri26.seq - Primate sequence entries, part 26.
1639. gbpri27.seq - Primate sequence entries, part 27.
1640. gbpri28.seq - Primate sequence entries, part 28.
1641. gbpri29.seq - Primate sequence entries, part 29.
1642. gbpri3.seq - Primate sequence entries, part 3.
1643. gbpri30.seq - Primate sequence entries, part 30.
1644. gbpri31.seq - Primate sequence entries, part 31.
1645. gbpri32.seq - Primate sequence entries, part 32.
1646. gbpri33.seq - Primate sequence entries, part 33.
1647. gbpri34.seq - Primate sequence entries, part 34.
1648. gbpri35.seq - Primate sequence entries, part 35.
1649. gbpri36.seq - Primate sequence entries, part 36.
1650. gbpri37.seq - Primate sequence entries, part 37.
1651. gbpri38.seq - Primate sequence entries, part 38.
1652. gbpri39.seq - Primate sequence entries, part 39.
1653. gbpri4.seq - Primate sequence entries, part 4.
1654. gbpri40.seq - Primate sequence entries, part 40.
1655. gbpri41.seq - Primate sequence entries, part 41.
1656. gbpri42.seq - Primate sequence entries, part 42.
1657. gbpri43.seq - Primate sequence entries, part 43.
1658. gbpri44.seq - Primate sequence entries, part 44.
1659. gbpri45.seq - Primate sequence entries, part 45.
1660. gbpri5.seq - Primate sequence entries, part 5.
1661. gbpri6.seq - Primate sequence entries, part 6.
1662. gbpri7.seq - Primate sequence entries, part 7.
1663. gbpri8.seq - Primate sequence entries, part 8.
1664. gbpri9.seq - Primate sequence entries, part 9.
1665. gbrel.txt - Release notes (this document).
1666. gbrod1.seq - Rodent sequence entries, part 1.
1667. gbrod10.seq - Rodent sequence entries, part 10.
1668. gbrod11.seq - Rodent sequence entries, part 11.
1669. gbrod12.seq - Rodent sequence entries, part 12.
1670. gbrod13.seq - Rodent sequence entries, part 13.
1671. gbrod14.seq - Rodent sequence entries, part 14.
1672. gbrod15.seq - Rodent sequence entries, part 15.
1673. gbrod16.seq - Rodent sequence entries, part 16.
1674. gbrod17.seq - Rodent sequence entries, part 17.
1675. gbrod18.seq - Rodent sequence entries, part 18.
1676. gbrod19.seq - Rodent sequence entries, part 19.
1677. gbrod2.seq - Rodent sequence entries, part 2.
1678. gbrod20.seq - Rodent sequence entries, part 20.
1679. gbrod21.seq - Rodent sequence entries, part 21.
1680. gbrod22.seq - Rodent sequence entries, part 22.
1681. gbrod23.seq - Rodent sequence entries, part 23.
1682. gbrod24.seq - Rodent sequence entries, part 24.
1683. gbrod25.seq - Rodent sequence entries, part 25.
1684. gbrod26.seq - Rodent sequence entries, part 26.
1685. gbrod27.seq - Rodent sequence entries, part 27.
1686. gbrod28.seq - Rodent sequence entries, part 28.
1687. gbrod29.seq - Rodent sequence entries, part 29.
1688. gbrod3.seq - Rodent sequence entries, part 3.
1689. gbrod4.seq - Rodent sequence entries, part 4.
1690. gbrod5.seq - Rodent sequence entries, part 5.
1691. gbrod6.seq - Rodent sequence entries, part 6.
1692. gbrod7.seq - Rodent sequence entries, part 7.
1693. gbrod8.seq - Rodent sequence entries, part 8.
1694. gbrod9.seq - Rodent sequence entries, part 9.
1695. gbsdr1.txt - Short directory of the data bank, part 1.
1696. gbsdr2.txt - Short directory of the data bank, part 2.
1697. gbsdr3.txt - Short directory of the data bank, part 3.
1698. gbsec.idx - Index of the entries according to secondary accession number.
1699. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1700. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1701. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1702. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1703. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1704. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1705. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1706. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1707. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1708. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1709. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1710. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1711. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1712. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1713. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1714. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1715. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1716. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1717. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1718. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1719. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1720. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1721. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1722. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1723. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1724. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1725. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1726. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1727. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1728. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
1729. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
1730. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
1731. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
1732. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
1733. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
1734. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
1735. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
1736. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
1737. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
1738. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1739. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
1740. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
1741. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
1742. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1743. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1744. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1745. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1746. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1747. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1748. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1749. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1750. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1751. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1752. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1753. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1754. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1755. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1756. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1757. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1758. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1759. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1760. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1761. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1762. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1763. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1764. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1765. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1766. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1767. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1768. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1769. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1770. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1771. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1772. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1773. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1774. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1775. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1776. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1777. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1778. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1779. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1780. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1781. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1782. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1783. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1784. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1785. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1786. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1787. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1788. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1789. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1790. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1791. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1792. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1793. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1794. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1795. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1796. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1797. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1798. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1799. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1800. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1801. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1802. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1803. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1804. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1805. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1806. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1807. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1808. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1809. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1810. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1811. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1812. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1813. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1814. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1815. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1816. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1817. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1818. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1819. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1820. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1821. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1822. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1823. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1824. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
1825. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
1826. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
1827. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1828. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
1829. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
1830. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
1831. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
1832. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
1833. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
1834. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
1835. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
1836. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
1837. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
1838. gbuna1.seq - Unannotated sequence entries, part 1.
1839. gbvrl1.seq - Viral sequence entries, part 1.
1840. gbvrl10.seq - Viral sequence entries, part 10.
1841. gbvrl11.seq - Viral sequence entries, part 11.
1842. gbvrl12.seq - Viral sequence entries, part 12.
1843. gbvrl13.seq - Viral sequence entries, part 13.
1844. gbvrl14.seq - Viral sequence entries, part 14.
1845. gbvrl15.seq - Viral sequence entries, part 15.
1846. gbvrl16.seq - Viral sequence entries, part 16.
1847. gbvrl17.seq - Viral sequence entries, part 17.
1848. gbvrl18.seq - Viral sequence entries, part 18.
1849. gbvrl19.seq - Viral sequence entries, part 19.
1850. gbvrl2.seq - Viral sequence entries, part 2.
1851. gbvrl20.seq - Viral sequence entries, part 20.
1852. gbvrl21.seq - Viral sequence entries, part 21.
1853. gbvrl22.seq - Viral sequence entries, part 22.
1854. gbvrl3.seq - Viral sequence entries, part 3.
1855. gbvrl4.seq - Viral sequence entries, part 4.
1856. gbvrl5.seq - Viral sequence entries, part 5.
1857. gbvrl6.seq - Viral sequence entries, part 6.
1858. gbvrl7.seq - Viral sequence entries, part 7.
1859. gbvrl8.seq - Viral sequence entries, part 8.
1860. gbvrl9.seq - Viral sequence entries, part 9.
1861. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1862. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1863. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1864. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1865. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1866. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1867. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1868. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1869. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1870. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1871. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1872. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1873. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1874. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1875. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1876. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1877. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1878. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1879. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1880. gbvrt27.seq - Other vertebrate sequence entries, part 27.
1881. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1882. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1883. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1884. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1885. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1886. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1887. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 192.0 flatfiles require roughly 569 GB (sequence
files only) or 612 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

2158153412     gbacc1.idx
2428441455     gbacc2.idx
 856488540     gbacc3.idx
 184474968     gbaut1.idx
 208135753     gbaut10.idx
 188063851     gbaut100.idx
 184029652     gbaut101.idx
 150559856     gbaut102.idx
 183840533     gbaut11.idx
 183848465     gbaut12.idx
 185521280     gbaut13.idx
 185161452     gbaut14.idx
 185811915     gbaut15.idx
 183728801     gbaut16.idx
 185523198     gbaut17.idx
 183892543     gbaut18.idx
 203130272     gbaut19.idx
 186214579     gbaut2.idx
 183860961     gbaut20.idx
 210947514     gbaut21.idx
 184329871     gbaut22.idx
 188941042     gbaut23.idx
 183988110     gbaut24.idx
 231380781     gbaut25.idx
 226666118     gbaut26.idx
 185348524     gbaut27.idx
 190445911     gbaut28.idx
 183985303     gbaut29.idx
 183925836     gbaut3.idx
 185955858     gbaut30.idx
 185748226     gbaut31.idx
 186132819     gbaut32.idx
 185102190     gbaut33.idx
 185937893     gbaut34.idx
 234950145     gbaut35.idx
 186230003     gbaut36.idx
 184154932     gbaut37.idx
 249123533     gbaut38.idx
 183860556     gbaut39.idx
 249128354     gbaut4.idx
 184897275     gbaut40.idx
 184531958     gbaut41.idx
 232307106     gbaut42.idx
 186065969     gbaut43.idx
 185036409     gbaut44.idx
 183824968     gbaut45.idx
 207845681     gbaut46.idx
 184115481     gbaut47.idx
 200712490     gbaut48.idx
 184483317     gbaut49.idx
 185432127     gbaut5.idx
 241175721     gbaut50.idx
 183949543     gbaut51.idx
 184945483     gbaut52.idx
 183974315     gbaut53.idx
 200265275     gbaut54.idx
 237260898     gbaut55.idx
 184252088     gbaut56.idx
 188605930     gbaut57.idx
 192357568     gbaut58.idx
 204643992     gbaut59.idx
 183928854     gbaut6.idx
 183983817     gbaut60.idx
 186196513     gbaut61.idx
 190496816     gbaut62.idx
 184172484     gbaut63.idx
 184016712     gbaut64.idx
 185444189     gbaut65.idx
 183888463     gbaut66.idx
 183919623     gbaut67.idx
 187540573     gbaut68.idx
 185972130     gbaut69.idx
 186444378     gbaut7.idx
 243942676     gbaut70.idx
 185546174     gbaut71.idx
 185887959     gbaut72.idx
 183934956     gbaut73.idx
 183862606     gbaut74.idx
 184818927     gbaut75.idx
 188036411     gbaut76.idx
 183993528     gbaut77.idx
 183788962     gbaut78.idx
 186729441     gbaut79.idx
 188982192     gbaut8.idx
 228275437     gbaut80.idx
 238663113     gbaut81.idx
 229145455     gbaut82.idx
 185596050     gbaut83.idx
 184150905     gbaut84.idx
 184445240     gbaut85.idx
 205055226     gbaut86.idx
 184118783     gbaut87.idx
 249127225     gbaut88.idx
 203708120     gbaut89.idx
 186390969     gbaut9.idx
 254540273     gbaut90.idx
 183776954     gbaut91.idx
 193553866     gbaut92.idx
 183787005     gbaut93.idx
 224520132     gbaut94.idx
 186724427     gbaut95.idx
 183944044     gbaut96.idx
 188551980     gbaut97.idx
 200277477     gbaut98.idx
 184475022     gbaut99.idx
 249999624     gbbct1.seq
 248280521     gbbct10.seq
 239032202     gbbct11.seq
 248802279     gbbct12.seq
 241799686     gbbct13.seq
 116677557     gbbct14.seq
 243190533     gbbct15.seq
 249804855     gbbct16.seq
 245562628     gbbct17.seq
 248629344     gbbct18.seq
 248233024     gbbct19.seq
 248325204     gbbct2.seq
 249282329     gbbct20.seq
 246199154     gbbct21.seq
 245693892     gbbct22.seq
 217807723     gbbct23.seq
 242804091     gbbct24.seq
 241841463     gbbct25.seq
 248677810     gbbct26.seq
 247876182     gbbct27.seq
 249388745     gbbct28.seq
 244186437     gbbct29.seq
 249650688     gbbct3.seq
 247337413     gbbct30.seq
 249997167     gbbct31.seq
 249762205     gbbct32.seq
 249793033     gbbct33.seq
 242886970     gbbct34.seq
 241640310     gbbct35.seq
 164818361     gbbct36.seq
 243029950     gbbct37.seq
 244324408     gbbct38.seq
 249250072     gbbct39.seq
 246076810     gbbct4.seq
 247838739     gbbct40.seq
 246706471     gbbct41.seq
 241266210     gbbct42.seq
 249895456     gbbct43.seq
 248792349     gbbct44.seq
 244000837     gbbct45.seq
 240748007     gbbct46.seq
 247072501     gbbct47.seq
 231587023     gbbct48.seq
 244577616     gbbct49.seq
 213991242     gbbct5.seq
 243720304     gbbct50.seq
 248498818     gbbct51.seq
 239599867     gbbct52.seq
 248233100     gbbct53.seq
 247217404     gbbct54.seq
 244234276     gbbct55.seq
 249995259     gbbct56.seq
 247368653     gbbct57.seq
 241879998     gbbct58.seq
 249710660     gbbct59.seq
 242142729     gbbct6.seq
 247569363     gbbct60.seq
 105371412     gbbct61.seq
 244927103     gbbct62.seq
 247458586     gbbct63.seq
 249968335     gbbct64.seq
 238494006     gbbct65.seq
 242212870     gbbct66.seq
 249205665     gbbct67.seq
 247813953     gbbct68.seq
 245494854     gbbct69.seq
 244197887     gbbct7.seq
 140424619     gbbct70.seq
   6888487     gbbct71.seq
  14098739     gbbct72.seq
  23207138     gbbct73.seq
  45105456     gbbct74.seq
  87762103     gbbct75.seq
 170239136     gbbct76.seq
 249997571     gbbct77.seq
 249997463     gbbct78.seq
 244683130     gbbct79.seq
 229394187     gbbct8.seq
 239413252     gbbct80.seq
 249223343     gbbct81.seq
 247078279     gbbct82.seq
 245388836     gbbct83.seq
 249426975     gbbct84.seq
 214538028     gbbct85.seq
 248904593     gbbct86.seq
 242251208     gbbct87.seq
 249998898     gbbct88.seq
 249999175     gbbct89.seq
 245202010     gbbct9.seq
 249998669     gbbct90.seq
 241435138     gbbct91.seq
  43260135     gbchg.txt
 249995954     gbcon1.seq
 249991455     gbcon10.seq
 249999018     gbcon100.seq
 249995506     gbcon101.seq
 249999938     gbcon102.seq
 249996196     gbcon103.seq
 249994668     gbcon104.seq
 158184767     gbcon105.seq
 249997662     gbcon106.seq
 249996981     gbcon107.seq
 249998026     gbcon108.seq
 249999534     gbcon109.seq
 249306540     gbcon11.seq
  73726548     gbcon110.seq
 213431083     gbcon111.seq
 249999151     gbcon112.seq
 249998618     gbcon113.seq
 249995107     gbcon114.seq
 249967397     gbcon115.seq
 109513271     gbcon116.seq
 249993276     gbcon117.seq
 249997920     gbcon118.seq
 181287823     gbcon119.seq
 248941383     gbcon12.seq
 249997376     gbcon120.seq
 249999771     gbcon121.seq
 250000264     gbcon122.seq
 222531140     gbcon123.seq
 248957794     gbcon124.seq
 249935631     gbcon125.seq
 249448116     gbcon126.seq
 249999890     gbcon127.seq
 249998411     gbcon128.seq
 249997860     gbcon129.seq
 248692728     gbcon13.seq
  34323471     gbcon130.seq
 249971298     gbcon131.seq
 249997710     gbcon132.seq
 249994690     gbcon133.seq
 249959868     gbcon134.seq
 249943571     gbcon135.seq
 249999699     gbcon136.seq
 249977443     gbcon137.seq
 234884818     gbcon138.seq
 246632932     gbcon139.seq
 249997302     gbcon14.seq
 247186189     gbcon140.seq
 249988778     gbcon141.seq
 249615035     gbcon142.seq
 127384172     gbcon143.seq
 249999057     gbcon144.seq
 249346175     gbcon145.seq
 249996661     gbcon146.seq
 250000027     gbcon147.seq
 249998686     gbcon148.seq
 249998568     gbcon149.seq
 123634387     gbcon15.seq
 248987090     gbcon150.seq
 249998189     gbcon151.seq
 207973486     gbcon152.seq
 249999069     gbcon153.seq
 249999113     gbcon154.seq
 249963873     gbcon155.seq
 249995192     gbcon156.seq
 249997584     gbcon157.seq
 249983971     gbcon158.seq
   7238252     gbcon159.seq
 249997357     gbcon16.seq
 249999135     gbcon160.seq
 249989415     gbcon161.seq
 249998872     gbcon162.seq
 249998551     gbcon163.seq
 249999143     gbcon164.seq
 249688881     gbcon165.seq
  48206469     gbcon166.seq
 249978313     gbcon167.seq
 249768223     gbcon168.seq
 249994385     gbcon169.seq
 249910208     gbcon17.seq
 249886572     gbcon170.seq
 249829144     gbcon171.seq
 249999895     gbcon172.seq
 249626214     gbcon173.seq
 249551595     gbcon174.seq
 189010973     gbcon175.seq
  18870823     gbcon176.seq
 249998920     gbcon18.seq
 240711310     gbcon19.seq
 249313215     gbcon2.seq
 249994640     gbcon20.seq
 249193119     gbcon21.seq
 117444305     gbcon22.seq
 249998736     gbcon23.seq
 119794062     gbcon24.seq
 249993709     gbcon25.seq
 249727153     gbcon26.seq
 249999220     gbcon27.seq
 249996705     gbcon28.seq
 192075300     gbcon29.seq
 249817269     gbcon3.seq
 249998917     gbcon30.seq
 249996531     gbcon31.seq
 249997326     gbcon32.seq
 249998915     gbcon33.seq
 249951770     gbcon34.seq
 238918179     gbcon35.seq
 249997270     gbcon36.seq
 249999221     gbcon37.seq
 249994732     gbcon38.seq
 249996897     gbcon39.seq
 249994704     gbcon4.seq
 249997078     gbcon40.seq
 249997414     gbcon41.seq
  63412389     gbcon42.seq
 249995423     gbcon43.seq
 249997315     gbcon44.seq
 249997250     gbcon45.seq
 249997590     gbcon46.seq
 249996159     gbcon47.seq
  44928861     gbcon48.seq
 249994872     gbcon49.seq
 249999657     gbcon5.seq
 249995799     gbcon50.seq
 249997684     gbcon51.seq
 249996690     gbcon52.seq
 249997782     gbcon53.seq
  38241897     gbcon54.seq
 249998302     gbcon55.seq
 249999150     gbcon56.seq
 249998346     gbcon57.seq
 249994564     gbcon58.seq
 249999492     gbcon59.seq
 249994057     gbcon6.seq
 154672375     gbcon60.seq
 249999016     gbcon61.seq
 249996777     gbcon62.seq
 249999159     gbcon63.seq
 249995190     gbcon64.seq
 185611272     gbcon65.seq
 249996810     gbcon66.seq
 249998700     gbcon67.seq
 249997155     gbcon68.seq
 249997874     gbcon69.seq
  93508945     gbcon7.seq
 247616447     gbcon70.seq
 249998269     gbcon71.seq
 249995941     gbcon72.seq
 249998068     gbcon73.seq
 249999277     gbcon74.seq
 249999797     gbcon75.seq
  98773033     gbcon76.seq
 249997150     gbcon77.seq
 249997442     gbcon78.seq
 249995516     gbcon79.seq
 249993190     gbcon8.seq
 249996111     gbcon80.seq
 249995971     gbcon81.seq
  64633499     gbcon82.seq
 249998451     gbcon83.seq
 249995859     gbcon84.seq
 249994386     gbcon85.seq
 249994858     gbcon86.seq
 249998199     gbcon87.seq
  23638323     gbcon88.seq
 249997115     gbcon89.seq
 249995121     gbcon9.seq
 249995538     gbcon90.seq
 249998987     gbcon91.seq
 249999150     gbcon92.seq
 199759401     gbcon93.seq
 249994089     gbcon94.seq
 249998565     gbcon95.seq
 249998526     gbcon96.seq
 249996032     gbcon97.seq
 249999284     gbcon98.seq
 135141018     gbcon99.seq
    169333     gbdel.txt
 249998621     gbenv1.seq
 249999504     gbenv10.seq
 249998812     gbenv11.seq
  57820273     gbenv12.seq
 249999721     gbenv13.seq
 250000048     gbenv14.seq
 249999966     gbenv15.seq
 249998902     gbenv16.seq
 249999480     gbenv17.seq
 249999231     gbenv18.seq
 249999882     gbenv19.seq
 249998001     gbenv2.seq
 219990946     gbenv20.seq
 249998731     gbenv21.seq
 249998100     gbenv22.seq
 250000039     gbenv23.seq
 250000140     gbenv24.seq
 156931318     gbenv25.seq
 249999462     gbenv26.seq
 249962164     gbenv27.seq
 249998406     gbenv28.seq
 250000170     gbenv29.seq
 249998967     gbenv3.seq
 249998776     gbenv30.seq
 189417653     gbenv31.seq
 249999624     gbenv32.seq
 249999140     gbenv33.seq
 249998746     gbenv34.seq
 249997495     gbenv35.seq
 187121159     gbenv36.seq
 249998676     gbenv37.seq
 250000091     gbenv38.seq
 249999940     gbenv39.seq
 249999591     gbenv4.seq
 249999714     gbenv40.seq
 250000256     gbenv41.seq
 249997771     gbenv42.seq
  44579982     gbenv43.seq
 249999550     gbenv44.seq
 250000151     gbenv45.seq
 250000026     gbenv46.seq
 250000054     gbenv47.seq
 174976810     gbenv48.seq
 249999929     gbenv49.seq
 249998789     gbenv5.seq
 249997148     gbenv50.seq
 249999121     gbenv51.seq
 249996956     gbenv52.seq
 249998354     gbenv53.seq
 249999189     gbenv54.seq
 250000073     gbenv55.seq
 249999646     gbenv56.seq
  96747647     gbenv57.seq
 249998641     gbenv6.seq
   5839916     gbenv7.seq
 250000239     gbenv8.seq
 249998259     gbenv9.seq
 524291258     gbest1.seq
 524291691     gbest10.seq
 524289503     gbest100.seq
 524289117     gbest101.seq
 524291228     gbest102.seq
 524291374     gbest103.seq
 360471688     gbest104.seq
 524289437     gbest105.seq
 524290220     gbest106.seq
 524292310     gbest107.seq
 385868816     gbest108.seq
 389646281     gbest109.seq
 524291350     gbest11.seq
 383426451     gbest110.seq
 384181241     gbest111.seq
 381049581     gbest112.seq
 385314556     gbest113.seq
 390041318     gbest114.seq
 388174760     gbest115.seq
 387304186     gbest116.seq
 383870701     gbest117.seq
 407529928     gbest118.seq
 510895029     gbest119.seq
 524289338     gbest12.seq
 524290409     gbest120.seq
 524290409     gbest121.seq
 524291635     gbest122.seq
 524290760     gbest123.seq
 430296883     gbest124.seq
 524290214     gbest125.seq
 524292129     gbest126.seq
 524289327     gbest127.seq
 524290282     gbest128.seq
 524290485     gbest129.seq
 157978590     gbest13.seq
 524289905     gbest130.seq
 524290610     gbest131.seq
 524290311     gbest132.seq
 524289180     gbest133.seq
 524289362     gbest134.seq
 524289277     gbest135.seq
 524291308     gbest136.seq
 301917696     gbest137.seq
 524289110     gbest138.seq
 524289125     gbest139.seq
 524289168     gbest14.seq
 524289652     gbest140.seq
 524290303     gbest141.seq
 524288876     gbest142.seq
 524291296     gbest143.seq
 524289582     gbest144.seq
 524290691     gbest145.seq
 524292250     gbest146.seq
 524293002     gbest147.seq
 524289863     gbest148.seq
 524289916     gbest149.seq
 524291852     gbest15.seq
 524290234     gbest150.seq
 466136395     gbest151.seq
 524290637     gbest152.seq
 524290049     gbest153.seq
 524289751     gbest154.seq
 524290081     gbest155.seq
 524289496     gbest156.seq
 524289101     gbest157.seq
 524290566     gbest158.seq
 524289067     gbest159.seq
 524289721     gbest16.seq
 524291896     gbest160.seq
 524290490     gbest161.seq
 524290362     gbest162.seq
 524288742     gbest163.seq
 247708380     gbest164.seq
 524291244     gbest165.seq
 524290849     gbest166.seq
 524288956     gbest167.seq
 524289464     gbest168.seq
 524290707     gbest169.seq
 524291705     gbest17.seq
 524289659     gbest170.seq
 524289128     gbest171.seq
 524292317     gbest172.seq
 524292018     gbest173.seq
 524288946     gbest174.seq
 524290108     gbest175.seq
 524290497     gbest176.seq
 524290132     gbest177.seq
 114354791     gbest178.seq
 524291246     gbest179.seq
 524289860     gbest18.seq
 524289996     gbest180.seq
 524289993     gbest181.seq
 524289366     gbest182.seq
 524290597     gbest183.seq
 524290967     gbest184.seq
 524291027     gbest185.seq
 524288904     gbest186.seq
 524289129     gbest187.seq
 524291035     gbest188.seq
 524289994     gbest189.seq
 524290656     gbest19.seq
 524290380     gbest190.seq
 474304889     gbest191.seq
 524290694     gbest192.seq
 524290357     gbest193.seq
 524293686     gbest194.seq
 524290732     gbest195.seq
 524292521     gbest196.seq
 524291296     gbest197.seq
 524290645     gbest198.seq
 524290580     gbest199.seq
 524290885     gbest2.seq
 524290428     gbest20.seq
 524291113     gbest200.seq
 524290749     gbest201.seq
 524290408     gbest202.seq
 524290502     gbest203.seq
 524290132     gbest204.seq
  78639770     gbest205.seq
 524290755     gbest206.seq
 524289337     gbest207.seq
 524290952     gbest208.seq
 524290571     gbest209.seq
 524291732     gbest21.seq
 524292169     gbest210.seq
 524290898     gbest211.seq
 524291221     gbest212.seq
 524290445     gbest213.seq
 524290225     gbest214.seq
 524289671     gbest215.seq
 425469521     gbest216.seq
 524290450     gbest217.seq
 524289935     gbest218.seq
 524289416     gbest219.seq
 512263225     gbest22.seq
 524290998     gbest220.seq
 524293167     gbest221.seq
 524295305     gbest222.seq
 524290097     gbest223.seq
 524290750     gbest224.seq
 524290664     gbest225.seq
 524292706     gbest226.seq
 524288904     gbest227.seq
 524289267     gbest228.seq
 524291223     gbest229.seq
 500300273     gbest23.seq
 350888376     gbest230.seq
 524290657     gbest231.seq
 524292710     gbest232.seq
 524289947     gbest233.seq
 524290255     gbest234.seq
 524289598     gbest235.seq
 524290936     gbest236.seq
 524292578     gbest237.seq
 524290775     gbest238.seq
 524290983     gbest239.seq
 509293873     gbest24.seq
 524291397     gbest240.seq
 524289862     gbest241.seq
 524291281     gbest242.seq
 524289654     gbest243.seq
 524289574     gbest244.seq
  33276964     gbest245.seq
 524290085     gbest246.seq
 524289242     gbest247.seq
 524292264     gbest248.seq
 524290431     gbest249.seq
 320478099     gbest25.seq
 524288761     gbest250.seq
 524289276     gbest251.seq
 524291097     gbest252.seq
 524290422     gbest253.seq
 524291422     gbest254.seq
 524290016     gbest255.seq
 524289441     gbest256.seq
 270612611     gbest257.seq
 524291119     gbest258.seq
 524291376     gbest259.seq
 524290814     gbest26.seq
 524288728     gbest260.seq
 524290388     gbest261.seq
 524289079     gbest262.seq
 524291657     gbest263.seq
 524290862     gbest264.seq
 524290295     gbest265.seq
 524290785     gbest266.seq
 524290959     gbest267.seq
 300575461     gbest268.seq
 524289522     gbest269.seq
 524290138     gbest27.seq
 524291313     gbest270.seq
 524290049     gbest271.seq
 524289255     gbest272.seq
 524289986     gbest273.seq
 524291082     gbest274.seq
 524290277     gbest275.seq
 524290563     gbest276.seq
 524291310     gbest277.seq
 524290631     gbest278.seq
 524288899     gbest279.seq
 524289347     gbest28.seq
 312560110     gbest280.seq
 524291839     gbest281.seq
 524289055     gbest282.seq
 524292148     gbest283.seq
 524290111     gbest284.seq
 524288964     gbest285.seq
 524292385     gbest286.seq
 524291050     gbest287.seq
 524289240     gbest288.seq
 524291301     gbest289.seq
 524288943     gbest29.seq
 524290056     gbest290.seq
 524290910     gbest291.seq
 223360005     gbest292.seq
 524291235     gbest293.seq
 524289648     gbest294.seq
 524289373     gbest295.seq
 524288942     gbest296.seq
 524290640     gbest297.seq
 524290143     gbest298.seq
 524289501     gbest299.seq
 497614745     gbest3.seq
 524289053     gbest30.seq
 524290303     gbest300.seq
 477206485     gbest301.seq
 484971571     gbest302.seq
 487584675     gbest303.seq
 328812311     gbest304.seq
 524290958     gbest305.seq
 524288791     gbest306.seq
 524292598     gbest307.seq
 524290432     gbest308.seq
 524289670     gbest309.seq
 524292328     gbest31.seq
 524290779     gbest310.seq
 524291042     gbest311.seq
 524290831     gbest312.seq
 524291252     gbest313.seq
 524291277     gbest314.seq
 524290668     gbest315.seq
 524289468     gbest316.seq
 506309099     gbest317.seq
 524289787     gbest318.seq
 524289856     gbest319.seq
 524289518     gbest32.seq
 524291127     gbest320.seq
 524291613     gbest321.seq
 524289858     gbest322.seq
 524289349     gbest323.seq
 524291534     gbest324.seq
 524289176     gbest325.seq
 524290844     gbest326.seq
 524289717     gbest327.seq
 524291748     gbest328.seq
 524289085     gbest329.seq
 524289648     gbest33.seq
 524290996     gbest330.seq
 253443789     gbest331.seq
 524290152     gbest332.seq
 524288762     gbest333.seq
 524290880     gbest334.seq
 524292549     gbest335.seq
 500875525     gbest336.seq
 524290163     gbest337.seq
 524289204     gbest338.seq
 524290564     gbest339.seq
 520110839     gbest34.seq
 524288980     gbest340.seq
 524290308     gbest341.seq
 524289350     gbest342.seq
 524289250     gbest343.seq
 524291662     gbest344.seq
 350307450     gbest345.seq
 524291963     gbest346.seq
 524291687     gbest347.seq
 524291171     gbest348.seq
 524290448     gbest349.seq
 492754682     gbest35.seq
 524290028     gbest350.seq
 524289679     gbest351.seq
 524289449     gbest352.seq
 524294144     gbest353.seq
 524288776     gbest354.seq
 524291148     gbest355.seq
 524289803     gbest356.seq
 524288730     gbest357.seq
 524289638     gbest358.seq
 524289745     gbest359.seq
 494458317     gbest36.seq
  36620324     gbest360.seq
 524289139     gbest361.seq
 524289559     gbest362.seq
 524292302     gbest363.seq
 524292586     gbest364.seq
 524292386     gbest365.seq
 524290831     gbest366.seq
 524289607     gbest367.seq
 524289597     gbest368.seq
 524291596     gbest369.seq
 493331750     gbest37.seq
 524291332     gbest370.seq
 396132081     gbest371.seq
 524291344     gbest372.seq
 524289188     gbest373.seq
 524288884     gbest374.seq
 524290974     gbest375.seq
 524290913     gbest376.seq
 524288994     gbest377.seq
 524291135     gbest378.seq
 524290319     gbest379.seq
 487995788     gbest38.seq
 524291807     gbest380.seq
 524289778     gbest381.seq
 524289691     gbest382.seq
 347543594     gbest383.seq
 524289836     gbest384.seq
 524288942     gbest385.seq
 524289703     gbest386.seq
 524288815     gbest387.seq
 524289640     gbest388.seq
 524290039     gbest389.seq
 493160350     gbest39.seq
 524290924     gbest390.seq
 524290044     gbest391.seq
 524289777     gbest392.seq
 524290147     gbest393.seq
 518637064     gbest394.seq
 524290864     gbest395.seq
 524288727     gbest396.seq
 524291023     gbest397.seq
 524289815     gbest398.seq
 524289176     gbest399.seq
 524289662     gbest4.seq
 113006982     gbest40.seq
 524290803     gbest400.seq
 524291693     gbest401.seq
 524288859     gbest402.seq
 524290504     gbest403.seq
 524289525     gbest404.seq
 524292123     gbest405.seq
 524292202     gbest406.seq
 516867127     gbest407.seq
 524292010     gbest408.seq
 524289643     gbest409.seq
 524289451     gbest41.seq
 524290147     gbest410.seq
 524291021     gbest411.seq
 524290393     gbest412.seq
 524289100     gbest413.seq
 524292064     gbest414.seq
 524290835     gbest415.seq
 524290786     gbest416.seq
 524289290     gbest417.seq
 524290598     gbest418.seq
 524291804     gbest419.seq
 524289716     gbest42.seq
 524291193     gbest420.seq
   8454818     gbest421.seq
 524289305     gbest422.seq
 524288893     gbest423.seq
 524288963     gbest424.seq
 524294696     gbest425.seq
 524294113     gbest426.seq
 524288904     gbest427.seq
 524294280     gbest428.seq
 524290679     gbest429.seq
 524289690     gbest43.seq
 524291765     gbest430.seq
 524289092     gbest431.seq
 524291051     gbest432.seq
 524290821     gbest433.seq
 524290512     gbest434.seq
 524290616     gbest435.seq
  71428037     gbest436.seq
 524291327     gbest437.seq
 524289147     gbest438.seq
 524291737     gbest439.seq
 524290558     gbest44.seq
 524292770     gbest440.seq
 524292586     gbest441.seq
 524289675     gbest442.seq
 524291091     gbest443.seq
 524289373     gbest444.seq
 524290373     gbest445.seq
 524291172     gbest446.seq
 524289281     gbest447.seq
 483530943     gbest448.seq
 524290373     gbest449.seq
 524289608     gbest45.seq
 524290784     gbest450.seq
 524288877     gbest451.seq
 524289901     gbest452.seq
 524289561     gbest453.seq
 524289247     gbest454.seq
 524291281     gbest455.seq
 524290041     gbest456.seq
 524290964     gbest457.seq
 524289882     gbest458.seq
 524289504     gbest459.seq
 524290059     gbest46.seq
 184026538     gbest460.seq
 524290764     gbest461.seq
 524291173     gbest462.seq
 524290968     gbest463.seq
 524291479     gbest464.seq
 524289122     gbest465.seq
 494355812     gbest466.seq
 524289815     gbest47.seq
 524290832     gbest48.seq
 524291441     gbest49.seq
 524290143     gbest5.seq
 524289193     gbest50.seq
 524289821     gbest51.seq
 524288853     gbest52.seq
 524291027     gbest53.seq
 254282266     gbest54.seq
 524290547     gbest55.seq
 524291109     gbest56.seq
 524291881     gbest57.seq
 524290833     gbest58.seq
 524289115     gbest59.seq
 524289793     gbest6.seq
 524290338     gbest60.seq
 524291844     gbest61.seq
 524289934     gbest62.seq
 524291536     gbest63.seq
 524289349     gbest64.seq
 524291219     gbest65.seq
 524289000     gbest66.seq
 464571013     gbest67.seq
 524289181     gbest68.seq
 524291163     gbest69.seq
 524288922     gbest7.seq
 524290146     gbest70.seq
 524289125     gbest71.seq
 524290974     gbest72.seq
 524291712     gbest73.seq
 524290850     gbest74.seq
 524293204     gbest75.seq
 524291139     gbest76.seq
 524291183     gbest77.seq
 524290774     gbest78.seq
 524290311     gbest79.seq
 524290619     gbest8.seq
 192290980     gbest80.seq
 524290727     gbest81.seq
 524290780     gbest82.seq
 524290243     gbest83.seq
 524291050     gbest84.seq
 524290568     gbest85.seq
 524291024     gbest86.seq
 524290755     gbest87.seq
 524289152     gbest88.seq
 524288950     gbest89.seq
 524293073     gbest9.seq
 524290685     gbest90.seq
 524290958     gbest91.seq
 463227010     gbest92.seq
 524292178     gbest93.seq
 524291563     gbest94.seq
 524291967     gbest95.seq
 524289003     gbest96.seq
 524292050     gbest97.seq
 524291981     gbest98.seq
 524288752     gbest99.seq
 197420238     gbgen.idx
 524291268     gbgss1.seq
 524289844     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524288836     gbgss103.seq
 418618384     gbgss104.seq
 524289981     gbgss105.seq
 524289409     gbgss106.seq
 524289590     gbgss107.seq
 524289562     gbgss108.seq
 524290609     gbgss109.seq
 524291170     gbgss11.seq
 524290191     gbgss110.seq
 524288873     gbgss111.seq
 524290006     gbgss112.seq
 524290845     gbgss113.seq
 524290117     gbgss114.seq
 524291178     gbgss115.seq
  56015061     gbgss116.seq
 524291185     gbgss117.seq
 524291250     gbgss118.seq
 524288915     gbgss119.seq
 524291525     gbgss12.seq
 524289908     gbgss120.seq
 524288793     gbgss121.seq
 524289578     gbgss122.seq
 524288786     gbgss123.seq
 524291168     gbgss124.seq
 524290926     gbgss125.seq
 524289929     gbgss126.seq
 524289589     gbgss127.seq
 524291592     gbgss128.seq
 205528272     gbgss129.seq
 524290301     gbgss13.seq
 524288727     gbgss130.seq
 524291361     gbgss131.seq
 524289314     gbgss132.seq
 524290882     gbgss133.seq
 524290446     gbgss134.seq
 524289077     gbgss135.seq
 524288773     gbgss136.seq
 524289512     gbgss137.seq
 524290859     gbgss138.seq
 517497172     gbgss139.seq
 524290538     gbgss14.seq
 516021215     gbgss140.seq
 157659078     gbgss141.seq
 524289602     gbgss142.seq
 524289547     gbgss143.seq
 524290849     gbgss144.seq
 524291267     gbgss145.seq
 524290484     gbgss146.seq
 524290520     gbgss147.seq
 524291547     gbgss148.seq
 524289741     gbgss149.seq
 524290893     gbgss15.seq
 524288989     gbgss150.seq
 524290826     gbgss151.seq
 325872631     gbgss152.seq
 524289115     gbgss153.seq
 396548736     gbgss154.seq
 249998130     gbgss155.seq
 249997341     gbgss156.seq
 249997848     gbgss157.seq
 249997631     gbgss158.seq
  29198811     gbgss159.seq
 524291189     gbgss16.seq
 249997137     gbgss160.seq
 250000033     gbgss161.seq
 249998542     gbgss162.seq
 249998333     gbgss163.seq
 224919493     gbgss164.seq
 249998415     gbgss165.seq
 249998761     gbgss166.seq
 249999722     gbgss167.seq
 249998684     gbgss168.seq
 191344183     gbgss169.seq
 524289284     gbgss17.seq
 249997564     gbgss170.seq
 249996752     gbgss171.seq
 249999513     gbgss172.seq
 249997874     gbgss173.seq
 249999326     gbgss174.seq
  77035229     gbgss175.seq
 249999158     gbgss176.seq
   2090297     gbgss177.seq
  79542394     gbgss178.seq
 249998428     gbgss179.seq
 524290445     gbgss18.seq
 249999593     gbgss180.seq
  87205952     gbgss181.seq
 249999685     gbgss182.seq
 249998355     gbgss183.seq
 249998984     gbgss184.seq
 202702168     gbgss185.seq
 249999232     gbgss186.seq
 249998752     gbgss187.seq
 250000079     gbgss188.seq
 246010499     gbgss189.seq
 315738815     gbgss19.seq
 249997836     gbgss190.seq
 249998110     gbgss191.seq
 249999870     gbgss192.seq
 243311140     gbgss193.seq
 249999336     gbgss194.seq
 249999577     gbgss195.seq
 250000236     gbgss196.seq
 249997665     gbgss197.seq
 123207544     gbgss198.seq
 249998013     gbgss199.seq
 524291236     gbgss2.seq
 524289657     gbgss20.seq
 249999792     gbgss200.seq
 249998459     gbgss201.seq
 249998343     gbgss202.seq
  95905540     gbgss203.seq
 249999742     gbgss204.seq
 249999443     gbgss205.seq
 249998384     gbgss206.seq
 249999963     gbgss207.seq
 183118490     gbgss208.seq
 249999236     gbgss209.seq
 524288871     gbgss21.seq
 249997993     gbgss210.seq
 249998006     gbgss211.seq
 249999353     gbgss212.seq
  95926739     gbgss213.seq
 249999461     gbgss214.seq
 249999350     gbgss215.seq
 249998406     gbgss216.seq
 249998619     gbgss217.seq
 249999398     gbgss218.seq
 249998401     gbgss219.seq
 524290551     gbgss22.seq
  99057250     gbgss220.seq
 249999424     gbgss221.seq
 249999963     gbgss222.seq
 249997369     gbgss223.seq
  43648880     gbgss224.seq
  52925443     gbgss225.seq
 249997818     gbgss226.seq
 249998543     gbgss227.seq
 249997629     gbgss228.seq
 249998343     gbgss229.seq
 524289209     gbgss23.seq
  32070531     gbgss230.seq
 249997670     gbgss231.seq
 249997588     gbgss232.seq
 249999018     gbgss233.seq
 250000000     gbgss234.seq
  28042636     gbgss235.seq
 249997661     gbgss236.seq
 250000032     gbgss237.seq
 249998827     gbgss238.seq
 249999616     gbgss239.seq
 524290237     gbgss24.seq
 249999456     gbgss240.seq
 249997806     gbgss241.seq
 180456815     gbgss242.seq
 249999812     gbgss243.seq
 249998926     gbgss244.seq
 249999095     gbgss245.seq
 220154622     gbgss246.seq
 250000034     gbgss247.seq
 249997956     gbgss248.seq
 250000074     gbgss249.seq
 524289518     gbgss25.seq
 249999182     gbgss250.seq
 249999521     gbgss251.seq
 249999273     gbgss252.seq
 249999982     gbgss253.seq
 141286832     gbgss254.seq
 249999562     gbgss255.seq
 249998752     gbgss256.seq
 249999600     gbgss257.seq
 249999029     gbgss258.seq
 249999913     gbgss259.seq
 524289126     gbgss26.seq
  31601752     gbgss260.seq
 524291882     gbgss27.seq
 524289238     gbgss28.seq
 524290063     gbgss29.seq
 524291209     gbgss3.seq
 524291675     gbgss30.seq
  39710031     gbgss31.seq
 524289648     gbgss32.seq
 524290113     gbgss33.seq
 524289714     gbgss34.seq
 524289477     gbgss35.seq
 524289253     gbgss36.seq
 524289803     gbgss37.seq
 524290304     gbgss38.seq
 509235276     gbgss39.seq
 524291248     gbgss4.seq
 524291637     gbgss40.seq
 524290032     gbgss41.seq
 524290785     gbgss42.seq
  27290698     gbgss43.seq
 524288946     gbgss44.seq
 524288881     gbgss45.seq
 524289248     gbgss46.seq
 524288900     gbgss47.seq
 223531204     gbgss48.seq
 524290426     gbgss49.seq
 168382749     gbgss5.seq
 524289735     gbgss50.seq
 524291269     gbgss51.seq
 524290992     gbgss52.seq
 524290041     gbgss53.seq
 524288997     gbgss54.seq
 524292017     gbgss55.seq
 524290771     gbgss56.seq
 524290630     gbgss57.seq
 524289617     gbgss58.seq
 524288925     gbgss59.seq
 524290951     gbgss6.seq
  36635990     gbgss60.seq
 524291629     gbgss61.seq
 524290608     gbgss62.seq
 524291618     gbgss63.seq
 461765495     gbgss64.seq
 524290190     gbgss65.seq
 524290828     gbgss66.seq
 524290508     gbgss67.seq
 524290868     gbgss68.seq
 524289498     gbgss69.seq
 524288796     gbgss7.seq
 524288938     gbgss70.seq
 524290467     gbgss71.seq
 524288729     gbgss72.seq
 524290924     gbgss73.seq
 524289241     gbgss74.seq
 524290569     gbgss75.seq
 524289070     gbgss76.seq
  49646918     gbgss77.seq
 524291014     gbgss78.seq
 524289021     gbgss79.seq
 524291665     gbgss8.seq
 524290279     gbgss80.seq
 524290660     gbgss81.seq
 524291034     gbgss82.seq
 524290373     gbgss83.seq
 524289673     gbgss84.seq
 524289427     gbgss85.seq
 524291776     gbgss86.seq
 524289284     gbgss87.seq
 524289797     gbgss88.seq
 390928760     gbgss89.seq
 524290499     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 250000034     gbhtc1.seq
 249998647     gbhtc10.seq
 249997533     gbhtc11.seq
  33336954     gbhtc12.seq
 249997337     gbhtc13.seq
 249997513     gbhtc14.seq
  66501472     gbhtc15.seq
 249992681     gbhtc2.seq
 249996913     gbhtc3.seq
 249991889     gbhtc4.seq
 249985674     gbhtc5.seq
 249997743     gbhtc6.seq
 249996123     gbhtc7.seq
  84096736     gbhtc8.seq
 249996193     gbhtc9.seq
 249907861     gbhtg1.seq
 249801162     gbhtg10.seq
 249917504     gbhtg100.seq
 249844960     gbhtg101.seq
 249902534     gbhtg102.seq
 249987237     gbhtg103.seq
   5671243     gbhtg104.seq
 249937699     gbhtg105.seq
 249890707     gbhtg106.seq
 249627730     gbhtg107.seq
 249784108     gbhtg108.seq
 249918357     gbhtg109.seq
   1643239     gbhtg11.seq
 249872422     gbhtg110.seq
 179990578     gbhtg111.seq
 249886747     gbhtg112.seq
 249853982     gbhtg113.seq
 249945826     gbhtg114.seq
 249865680     gbhtg115.seq
 249873643     gbhtg116.seq
 249764940     gbhtg117.seq
 249985854     gbhtg118.seq
 115386031     gbhtg119.seq
 249888438     gbhtg12.seq
 249867328     gbhtg120.seq
 249979076     gbhtg121.seq
 249891974     gbhtg122.seq
 249811641     gbhtg123.seq
 249909936     gbhtg124.seq
  32001278     gbhtg125.seq
 249935899     gbhtg126.seq
 249834856     gbhtg127.seq
 249925989     gbhtg128.seq
 249893130     gbhtg129.seq
 249970556     gbhtg13.seq
 249991866     gbhtg130.seq
 135260137     gbhtg131.seq
 249837708     gbhtg132.seq
 249847144     gbhtg133.seq
 249810959     gbhtg134.seq
 249845531     gbhtg135.seq
 249823951     gbhtg136.seq
 249763586     gbhtg137.seq
 249983283     gbhtg138.seq
 249909427     gbhtg139.seq
 249587437     gbhtg14.seq
 249823121     gbhtg140.seq
  77645919     gbhtg141.seq
 249775919     gbhtg15.seq
 249742391     gbhtg16.seq
 249169910     gbhtg17.seq
 249983662     gbhtg18.seq
 249677588     gbhtg19.seq
 249988506     gbhtg2.seq
 249988774     gbhtg20.seq
 237145184     gbhtg21.seq
 249760635     gbhtg22.seq
 249868408     gbhtg23.seq
 249987789     gbhtg24.seq
 249921752     gbhtg25.seq
 249761262     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249842167     gbhtg29.seq
 249988698     gbhtg3.seq
 249992987     gbhtg30.seq
 225324756     gbhtg31.seq
 249827828     gbhtg32.seq
 249920778     gbhtg33.seq
 249929470     gbhtg34.seq
 249919058     gbhtg35.seq
 249858216     gbhtg36.seq
 249814780     gbhtg37.seq
 249767485     gbhtg38.seq
 249627604     gbhtg39.seq
 249766042     gbhtg4.seq
 249839726     gbhtg40.seq
 224363181     gbhtg41.seq
 249889409     gbhtg42.seq
 249786859     gbhtg43.seq
 249974474     gbhtg44.seq
 249775813     gbhtg45.seq
 249912495     gbhtg46.seq
 249597904     gbhtg47.seq
 249994359     gbhtg48.seq
 249827714     gbhtg49.seq
 249989014     gbhtg5.seq
 249877445     gbhtg50.seq
 234821586     gbhtg51.seq
 249732630     gbhtg52.seq
 249917798     gbhtg53.seq
 249773220     gbhtg54.seq
 249971346     gbhtg55.seq
 249962503     gbhtg56.seq
  18795866     gbhtg57.seq
 249861298     gbhtg58.seq
 249823559     gbhtg59.seq
 249770427     gbhtg6.seq
 249990589     gbhtg60.seq
 249921231     gbhtg61.seq
 225131050     gbhtg62.seq
 249853671     gbhtg63.seq
 249787654     gbhtg64.seq
 249883726     gbhtg65.seq
 249980288     gbhtg66.seq
 249833261     gbhtg67.seq
  16614633     gbhtg68.seq
 249960711     gbhtg69.seq
 249852195     gbhtg7.seq
 249973591     gbhtg70.seq
 249953795     gbhtg71.seq
 249976849     gbhtg72.seq
 224833550     gbhtg73.seq
 249811083     gbhtg74.seq
 249874989     gbhtg75.seq
 249800276     gbhtg76.seq
 249959811     gbhtg77.seq
 244236597     gbhtg78.seq
 249884075     gbhtg79.seq
 249758873     gbhtg8.seq
 249989775     gbhtg80.seq
 249840148     gbhtg81.seq
 249838461     gbhtg82.seq
 216751404     gbhtg83.seq
 249966974     gbhtg84.seq
 249803238     gbhtg85.seq
 249757896     gbhtg86.seq
 249849119     gbhtg87.seq
 220831501     gbhtg88.seq
 249970341     gbhtg89.seq
 249968894     gbhtg9.seq
 249954491     gbhtg90.seq
 249999471     gbhtg91.seq
 249963741     gbhtg92.seq
 208664273     gbhtg93.seq
 249870418     gbhtg94.seq
 249944588     gbhtg95.seq
 249904036     gbhtg96.seq
 249769960     gbhtg97.seq
 167889800     gbhtg98.seq
 249744704     gbhtg99.seq
 249998798     gbinv1.seq
 249998992     gbinv10.seq
 249998207     gbinv11.seq
 181284762     gbinv12.seq
 249999219     gbinv13.seq
 249999822     gbinv14.seq
 249998845     gbinv15.seq
 159788224     gbinv16.seq
 249999177     gbinv17.seq
 249039050     gbinv18.seq
 249999814     gbinv19.seq
 249889604     gbinv2.seq
 249997738     gbinv20.seq
 249999813     gbinv21.seq
  11152155     gbinv22.seq
 223881343     gbinv23.seq
 175506967     gbinv24.seq
 249997752     gbinv25.seq
 249999385     gbinv26.seq
 102974106     gbinv27.seq
 249998201     gbinv28.seq
 249998374     gbinv29.seq
 236722945     gbinv3.seq
 249999009     gbinv30.seq
 250000151     gbinv31.seq
 249891017     gbinv32.seq
   2787477     gbinv33.seq
 249995918     gbinv4.seq
 249996906     gbinv5.seq
 249756501     gbinv6.seq
 249995710     gbinv7.seq
  41769127     gbinv8.seq
 249997977     gbinv9.seq
 139340358     gbjou1.idx
 305252873     gbjou10.idx
 297041333     gbjou11.idx
 261826286     gbjou12.idx
 220573172     gbjou13.idx
  22960429     gbjou14.idx
 139418432     gbjou2.idx
 163354303     gbjou3.idx
 142011534     gbjou4.idx
 234836634     gbjou5.idx
 289358240     gbjou6.idx
 257092152     gbjou7.idx
 280732009     gbjou8.idx
 293173698     gbjou9.idx
 354192523     gbkey1.idx
 180097208     gbkey2.idx
 179384371     gbkey3.idx
 264748200     gbkey4.idx
 210011455     gbkey5.idx
 183456832     gbkey6.idx
 122138122     gbkey7.idx
 249863023     gbmam1.seq
 249963061     gbmam2.seq
 249885616     gbmam3.seq
 249998162     gbmam4.seq
 249997414     gbmam5.seq
 249999421     gbmam6.seq
 249999158     gbmam7.seq
  69057603     gbmam8.seq
  25643451     gbnew.txt
 249999224     gbpat1.seq
 250000069     gbpat10.seq
 249999793     gbpat100.seq
 149112469     gbpat101.seq
 249999880     gbpat102.seq
 249999565     gbpat103.seq
 249929731     gbpat104.seq
 249824879     gbpat105.seq
 249998856     gbpat106.seq
 192957445     gbpat107.seq
 250000209     gbpat108.seq
 249999625     gbpat109.seq
 179605805     gbpat11.seq
 249995259     gbpat110.seq
  80149593     gbpat111.seq
 249999663     gbpat112.seq
 250000019     gbpat113.seq
 249999595     gbpat114.seq
 249999878     gbpat115.seq
 249849703     gbpat116.seq
  66835452     gbpat117.seq
 249999441     gbpat118.seq
 249999845     gbpat119.seq
 249999800     gbpat12.seq
 249999888     gbpat120.seq
 249999095     gbpat121.seq
 160256390     gbpat122.seq
 249999974     gbpat123.seq
 249999633     gbpat124.seq
 234784218     gbpat125.seq
 249991591     gbpat126.seq
 249970935     gbpat127.seq
 249999681     gbpat128.seq
 249997397     gbpat129.seq
 250000262     gbpat13.seq
 249997452     gbpat130.seq
  66832984     gbpat131.seq
 249992315     gbpat132.seq
 249999867     gbpat133.seq
 250000197     gbpat134.seq
 249999821     gbpat135.seq
 249998337     gbpat136.seq
  18437114     gbpat137.seq
 249999655     gbpat138.seq
 249998828     gbpat139.seq
 249999107     gbpat14.seq
 249999803     gbpat140.seq
 249999630     gbpat141.seq
 249999242     gbpat142.seq
 156351865     gbpat143.seq
 249998039     gbpat144.seq
 250000068     gbpat145.seq
 250000067     gbpat146.seq
  86028783     gbpat147.seq
 249999922     gbpat148.seq
 249999547     gbpat149.seq
 249998247     gbpat15.seq
 250000047     gbpat150.seq
  63545113     gbpat151.seq
 249997936     gbpat152.seq
 249998685     gbpat153.seq
 250000097     gbpat154.seq
 249998938     gbpat155.seq
 250000265     gbpat156.seq
 249999035     gbpat157.seq
 222257365     gbpat158.seq
 250000249     gbpat159.seq
 249998662     gbpat16.seq
 249999893     gbpat160.seq
 249999893     gbpat161.seq
 220539897     gbpat162.seq
 249999753     gbpat163.seq
 250000152     gbpat164.seq
 249999979     gbpat165.seq
  12389115     gbpat166.seq
 249997274     gbpat167.seq
 249998918     gbpat168.seq
 249999535     gbpat169.seq
  65949737     gbpat17.seq
 249999609     gbpat170.seq
  35425686     gbpat171.seq
 249998936     gbpat172.seq
 249999147     gbpat173.seq
 249999261     gbpat174.seq
 249999114     gbpat175.seq
 249999335     gbpat176.seq
 249999993     gbpat177.seq
 147946096     gbpat178.seq
 250000201     gbpat179.seq
 250000027     gbpat18.seq
 249999686     gbpat180.seq
 249998303     gbpat181.seq
 140781203     gbpat182.seq
 249999801     gbpat19.seq
 249997564     gbpat2.seq
 250000170     gbpat20.seq
 249995119     gbpat21.seq
 186149817     gbpat22.seq
 249999352     gbpat23.seq
 249967655     gbpat24.seq
 249999252     gbpat25.seq
 249999307     gbpat26.seq
  71269871     gbpat27.seq
 249992428     gbpat28.seq
 249999397     gbpat29.seq
 249999687     gbpat3.seq
 249998557     gbpat30.seq
 249999292     gbpat31.seq
 250000003     gbpat32.seq
 180220267     gbpat33.seq
 249999227     gbpat34.seq
 249999204     gbpat35.seq
 249999914     gbpat36.seq
 249998923     gbpat37.seq
 130551393     gbpat38.seq
 249997332     gbpat39.seq
 249995996     gbpat4.seq
 249995262     gbpat40.seq
 249998829     gbpat41.seq
 249999496     gbpat42.seq
 249995159     gbpat43.seq
 249899385     gbpat44.seq
 249999190     gbpat45.seq
 249999197     gbpat46.seq
 171471500     gbpat47.seq
 249999317     gbpat48.seq
 249997524     gbpat49.seq
  71719615     gbpat5.seq
 249999853     gbpat50.seq
 249999528     gbpat51.seq
 222937739     gbpat52.seq
 249999057     gbpat53.seq
 249999815     gbpat54.seq
 250000246     gbpat55.seq
 164995993     gbpat56.seq
 249886561     gbpat57.seq
 249998432     gbpat58.seq
 250000003     gbpat59.seq
 249999527     gbpat6.seq
 250000158     gbpat60.seq
 135004984     gbpat61.seq
 249998945     gbpat62.seq
 249999978     gbpat63.seq
 249999690     gbpat64.seq
 249998210     gbpat65.seq
 249999753     gbpat66.seq
 249999682     gbpat67.seq
 144886744     gbpat68.seq
 250000135     gbpat69.seq
 250000218     gbpat7.seq
 249999899     gbpat70.seq
 249998837     gbpat71.seq
 244400042     gbpat72.seq
 248969066     gbpat73.seq
 244459261     gbpat74.seq
 247875799     gbpat75.seq
 249999921     gbpat76.seq
 160624439     gbpat77.seq
 250000121     gbpat78.seq
 249999657     gbpat79.seq
 249998836     gbpat8.seq
 249999470     gbpat80.seq
 249999644     gbpat81.seq
 249996869     gbpat82.seq
 250000181     gbpat83.seq
  93339777     gbpat84.seq
 249156483     gbpat85.seq
 249999683     gbpat86.seq
 249999994     gbpat87.seq
 249999368     gbpat88.seq
 249999290     gbpat89.seq
 250000160     gbpat9.seq
 249999957     gbpat90.seq
 145297619     gbpat91.seq
 249999508     gbpat92.seq
 249998980     gbpat93.seq
 249999939     gbpat94.seq
 250000257     gbpat95.seq
 196964910     gbpat96.seq
 249999051     gbpat97.seq
 249998995     gbpat98.seq
 249999064     gbpat99.seq
 213560560     gbphg1.seq
 249996775     gbpln1.seq
 249999740     gbpln10.seq
 249998752     gbpln11.seq
 249999449     gbpln12.seq
 249892935     gbpln13.seq
 214585736     gbpln14.seq
 249969765     gbpln15.seq
 249989406     gbpln16.seq
 249992843     gbpln17.seq
 249928458     gbpln18.seq
 249994013     gbpln19.seq
 249886915     gbpln2.seq
 249952454     gbpln20.seq
 249995569     gbpln21.seq
  33983667     gbpln22.seq
 249991306     gbpln23.seq
  97752990     gbpln24.seq
 249998520     gbpln25.seq
 249998124     gbpln26.seq
 249837325     gbpln27.seq
 221260740     gbpln28.seq
 181007284     gbpln29.seq
 249768732     gbpln3.seq
 249670768     gbpln30.seq
 249895640     gbpln31.seq
 249999868     gbpln32.seq
 250000243     gbpln33.seq
 250000128     gbpln34.seq
 156468880     gbpln35.seq
 249997992     gbpln36.seq
 249999057     gbpln37.seq
 249999371     gbpln38.seq
 250000253     gbpln39.seq
 249893596     gbpln4.seq
 143909423     gbpln40.seq
 249943308     gbpln41.seq
 249905662     gbpln42.seq
 249999037     gbpln43.seq
 249999193     gbpln44.seq
 245992794     gbpln45.seq
 219728195     gbpln46.seq
 249999905     gbpln47.seq
 249550572     gbpln48.seq
 249998967     gbpln49.seq
 249824463     gbpln5.seq
 249998895     gbpln50.seq
 249998365     gbpln51.seq
  28960287     gbpln52.seq
 250000244     gbpln53.seq
 249998624     gbpln54.seq
 249999811     gbpln55.seq
 249887601     gbpln56.seq
 249996435     gbpln57.seq
 250000200     gbpln58.seq
 130593883     gbpln59.seq
 249976671     gbpln6.seq
 249299708     gbpln7.seq
 249998725     gbpln8.seq
 101109981     gbpln9.seq
 148968929     gbpri1.seq
 249860761     gbpri10.seq
 131545508     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249902715     gbpri16.seq
 249876249     gbpri17.seq
 249992266     gbpri18.seq
 249904047     gbpri19.seq
 249885275     gbpri2.seq
 249955645     gbpri20.seq
 249974539     gbpri21.seq
 249913702     gbpri22.seq
  57376514     gbpri23.seq
 177491906     gbpri24.seq
 249998492     gbpri25.seq
 211357951     gbpri26.seq
 249984318     gbpri27.seq
 249988068     gbpri28.seq
 249947682     gbpri29.seq
 249872295     gbpri3.seq
 249935305     gbpri30.seq
 249956545     gbpri31.seq
 249969435     gbpri32.seq
 249968207     gbpri33.seq
 249985584     gbpri34.seq
  99003572     gbpri35.seq
 249993971     gbpri36.seq
 249997177     gbpri37.seq
 249926095     gbpri38.seq
 249994583     gbpri39.seq
 249930116     gbpri4.seq
 249997671     gbpri40.seq
 184925076     gbpri41.seq
 249999830     gbpri42.seq
 249999034     gbpri43.seq
 249998899     gbpri44.seq
  81409729     gbpri45.seq
 249863455     gbpri5.seq
 249792010     gbpri6.seq
 249859687     gbpri7.seq
 249806231     gbpri8.seq
 249896907     gbpri9.seq
    336441     gbrel.txt
 249952887     gbrod1.seq
 249890064     gbrod10.seq
  63086316     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249944172     gbrod18.seq
 249740612     gbrod19.seq
 249927954     gbrod2.seq
 249742613     gbrod20.seq
 249924095     gbrod21.seq
 230194968     gbrod22.seq
 249997864     gbrod23.seq
 250000163     gbrod24.seq
 249953950     gbrod25.seq
 249850861     gbrod26.seq
 249999285     gbrod27.seq
 249999569     gbrod28.seq
 228470294     gbrod29.seq
 249846934     gbrod3.seq
 249801207     gbrod4.seq
 249878898     gbrod5.seq
 249894478     gbrod6.seq
 249944880     gbrod7.seq
 249973808     gbrod8.seq
 249999120     gbrod9.seq
4554412719     gbsdr1.txt
5897199457     gbsdr2.txt
2762775895     gbsdr3.txt
 166387531     gbsec.idx
 249996637     gbsts1.seq
 249997720     gbsts10.seq
 210919464     gbsts11.seq
 249996524     gbsts12.seq
 249998812     gbsts13.seq
 249999881     gbsts14.seq
 249999569     gbsts15.seq
  24453604     gbsts16.seq
 249999107     gbsts17.seq
 249999933     gbsts18.seq
 249998944     gbsts19.seq
 249998310     gbsts2.seq
 148910603     gbsts20.seq
 250000245     gbsts3.seq
 249996479     gbsts4.seq
  39285911     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249999304     gbsts9.seq
 249998424     gbsyn1.seq
 249998740     gbsyn2.seq
 249982438     gbsyn3.seq
 249995958     gbsyn4.seq
 249978656     gbsyn5.seq
 249956817     gbsyn6.seq
 142481091     gbsyn7.seq
 249998949     gbtsa1.seq
  60152536     gbtsa10.seq
 250000174     gbtsa100.seq
 249999584     gbtsa101.seq
 249997105     gbtsa102.seq
 196200322     gbtsa103.seq
 249999600     gbtsa104.seq
 249994630     gbtsa105.seq
 249997962     gbtsa106.seq
 249998548     gbtsa107.seq
 249999647     gbtsa108.seq
 249999586     gbtsa109.seq
 249997488     gbtsa11.seq
 249999725     gbtsa110.seq
 249997827     gbtsa111.seq
 116050893     gbtsa112.seq
 249995952     gbtsa12.seq
 249999431     gbtsa13.seq
 249999867     gbtsa14.seq
 249999291     gbtsa15.seq
  37289699     gbtsa16.seq
 249998569     gbtsa17.seq
 249998880     gbtsa18.seq
 249999066     gbtsa19.seq
 249997872     gbtsa2.seq
 249993881     gbtsa20.seq
 175705543     gbtsa21.seq
 249999624     gbtsa22.seq
 249998425     gbtsa23.seq
 249999491     gbtsa24.seq
 249999247     gbtsa25.seq
 249999747     gbtsa26.seq
 249998903     gbtsa27.seq
  40124348     gbtsa28.seq
 249998953     gbtsa29.seq
 249998023     gbtsa3.seq
 249997667     gbtsa30.seq
 250000063     gbtsa31.seq
 249998720     gbtsa32.seq
 249999882     gbtsa33.seq
 249999779     gbtsa34.seq
 249998416     gbtsa35.seq
   5664107     gbtsa36.seq
 249997128     gbtsa37.seq
 249999411     gbtsa38.seq
 249998366     gbtsa39.seq
 250000174     gbtsa4.seq
 249999971     gbtsa40.seq
  62939241     gbtsa41.seq
 249998923     gbtsa42.seq
 249999602     gbtsa43.seq
 249998333     gbtsa44.seq
 249999006     gbtsa45.seq
  74665083     gbtsa46.seq
 249999615     gbtsa47.seq
 249998945     gbtsa48.seq
 249997943     gbtsa49.seq
  89214320     gbtsa5.seq
 249997483     gbtsa50.seq
 249997286     gbtsa51.seq
 249999918     gbtsa52.seq
 249998636     gbtsa53.seq
 178872109     gbtsa54.seq
 249996642     gbtsa55.seq
 249998501     gbtsa56.seq
 249999029     gbtsa57.seq
 249999341     gbtsa58.seq
 249997360     gbtsa59.seq
 249998268     gbtsa6.seq
 249999156     gbtsa60.seq
 214694295     gbtsa61.seq
 249999216     gbtsa62.seq
 250000224     gbtsa63.seq
 249998245     gbtsa64.seq
 249998468     gbtsa65.seq
 250000251     gbtsa66.seq
 100267956     gbtsa67.seq
 249999943     gbtsa68.seq
 249997522     gbtsa69.seq
 250000072     gbtsa7.seq
 249998509     gbtsa70.seq
 249998538     gbtsa71.seq
 249998464     gbtsa72.seq
  26840872     gbtsa73.seq
 249999932     gbtsa74.seq
 249998917     gbtsa75.seq
 249998531     gbtsa76.seq
 249997728     gbtsa77.seq
 249997863     gbtsa78.seq
 249998169     gbtsa79.seq
 250000052     gbtsa8.seq
 249997077     gbtsa80.seq
  31414257     gbtsa81.seq
 249998284     gbtsa82.seq
 249998100     gbtsa83.seq
 249998276     gbtsa84.seq
 249999907     gbtsa85.seq
 249998577     gbtsa86.seq
  29919285     gbtsa87.seq
 249998447     gbtsa88.seq
 249998843     gbtsa89.seq
 249997923     gbtsa9.seq
 249999713     gbtsa90.seq
 249998940     gbtsa91.seq
 244854076     gbtsa92.seq
 249999257     gbtsa93.seq
 249998411     gbtsa94.seq
 249997711     gbtsa95.seq
 249998937     gbtsa96.seq
 249719593     gbtsa97.seq
 249999535     gbtsa98.seq
 249998914     gbtsa99.seq
    496442     gbuna1.seq
 249997497     gbvrl1.seq
 249996596     gbvrl10.seq
 230556266     gbvrl11.seq
 249996666     gbvrl12.seq
 249994854     gbvrl13.seq
 249997869     gbvrl14.seq
 249999604     gbvrl15.seq
 162889778     gbvrl16.seq
 249993300     gbvrl17.seq
 249982967     gbvrl18.seq
 249997833     gbvrl19.seq
 249999242     gbvrl2.seq
 249995201     gbvrl20.seq
 249996027     gbvrl21.seq
 116295067     gbvrl22.seq
 249998888     gbvrl3.seq
 249997426     gbvrl4.seq
 203255865     gbvrl5.seq
 250000031     gbvrl6.seq
 249998773     gbvrl7.seq
 249995105     gbvrl8.seq
 249999147     gbvrl9.seq
 249915660     gbvrt1.seq
 249855727     gbvrt10.seq
 249950363     gbvrt11.seq
 185412106     gbvrt12.seq
 249994619     gbvrt13.seq
 249897444     gbvrt14.seq
 249910477     gbvrt15.seq
 249999651     gbvrt16.seq
 249999508     gbvrt17.seq
 249997811     gbvrt18.seq
  99263725     gbvrt19.seq
 249823521     gbvrt2.seq
 249950820     gbvrt20.seq
 249997972     gbvrt21.seq
 249998686     gbvrt22.seq
 249997534     gbvrt23.seq
 249999370     gbvrt24.seq
 250000106     gbvrt25.seq
 249999827     gbvrt26.seq
 167099111     gbvrt27.seq
 249883407     gbvrt3.seq
 249997801     gbvrt4.seq
 113933022     gbvrt5.seq
 250000086     gbvrt6.seq
 249994827     gbvrt7.seq
 249879945     gbvrt8.seq
 249793188     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63964      86337907
BCT10        66         116730258
BCT11        74         112572581
BCT12        115        115325441
BCT13        44         113286588
BCT14        16101      45900496
BCT15        53933      85391494
BCT16        93         110189094
BCT17        151        93915681
BCT18        61         112455059
BCT19        52         112042350
BCT2         8146       109474737
BCT20        46         114233015
BCT21        58         114931588
BCT22        67         111284815
BCT23        36         96325907
BCT24        40         106881287
BCT25        58         105533856
BCT26        74         111675186
BCT27        55         110045255
BCT28        63         106845575
BCT29        55         109391288
BCT3         52         112760544
BCT30        53         108650404
BCT31        46         110496749
BCT32        95         109522868
BCT33        59         110966729
BCT34        67         108616570
BCT35        124        106350090
BCT36        37         71643089
BCT37        200        108779787
BCT38        53         109969009
BCT39        38         108760252
BCT4         56         109240941
BCT40        58         108566760
BCT41        56         107056790
BCT42        44         107631668
BCT43        74         110145776
BCT44        63         109222644
BCT45        45         107106306
BCT46        59         105661869
BCT47        80         110031975
BCT48        76         103598262
BCT49        67         109336234
BCT5         38315      81650281
BCT50        60         103344001
BCT51        51         106715862
BCT52        56         105766361
BCT53        54         107452055
BCT54        64         111546035
BCT55        47         104055611
BCT56        69         108689945
BCT57        61         113403997
BCT58        64         109922985
BCT59        63         109426773
BCT6         39042      82648391
BCT60        51         114853662
BCT61        35         46539831
BCT62        37         108301494
BCT63        53         115243937
BCT64        54         113498150
BCT65        53         109920857
BCT66        122        113813295
BCT67        65         116010476
BCT68        83         115337289
BCT69        220        98447010
BCT7         5518       94828825
BCT70        350        52715337
BCT71        1589       2511877
BCT72        3179       5215935
BCT73        6347       7902871
BCT74        12648      15076979
BCT75        25620      27738207
BCT76        50524      54036411
BCT77        76191      77911071
BCT78        71333      77174315
BCT79        9881       94289735
BCT8         13773      81411004
BCT80        5443       100112702
BCT81        3203       107449195
BCT82        39         113461033
BCT83        2376       110225873
BCT84        5925       108700788
BCT85        40600      75488483
BCT86        67821      79675622
BCT87        4111       124375619
BCT88        52055      89938071
BCT89        76301      79624150
BCT9         6838       96099579
BCT90        76698      78944257
BCT91        47186      87430848
ENV1         94104      70654692
ENV10        93251      72992468
ENV11        83203      87348958
ENV12        20758      17760380
ENV13        84748      80843700
ENV14        118375     43040171
ENV15        89183      77253657
ENV16        96496      67709152
ENV17        96130      63410337
ENV18        110559     66902497
ENV19        116972     67911907
ENV2         94649      68935041
ENV20        56635      76471364
ENV21        67983      87505211
ENV22        91106      74601703
ENV23        128242     34584261
ENV24        123050     29085257
ENV25        77959      17881890
ENV26        123121     49787346
ENV27        97689      67743895
ENV28        115709     56215319
ENV29        136377     52708778
ENV3         84671      76040787
ENV30        108582     61731385
ENV31        69515      51811672
ENV32        62536      84995133
ENV33        88979      73398903
ENV34        102624     44144264
ENV35        96843      56252227
ENV36        70694      54682368
ENV37        111341     47244097
ENV38        101086     61316240
ENV39        107217     63313935
ENV4         81621      83650567
ENV40        63535      90709116
ENV41        72613      78816555
ENV42        62032      84254413
ENV43        11050      15062180
ENV44        71793      79117723
ENV45        108676     48868025
ENV46        112200     56830463
ENV47        104860     61099749
ENV48        71478      37836557
ENV49        100506     44094010
ENV5         89160      84754086
ENV50        42757      53805700
ENV51        42381      55136831
ENV52        60471      57429118
ENV53        100137     59513368
ENV54        99733      59511112
ENV55        77923      84656591
ENV56        87351      72109006
ENV57        34973      25908513
ENV6         100336     66965556
ENV7         3409       351186
ENV8         131426     31030828
ENV9         86280      70411430
EST1         158919     61572670
EST10        167136     71987124
EST100       231736     140763677
EST101       237801     124861802
EST102       190121     104227132
EST103       184383     101960893
EST104       103255     71898629
EST105       160238     119715675
EST106       172274     105505357
EST107       134993     84824109
EST108       64410      24032213
EST109       63776      22430545
EST11        169723     74100103
EST110       64300      23290552
EST111       64314      27067505
EST112       64824      23108014
EST113       65040      24789732
EST114       63924      27181669
EST115       64305      26428863
EST116       64500      27445217
EST117       64330      25257020
EST118       61686      34904925
EST119       143086     68946802
EST12        166643     70029765
EST120       160862     84980820
EST121       176991     92873784
EST122       149340     96407517
EST123       156327     91866902
EST124       120454     78352052
EST125       189395     90785712
EST126       156163     83086158
EST127       157299     84443808
EST128       156473     84631750
EST129       151637     85041499
EST13        73164      35016155
EST130       172879     92806640
EST131       183351     116986849
EST132       202632     102425032
EST133       159026     87134784
EST134       163132     82939830
EST135       142118     83540684
EST136       144986     89679654
EST137       100783     53710109
EST138       173414     97939042
EST139       245181     113126747
EST14        217756     109283250
EST140       154609     83537231
EST141       167333     92307494
EST142       150632     88077845
EST143       133603     81709045
EST144       154276     96730064
EST145       155919     85642646
EST146       124543     63436565
EST147       121489     65223213
EST148       127998     58057539
EST149       127406     51315410
EST15        168446     105158467
EST150       128755     51319204
EST151       114836     42807454
EST152       163811     82666829
EST153       176181     73812808
EST154       162336     110222029
EST155       199949     122657089
EST156       214263     121765344
EST157       175421     97160206
EST158       154756     108203016
EST159       141941     95125676
EST16        179130     112614607
EST160       154684     96135971
EST161       157570     82567863
EST162       139282     78417421
EST163       167515     93150916
EST164       72224      44791549
EST165       150026     91755971
EST166       191850     110266521
EST167       145719     83912033
EST168       142852     72417592
EST169       148907     87004940
EST17        195643     113169467
EST170       190779     104718637
EST171       156407     95944513
EST172       168558     82344690
EST173       125070     86538529
EST174       169931     99555146
EST175       173298     100700765
EST176       122562     68070477
EST177       157099     90322185
EST178       36885      21444025
EST179       169724     102571222
EST18        190585     121354588
EST180       180461     118980204
EST181       143355     116918785
EST182       194736     99541170
EST183       153263     102172821
EST184       154545     102131493
EST185       141621     81868750
EST186       175382     70843804
EST187       150651     85169465
EST188       158224     99175801
EST189       155021     96146471
EST19        159352     114118119
EST190       139195     82598141
EST191       165720     100282736
EST192       145545     93178688
EST193       129265     90352886
EST194       144231     88153597
EST195       135848     88470760
EST196       129805     92784691
EST197       162724     86807768
EST198       173959     95600387
EST199       173380     96534297
EST2         161834     61542584
EST20        186608     99330728
EST200       171666     95207178
EST201       168841     95364304
EST202       171391     95596294
EST203       173219     95038721
EST204       173942     95721601
EST205       26177      14201683
EST206       188669     105137899
EST207       204797     104611955
EST208       172197     101986046
EST209       180084     101647848
EST21        217035     106291228
EST210       201547     123063255
EST211       193573     111781351
EST212       193319     123634351
EST213       156779     103959188
EST214       218947     141765002
EST215       235678     114622862
EST216       147247     103673940
EST217       162291     109343110
EST218       147438     94927316
EST219       177615     98532266
EST22        198923     66086149
EST220       189820     118130827
EST221       111640     87731326
EST222       134726     121259734
EST223       160083     93029254
EST224       148055     95107347
EST225       194881     107676223
EST226       166418     104031856
EST227       134162     92480363
EST228       142045     105257912
EST229       121269     87269510
EST23        141025     40096541
EST230       89557      60503553
EST231       144768     89897626
EST232       132135     93880853
EST233       142186     101213731
EST234       120293     86721421
EST235       125389     84242832
EST236       153351     106021853
EST237       160280     115759687
EST238       118523     122180889
EST239       148242     89064619
EST24        103792     28102294
EST240       183059     118560144
EST241       151203     92534285
EST242       170628     107952094
EST243       166943     121547985
EST244       146698     107320481
EST245       8906       6362041
EST246       151715     100082633
EST247       206418     97759831
EST248       197151     110513218
EST249       146753     91228207
EST25        121414     50823833
EST250       220509     24591012
EST251       220757     90237284
EST252       164684     118595620
EST253       177311     103387057
EST254       160930     107365116
EST255       174766     114833376
EST256       157398     114451736
EST257       101579     56552885
EST258       185289     97785186
EST259       177022     102341748
EST26        213500     97045520
EST260       165945     121340044
EST261       210626     102294901
EST262       269576     117341119
EST263       214173     122801359
EST264       182514     44136343
EST265       240417     107128719
EST266       174713     100608135
EST267       166978     104766781
EST268       92746      57343478
EST269       164030     113461012
EST27        218821     110004275
EST270       201476     103912213
EST271       152228     104687319
EST272       197831     116679450
EST273       195449     52611643
EST274       210331     39538497
EST275       182494     101653016
EST276       164496     115804753
EST277       189706     115628351
EST278       180337     107462954
EST279       160073     104297049
EST28        190221     88562402
EST280       106161     40386536
EST281       147593     85695119
EST282       117008     78203378
EST283       157394     106351340
EST284       244395     38946532
EST285       263887     24179927
EST286       171202     88731666
EST287       166715     109463390
EST288       160290     104734259
EST289       148715     92135281
EST29        158137     68948955
EST290       258880     39389841
EST291       177749     95033570
EST292       64615      47794566
EST293       192329     109522564
EST294       144559     79242536
EST295       178862     121744250
EST296       188894     110716047
EST297       151806     112642310
EST298       189987     105397790
EST299       180015     100585611
EST3         153587     54414675
EST30        171775     69728415
EST300       172988     111848667
EST301       188954     63258295
EST302       187215     68635882
EST303       187693     72975596
EST304       128011     46992822
EST305       192216     88863459
EST306       179877     125364399
EST307       160571     94456899
EST308       154557     91283219
EST309       127997     97520841
EST31        148798     63215048
EST310       148262     98976672
EST311       162521     99315208
EST312       167372     93658273
EST313       170432     103508709
EST314       150232     97259043
EST315       149921     101416373
EST316       164124     107807702
EST317       151489     104740027
EST318       178936     150072231
EST319       174213     115913600
EST32        168199     76004918
EST320       141271     75253084
EST321       144208     98288821
EST322       145437     100444605
EST323       132276     88878297
EST324       148786     98902731
EST325       147675     100667051
EST326       177734     112925291
EST327       153470     83493039
EST328       150358     86424952
EST329       150067     104616727
EST33        173584     66337909
EST330       156003     98409956
EST331       79566      47516640
EST332       143135     90981581
EST333       141827     89322854
EST334       205417     111667272
EST335       136843     74813880
EST336       92239      55003229
EST337       129775     85504198
EST338       137181     87085033
EST339       125452     80194113
EST34        123644     43757615
EST340       158696     85033857
EST341       216404     84676112
EST342       170951     87042309
EST343       170553     103357648
EST344       165588     98540663
EST345       85203      56823876
EST346       132584     88321762
EST347       135771     88421295
EST348       185463     121451604
EST349       160450     97083787
EST35        97392      29901461
EST350       158182     80551374
EST351       188239     128379925
EST352       116595     80633718
EST353       73345      44017433
EST354       138222     76212809
EST355       130208     77979115
EST356       148017     57271510
EST357       158629     32415880
EST358       158521     32654597
EST359       181804     105305259
EST36        97797      30574042
EST360       13077      9450809
EST361       226538     117641425
EST362       250983     114598125
EST363       201835     104342014
EST364       147076     94885274
EST365       135877     87084788
EST366       144707     86544214
EST367       182289     113096105
EST368       225276     81748103
EST369       191158     97518786
EST37        96709      29349943
EST370       211803     119277932
EST371       157752     87236129
EST372       145393     69125636
EST373       201120     119076785
EST374       147430     93853103
EST375       184777     135623589
EST376       180675     140237613
EST377       162441     103719561
EST378       163815     101383616
EST379       185150     109845679
EST38        98626      29830017
EST380       185900     107606436
EST381       204759     110493322
EST382       177833     106503783
EST383       140706     83614696
EST384       184888     123193897
EST385       202502     135592313
EST386       224387     131662624
EST387       205197     134235502
EST388       207701     168872743
EST389       217037     134499061
EST39        99403      31247415
EST390       158430     101400733
EST391       192884     106605953
EST392       170155     17606334
EST393       160048     13420760
EST394       155343     25059222
EST395       158743     32128889
EST396       158802     31980988
EST397       151345     73243802
EST398       170634     99022961
EST399       172359     117240294
EST4         170787     67086973
EST40        23394      5960537
EST400       167888     97345300
EST401       152779     107287996
EST402       141804     98688876
EST403       146874     102258710
EST404       157644     98700396
EST405       158792     116230830
EST406       165571     100003435
EST407       168536     54992304
EST408       167928     36585403
EST409       158219     106892944
EST41        101031     52982598
EST410       156617     102686648
EST411       177448     115036221
EST412       138141     78682108
EST413       196008     113343201
EST414       154707     111803794
EST415       133899     91294202
EST416       139958     91915593
EST417       151390     92109918
EST418       172620     96349653
EST419       178657     98447072
EST42        119515     50854874
EST420       151115     91296729
EST421       3205       1648527
EST422       179386     108550252
EST423       152941     93578663
EST424       110566     75940707
EST425       84176      64716552
EST426       99761      67092628
EST427       144453     82127402
EST428       132714     79310833
EST429       133470     84194551
EST43        165778     91712098
EST430       137728     86930253
EST431       147028     90049042
EST432       169517     91369843
EST433       190065     112219090
EST434       125176     80882316
EST435       193072     108261868
EST436       25051      13509557
EST437       177285     82519901
EST438       155861     89004474
EST439       156784     86944122
EST44        170232     72290930
EST440       217078     126740380
EST441       176835     108683958
EST442       175475     106743911
EST443       139251     101177034
EST444       141090     91804958
EST445       152980     76688720
EST446       194321     87523238
EST447       202110     82868529
EST448       190297     79548953
EST449       192635     88480793
EST45        167187     84789083
EST450       179737     110387142
EST451       185946     90491165
EST452       186591     85952296
EST453       203488     109960564
EST454       191770     117381197
EST455       174124     103156122
EST456       203130     126938910
EST457       143913     93964117
EST458       157479     105334647
EST459       169557     85557391
EST46        168565     86876384
EST460       63019      35533479
EST461       145900     81432787
EST462       159772     85934183
EST463       181490     100497999
EST464       165709     84828699
EST465       168377     58996777
EST466       152994     59624151
EST47        163200     87801704
EST48        162156     83302752
EST49        160123     91074967
EST5         168952     66190553
EST50        161537     88070818
EST51        157131     98922479
EST52        159531     69786471
EST53        145752     81582908
EST54        78262      50668846
EST55        167002     69861908
EST56        164697     74782148
EST57        164326     90717418
EST58        159166     97167069
EST59        156478     101495566
EST6         171459     66908856
EST60        164593     98906560
EST61        160089     108008836
EST62        171070     81443562
EST63        173109     92397867
EST64        155487     84167139
EST65        148903     81876026
EST66        158741     98434282
EST67        136338     77286727
EST68        149429     91682683
EST69        194816     108038490
EST7         169823     72788178
EST70        180869     95053427
EST71        221041     121169478
EST72        185579     110616973
EST73        203845     121318765
EST74        163289     90035751
EST75        134019     61456479
EST76        139678     68739806
EST77        154483     93936535
EST78        157733     100225893
EST79        141896     78481894
EST8         179311     72807239
EST80        53308      24839183
EST81        164043     100440633
EST82        211918     114774017
EST83        223617     123690011
EST84        200505     94287247
EST85        211035     93329196
EST86        162202     92842281
EST87        144116     86871979
EST88        164214     81058421
EST89        158054     79863325
EST9         168645     69366546
EST90        152888     102069318
EST91        152106     88935982
EST92        135247     87207724
EST93        156068     113044317
EST94        142346     104167411
EST95        143182     102384560
EST96        141140     97519750
EST97        147028     80995521
EST98        178710     111261867
EST99        224230     135786265
GSS1         200049     87610619
GSS10        132038     60282099
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167236     128919983
GSS104       149785     82570423
GSS105       191525     120852658
GSS106       167632     112045681
GSS107       197296     115492795
GSS108       204965     134781001
GSS109       209819     138217602
GSS11        137026     73963370
GSS110       207582     140843676
GSS111       206233     142445590
GSS112       205238     143755060
GSS113       205194     143913008
GSS114       202116     146642001
GSS115       182317     139928302
GSS116       18567      10955671
GSS117       132846     84050698
GSS118       169072     79781623
GSS119       183491     78755162
GSS12        147892     75892995
GSS120       169917     147882911
GSS121       177511     120185913
GSS122       179713     146295726
GSS123       187250     120318213
GSS124       187061     139575183
GSS125       192224     126960331
GSS126       192031     92815068
GSS127       167984     157295485
GSS128       163017     113624848
GSS129       63314      38570390
GSS13        145394     68606312
GSS130       171035     155492836
GSS131       172358     154451939
GSS132       172393     155154973
GSS133       173792     154156214
GSS134       171958     154859390
GSS135       180250     138356993
GSS136       178139     146370889
GSS137       165379     118879881
GSS138       189590     95371943
GSS139       265791     41849675
GSS14        169793     84763419
GSS140       265731     40965131
GSS141       81220      12472457
GSS142       254320     58600070
GSS143       260083     56261687
GSS144       190600     86306160
GSS145       196144     66077329
GSS146       186142     147967569
GSS147       182754     151060616
GSS148       167958     155156816
GSS149       171115     157881251
GSS15        161094     97661031
GSS150       235018     72740193
GSS151       227933     79457580
GSS152       136166     57238196
GSS153       179645     71123213
GSS154       122314     72860319
GSS155       87077      63914781
GSS156       83559      62803060
GSS157       103633     48602104
GSS158       68640      58496681
GSS159       7828       7140695
GSS16        172835     87034673
GSS160       68591      57924394
GSS161       69224      56650935
GSS162       69460      56187403
GSS163       71202      55998401
GSS164       68561      51865315
GSS165       75915      58209304
GSS166       87237      74898207
GSS167       81504      44375177
GSS168       92239      44894040
GSS169       63973      47973862
GSS17        183363     113392831
GSS170       77367      61295678
GSS171       69656      58696022
GSS172       67712      62704471
GSS173       61920      53368409
GSS174       95643      42963254
GSS175       21165      4933990
GSS176       112938     70877522
GSS177       822        559311
GSS178       23226      28867035
GSS179       109092     70683886
GSS18        192347     114304499
GSS180       84555      34682016
GSS181       35744      22177639
GSS182       103304     62490220
GSS183       102329     63761256
GSS184       104268     67656826
GSS185       82099      41276456
GSS186       83102      54651503
GSS187       95684      61343347
GSS188       107373     78577773
GSS189       106314     76646515
GSS19        114273     52228513
GSS190       106101     79982459
GSS191       104015     80025091
GSS192       76402      51055333
GSS193       104482     63232426
GSS194       109868     66415305
GSS195       106047     59222776
GSS196       68381      37443617
GSS197       69506      38725653
GSS198       37368      17878843
GSS199       85481      46023427
GSS2         182295     92190515
GSS20        181787     101769657
GSS200       96935      55799967
GSS201       95009      49632000
GSS202       95897      55649530
GSS203       42678      23961360
GSS204       114055     43442995
GSS205       116422     39251295
GSS206       108882     55041759
GSS207       101472     78371349
GSS208       72643      46689469
GSS209       95891      36542252
GSS21        166208     114174113
GSS210       95417      37268709
GSS211       96671      35161518
GSS212       94285      39167432
GSS213       37736      17626556
GSS214       103939     66277823
GSS215       94551      61190929
GSS216       95128      60357048
GSS217       94773      60868501
GSS218       75675      70017159
GSS219       80787      68603070
GSS22        169505     97608334
GSS220       32556      33612970
GSS221       83736      28233267
GSS222       84219      27346468
GSS223       84926      25909272
GSS224       14851      4422302
GSS225       16547      7508221
GSS226       92128      59308050
GSS227       84494      52388719
GSS228       94098      50827589
GSS229       88585      48343496
GSS23        187250     126684076
GSS230       11366      6197879
GSS231       90648      56882510
GSS232       89662      61882079
GSS233       88553      63641206
GSS234       89283      62505584
GSS235       9890       7129098
GSS236       87995      63795538
GSS237       90151      62444409
GSS238       94367      59805167
GSS239       74143      62678833
GSS24        194054     130219272
GSS240       84189      78959221
GSS241       83078      80516319
GSS242       71019      53174669
GSS243       117650     64297121
GSS244       108874     55446727
GSS245       107533     52125503
GSS246       96658      43251344
GSS247       109801     49060015
GSS248       98194      46325477
GSS249       73059      72225597
GSS25        177482     105208945
GSS250       77252      72611065
GSS251       92149      71193561
GSS252       92496      70717940
GSS253       91063      68371307
GSS254       53301      32810242
GSS255       94787      57200301
GSS256       93517      59081345
GSS257       93900      58510429
GSS258       94714      57307691
GSS259       94197      58070562
GSS26        185732     107675520
GSS260       12741      6343956
GSS27        170506     151234083
GSS28        190511     146386306
GSS29        151054     106332306
GSS3         174946     87828983
GSS30        192536     132230345
GSS31        13906      8947947
GSS32        195895     127234153
GSS33        216654     116238131
GSS34        218577     113597712
GSS35        219716     112030658
GSS36        213973     121865192
GSS37        198560     156440039
GSS38        194985     146794861
GSS39        197291     73457394
GSS4         167157     85100788
GSS40        185038     97613049
GSS41        189714     125917418
GSS42        170994     159189605
GSS43        8594       5601792
GSS44        183999     100320381
GSS45        172666     121431355
GSS46        183067     123301526
GSS47        188535     120735257
GSS48        75421      65817457
GSS49        171545     101809563
GSS5         53455      31623154
GSS50        167648     103033730
GSS51        167797     102601882
GSS52        181966     120030309
GSS53        183671     115951946
GSS54        180675     122324637
GSS55        186380     112373101
GSS56        188973     135398180
GSS57        177496     103715733
GSS58        193462     118790383
GSS59        179834     130483059
GSS6         161617     84471320
GSS60        11859      10778852
GSS61        172841     138946229
GSS62        161635     111553131
GSS63        161673     111573561
GSS64        158830     107594298
GSS65        156726     129035698
GSS66        170186     142548648
GSS67        178808     116414085
GSS68        202003     126663756
GSS69        193525     110351742
GSS7         165321     79360873
GSS70        243841     125953050
GSS71        161398     107375254
GSS72        158017     118089918
GSS73        162108     124120427
GSS74        162074     124178449
GSS75        174033     108804801
GSS76        191241     140117430
GSS77        18382      11726115
GSS78        196572     124895921
GSS79        169659     110747724
GSS8         165782     88979534
GSS80        198937     130327630
GSS81        209570     89241268
GSS82        190513     95607097
GSS83        133194     93196958
GSS84        146028     117260125
GSS85        139698     116905241
GSS86        142745     113865568
GSS87        144086     119923469
GSS88        141642     115507937
GSS89        110756     92378197
GSS9         137999     67157719
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25057      27045808
HTC10        55896      70693175
HTC11        80041      70778311
HTC12        7835       9353773
HTC13        66993      60073171
HTC14        68563      69502858
HTC15        24588      16709696
HTC2         16086      36243320
HTC3         16029      36627693
HTC4         16251      35560357
HTC5         15980      40344457
HTC6         16068      37474845
HTC7         53834      31477922
HTC8         31137      19451907
HTC9         60957      77955151
HTG1         1318       188771164
HTG10        1297       186285876
HTG100       990        189440077
HTG101       996        189331054
HTG102       985        189419172
HTG103       1161       190585510
HTG104       30         4314892
HTG105       1087       189854687
HTG106       1046       189729798
HTG107       1386       191260179
HTG108       1295       190792465
HTG109       1639       191129237
HTG11        9          1245953
HTG110       1338       191984286
HTG111       945        138226591
HTG112       1435       191002309
HTG113       1522       189585821
HTG114       1413       178051407
HTG115       1209       154073372
HTG116       1330       173624734
HTG117       1256       189207285
HTG118       1061       185389901
HTG119       541        86944292
HTG12        1452       184004673
HTG120       1509       182779454
HTG121       1010       191768926
HTG122       1027       187615238
HTG123       1065       193671779
HTG124       1102       193157342
HTG125       130        24778576
HTG126       1029       189520679
HTG127       1054       192676832
HTG128       1163       191937540
HTG129       1080       192382243
HTG13        875        191786413
HTG130       1084       193101052
HTG131       592        104413873
HTG132       1122       192576031
HTG133       1080       192404979
HTG134       1078       192326016
HTG135       1166       191911933
HTG136       1517       191826635
HTG137       1069       192141286
HTG138       1069       192408918
HTG139       1130       191785062
HTG14        753        191921309
HTG140       1404       187560343
HTG141       395        55012384
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2468       186022324
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2515       185223642
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2549       188262266
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190634433
HTG47        1176       190820695
HTG48        1128       191324694
HTG49        1046       191269623
HTG5         1283       185544093
HTG50        1030       189585714
HTG51        1041       178589404
HTG52        968        190052338
HTG53        1105       190148899
HTG54        1046       190158403
HTG55        1014       189831932
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189903667
HTG6         1273       185016781
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1085       189487801
HTG64        1064       189415560
HTG65        1169       188798107
HTG66        1179       187545797
HTG67        1282       184397923
HTG68        94         12194080
HTG69        1221       185314622
HTG7         1275       185326125
HTG70        1239       184674446
HTG71        1244       184625496
HTG72        1183       187688486
HTG73        1018       169945682
HTG74        1118       188293510
HTG75        1103       190775743
HTG76        1135       190789237
HTG77        1182       190871034
HTG78        1096       185997580
HTG79        1171       190202119
HTG8         1459       184462575
HTG80        1115       190063261
HTG81        1213       189874691
HTG82        1120       189645029
HTG83        959        164682536
HTG84        1229       188409093
HTG85        1250       187741728
HTG86        1141       189879061
HTG87        1144       189686641
HTG88        978        167870813
HTG89        1182       189961005
HTG9         1200       186951993
HTG90        1104       190233697
HTG91        1146       190217975
HTG92        1109       190471215
HTG93        961        159222190
HTG94        1056       190754252
HTG95        1160       191011164
HTG96        1031       189156227
HTG97        1071       189497493
HTG98        684        127508859
HTG99        1018       189641315
INV1         93717      48141883
INV10        57031      86473273
INV11        82669      65187399
INV12        60583      47682023
INV13        84605      65952024
INV14        80801      66808385
INV15        78783      66596571
INV16        47784      45625390
INV17        28346      113157120
INV18        8495       142340684
INV19        42234      112389064
INV2         28149      143964755
INV20        77367      56584700
INV21        73112      62453629
INV22        2973       1941579
INV23        21249      126088063
INV24        6          133712559
INV25        53768      98902097
INV26        78392      53888751
INV27        31620      23186152
INV28        79292      57250558
INV29        77128      59009531
INV3         1707       176149992
INV30        74525      57124752
INV31        74564      50273225
INV32        52336      88512070
INV33        79         1036276
INV4         3854       133939858
INV5         78653      73290083
INV6         55794      94947866
INV7         47535      92725482
INV8         13002      12571168
INV9         80296      71523615
MAM1         16561      160752238
MAM2         19032      158658630
MAM3         59766      81443232
MAM4         6886       185756498
MAM5         79395      74716859
MAM6         48824      125606524
MAM7         73885      63393224
MAM8         20925      19872355
PAT1         222551     70117059
PAT10        124441     102578063
PAT100       178185     3385515
PAT101       132610     2848492
PAT102       342935     8573375
PAT103       188806     88519660
PAT104       111348     132068608
PAT105       3850       194703659
PAT106       131292     110979300
PAT107       158599     54826034
PAT108       224730     34113420
PAT109       250080     15844360
PAT11        98661      64110448
PAT110       180676     63661713
PAT111       51652      26061632
PAT112       114181     110461986
PAT113       137698     83276559
PAT114       164170     99350467
PAT115       158877     103325984
PAT116       137417     114988187
PAT117       42311      27994848
PAT118       193712     81686401
PAT119       150217     108404022
PAT12        142059     62828666
PAT120       356051     11379688
PAT121       257211     57607099
PAT122       138161     48226925
PAT123       322021     22795469
PAT124       155639     102753887
PAT125       132727     110696284
PAT126       128341     121313309
PAT127       21664      184390005
PAT128       144888     112900567
PAT129       171997     96403773
PAT13        105889     59875047
PAT130       44618      171217879
PAT131       9167       47581637
PAT132       33645      178334734
PAT133       153558     109675196
PAT134       178705     90913377
PAT135       136049     115324159
PAT136       120392     123342367
PAT137       8527       8992390
PAT138       155429     101473147
PAT139       184764     88815933
PAT14        103637     50157591
PAT140       182409     85292093
PAT141       174403     93928365
PAT142       125174     122942590
PAT143       140680     35530029
PAT144       203662     47737230
PAT145       277828     9627968
PAT146       220409     46465135
PAT147       106719     2881142
PAT148       270386     21672571
PAT149       186749     61237793
PAT15        121135     53308801
PAT150       109797     106057638
PAT151       47522      9551625
PAT152       87296      88239857
PAT153       78458      95572890
PAT154       145142     77718129
PAT155       167508     71368818
PAT156       121467     92946689
PAT157       103008     85350819
PAT158       165593     46060796
PAT159       270022     5130418
PAT16        113128     61270845
PAT160       269978     5129582
PAT161       269978     5129582
PAT162       237888     4519872
PAT163       269396     5118524
PAT164       235480     25575098
PAT165       203727     47154186
PAT166       12040      422808
PAT167       165317     74871979
PAT168       91686      126656173
PAT169       172584     71662747
PAT17        39191      16250237
PAT170       137842     72230817
PAT171       9556       14012460
PAT172       93111      87244841
PAT173       91680      79829497
PAT174       83213      91466816
PAT175       109148     53718640
PAT176       119767     63745357
PAT177       156331     19195880
PAT178       108126     30306626
PAT179       86862      129980830
PAT18        146771     52594264
PAT180       159196     78756411
PAT181       211906     48209823
PAT182       93359      41229190
PAT19        153705     78039102
PAT2         194513     84656825
PAT20        104751     118096823
PAT21        133743     95365390
PAT22        84649      79535519
PAT23        123506     103386772
PAT24        119472     105675014
PAT25        145423     86657448
PAT26        175150     64309743
PAT27        71449      1786225
PAT28        102171     77387698
PAT29        93951      87640330
PAT3         171983     95896583
PAT30        119941     61674794
PAT31        96634      78969836
PAT32        128390     55023697
PAT33        92223      51126479
PAT34        111296     78150585
PAT35        138098     29120154
PAT36        158504     24081221
PAT37        114675     49019980
PAT38        44875      54580173
PAT39        95732      83191686
PAT4         153749     106054879
PAT40        100232     70984798
PAT41        136205     39303239
PAT42        143773     35446818
PAT43        123732     64730827
PAT44        104362     81213845
PAT45        93445      74211542
PAT46        113254     66591441
PAT47        65219      54831918
PAT48        135192     108000182
PAT49        167081     97031566
PAT5         57141      23924741
PAT50        116396     127556602
PAT51        196341     76723288
PAT52        80306      127991232
PAT53        27631      180872621
PAT54        185408     93066629
PAT55        274259     6856475
PAT56        129447     31627433
PAT57        161320     77719729
PAT58        92802      89391390
PAT59        106504     74790004
PAT6         170642     91909261
PAT60        122362     64031281
PAT61        67447      30302020
PAT62        70750      109767817
PAT63        87947      82758966
PAT64        92971      78937516
PAT65        93166      72441718
PAT66        93384      75085880
PAT67        115775     60531183
PAT68        102736     9941783
PAT69        175933     10547809
PAT7         154761     88225542
PAT70        171510     10872561
PAT71        171496     10866737
PAT72        99859      86225043
PAT73        99         196466297
PAT74        67         192869889
PAT75        103        195600591
PAT76        1137       196318757
PAT77        97599      5772236
PAT78        151009     9636510
PAT79        151022     9621259
PAT8         131223     96905365
PAT80        151024     9622125
PAT81        151021     9620837
PAT82        94632      88056898
PAT83        93686      93467861
PAT84        34076      33981506
PAT85        83459      93185861
PAT86        15570      180450165
PAT87        164895     19209843
PAT88        178944     3399936
PAT89        177434     3371246
PAT9         129357     101143197
PAT90        175305     3330795
PAT91        101394     1926486
PAT92        169171     12412246
PAT93        178699     3395281
PAT94        178691     3395129
PAT95        178677     3394863
PAT96        140780     2674820
PAT97        178683     3394977
PAT98        178342     3388498
PAT99        178198     3385762
PHG1         6800       88051367
PLN1         59892      93459938
PLN10        73051      75858823
PLN11        37378      49292346
PLN12        40286      65711024
PLN13        22491      123979778
PLN14        21103      99490647
PLN15        17566      144768265
PLN16        17622      146203357
PLN17        17550      146317118
PLN18        24673      128747914
PLN19        5999       149130224
PLN2         47988      105940773
PLN20        1268       170558125
PLN21        13938      156108362
PLN22        7326       8521642
PLN23        67245      69725654
PLN24        29383      31608736
PLN25        76929      76345439
PLN26        64743      80334247
PLN27        61757      100531789
PLN28        76         95744252
PLN29        3          61743175
PLN3         1370       174115808
PLN30        55         125319454
PLN31        13939      137855186
PLN32        15876      135265682
PLN33        76914      74968057
PLN34        82790      71605112
PLN35        62168      33035047
PLN36        80347      71630908
PLN37        77830      75855781
PLN38        80049      70442372
PLN39        82068      75439466
PLN4         1783       185053409
PLN40        58155      31974407
PLN41        98606      55074243
PLN42        82034      68836091
PLN43        45781      98633973
PLN44        19096      132048240
PLN45        31034      127255332
PLN46        62510      70172190
PLN47        81378      72267422
PLN48        63367      82047041
PLN49        28631      110321321
PLN5         1882       193563346
PLN50        82749      65441045
PLN51        95297      56954582
PLN52        10330      7723427
PLN53        76921      72400257
PLN54        70843      83894218
PLN55        76169      69230265
PLN56        71731      74932527
PLN57        76844      66483273
PLN58        74293      71964552
PLN59        25534      48286602
PLN6         1690       194505017
PLN7         1601       183601704
PLN8         67406      87527710
PLN9         30967      29230389
PRI1         23019      59656550
PRI10        1272       179228181
PRI11        784        95380628
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191720215
PRI17        1137       193666240
PRI18        1099       194310776
PRI19        1166       193657185
PRI2         18799      148619340
PRI20        1737       191818169
PRI21        2646       189795035
PRI22        9854       177039796
PRI23        11136      25136628
PRI24        31572      84615190
PRI25        61951      78207697
PRI26        31350      70628098
PRI27        8521       161801360
PRI28        2251       180645625
PRI29        1618       181509288
PRI3         1433       175175982
PRI30        2007       181705860
PRI31        1957       180746291
PRI32        13185      156514786
PRI33        1328       183749995
PRI34        41218      106774346
PRI35        23502      34414975
PRI36        32189      63608729
PRI37        20152      117784920
PRI38        18563      147331908
PRI39        66684      86887520
PRI4         1282       185562541
PRI40        49540      89482517
PRI41        40721      74985611
PRI42        45376      95601075
PRI43        17838      108091368
PRI44        70268      81069782
PRI45        12132      43769329
PRI5         1326       184326659
PRI6         1180       179899565
PRI7         1241       180866429
PRI8         1216       178447980
PRI9         1366       174657467
ROD1         33176      139427209
ROD10        989        181485158
ROD11        240        45576056
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190606461
ROD19        16786      156932257
ROD2         916        175542994
ROD20        20349      148361192
ROD21        1132       182075942
ROD22        1079       168189648
ROD23        12239      164894390
ROD24        39631      69428417
ROD25        22367      102345594
ROD26        1533       187671189
ROD27        131992     39944307
ROD28        85469      70135982
ROD29        63484      67317397
ROD3         905        173326813
ROD4         901        173780081
ROD5         920        174266650
ROD6         966        178082195
ROD7         970        179708672
ROD8         979        181294026
ROD9         993        181869376
STS1         85257      36750501
STS10        57907      44420267
STS11        48910      37503235
STS12        57924      43637361
STS13        64283      42850336
STS14        93614      34186498
STS15        104286     26517058
STS16        10109      2739230
STS17        103611     27476228
STS18        86926      34447437
STS19        99725      33367017
STS2         84327      49855709
STS20        55000      21032797
STS3         66836      26359108
STS4         77030      36944377
STS5         8484       4973721
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55716      37767321
SYN1         42701      77371229
SYN2         49461      67941274
SYN3         11382      159376687
SYN4         4599       176566897
SYN5         4596       176481368
SYN6         4600       176570409
SYN7         6279       94761394
TSA1         119977     38112352
TSA10        19782      21876029
TSA100       62796      68082050
TSA101       83597      81259826
TSA102       77368      53642425
TSA103       52890      45157231
TSA104       78372      34800123
TSA105       74786      67822110
TSA106       81274      78630897
TSA107       77057      65556747
TSA108       79784      74400901
TSA109       74319      61098092
TSA11        104981     27321556
TSA110       91897      74868705
TSA111       86386      74020888
TSA112       43900      36607150
TSA12        63093      36049176
TSA13        78048      76369363
TSA14        108605     44529741
TSA15        100309     35637870
TSA16        15339      6761707
TSA17        85951      70204975
TSA18        120164     38802704
TSA19        134981     34131922
TSA2         113082     41399259
TSA20        61572      79385070
TSA21        41183      55937127
TSA22        70040      97061853
TSA23        99922      57201815
TSA24        110032     52097937
TSA25        103116     51778350
TSA26        101845     53640384
TSA27        101699     46128965
TSA28        13624      8614501
TSA29        66220      59270523
TSA3         109975     40913799
TSA30        92600      67995596
TSA31        91392      64594868
TSA32        78714      86314225
TSA33        103047     46070815
TSA34        113079     34914472
TSA35        93836      70176444
TSA36        2112       1500534
TSA37        94687      35571775
TSA38        78620      36299174
TSA39        109341     44676061
TSA4         110065     45517449
TSA40        116437     47138299
TSA41        22643      16977488
TSA42        105982     50234310
TSA43        100439     54422418
TSA44        89580      68296946
TSA45        90589      73571296
TSA46        35138      10891113
TSA47        90399      71322568
TSA48        97571      54486833
TSA49        62913      108042465
TSA5         45423      11642796
TSA50        85439      75882018
TSA51        86233      63222818
TSA52        86360      67566262
TSA53        77742      78893627
TSA54        47671      69732863
TSA55        90605      66610069
TSA56        75924      84434075
TSA57        75363      75755380
TSA58        70635      62157721
TSA59        86644      78135154
TSA6         111608     58989548
TSA60        83656      81544536
TSA61        64829      90463011
TSA62        87304      70844407
TSA63        85576      52138686
TSA64        99116      67787357
TSA65        99642      53410162
TSA66        75547      66538074
TSA67        44523      23875700
TSA68        89929      79960169
TSA69        90764      69533926
TSA7         87587      57991023
TSA70        78679      53875805
TSA71        79619      56783359
TSA72        102372     58740394
TSA73        11697      6440378
TSA74        108728     48398903
TSA75        88607      73686611
TSA76        76866      86493420
TSA77        93182      49901432
TSA78        93430      44364550
TSA79        88575      73970519
TSA8         103411     71945868
TSA80        58475      74485382
TSA81        12365      12212328
TSA82        68511      112244496
TSA83        92752      71643895
TSA84        105411     57089509
TSA85        117326     53642858
TSA86        62444      120412832
TSA87        12933      6093884
TSA88        109175     49378845
TSA89        67049      70014304
TSA9         108865     60366586
TSA90        80457      88837063
TSA91        72654      76075978
TSA92        55504      121200688
TSA93        72298      66388986
TSA94        84628      73090568
TSA95        83568      67487308
TSA96        89927      48091175
TSA97        66473      60653547
TSA98        64087      65481741
TSA99        62776      67314514
UNA1         244        127803
VRL1         67289      69767191
VRL10        66775      68557099
VRL11        50876      67828724
VRL12        62897      71030516
VRL13        57325      72815886
VRL14        63393      64987711
VRL15        56576      73520618
VRL16        38778      46425267
VRL17        54784      72428389
VRL18        59012      71112175
VRL19        56513      73056047
VRL2         73234      64405149
VRL20        55192      74154058
VRL21        53957      79484205
VRL22        33681      31590999
VRL3         69958      60695478
VRL4         68785      69425931
VRL5         53005      55565304
VRL6         48159      77521072
VRL7         46988      72893597
VRL8         60802      69715533
VRL9         61191      73147540
VRT1         45539      117207363
VRT10        1256       189217442
VRT11        8274       177839690
VRT12        3993       136596069
VRT13        13101      170790688
VRT14        5342       182610424
VRT15        3935       185842273
VRT16        37528      134645100
VRT17        79785      68467943
VRT18        78197      66347379
VRT19        31154      25132902
VRT2         1157       194206412
VRT20        71392      77137953
VRT21        46473      121897819
VRT22        77598      62957978
VRT23        78499      62446115
VRT24        80526      57652426
VRT25        103679     65946589
VRT26        83350      54907487
VRT27        53725      40338379
VRT3         72602      78698133
VRT4         8183       173309062
VRT5         31678      33998960
VRT6         73012      66723579
VRT7         31769      63580804
VRT8         30616      112218539
VRT9         1201       189867913

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 192.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

20038080 16323766903   Homo sapiens
9698460   9975576594   Mus musculus
2188186   6521766255   Rattus norvegicus
2201180   5386471428   Bos taurus
3934468   5062779765   Zea mays
3286972   4888152421   Sus scrofa
1725384   3120424194   Danio rerio
257584    1435236537   Strongylocentrotus purpuratus
453184    1256236621   Macaca mulatta
1348576   1255716225   Oryza sativa Japonica Group
1588281   1249950189   Xenopus (Silurana) tropicalis
1774386   1197402826   Nicotiana tabacum
2331653   1144645070   Arabidopsis thaliana
1778663   1132439488   Triticum aestivum
1253886   1120678925   Drosophila melanogaster
457436    1089324157   Hordeum vulgare subsp. vulgare
216843    1008548378   Pan troglodytes
766866     999034823   Vitis vinifera
1455881    951282544   Canis lupus familiaris
1902893    906665374   Glycine max

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2012

                NCBI-GenBank Flat File Release 192.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         June 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       AAWZ01000001           40763 bp    DNA     linear   VRT 15-FEB-2007
DEFINITION  Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION   AAWZ01000001 AAWZ01000000
VERSION     AAWZ01000001.1  GI:125802685
DBLINK      Project:18787

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      Project:100,200,300

  DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=genomeprj

  At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/genomes/static/gprj_help.html#introduction

  As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/projects/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 192.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Brian Henson, Anjanette Johnston,
	Mark Landree, Jason Lowry, Suzanne Mate, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
	Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Ilya Dondoshansky, J. Bradley Holmes, WonHee Jang, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh, Jim Ostell,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center