Release Notes For GenBank Release 199

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2013

               NCBI-GenBank Flat File Release 199.0

                    Distribution Release Notes

 169331407 loci, 156230531562 bases, from 169331407 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 199.0
1.2 Cutoff Date
1.3 Important Changes in Release 199.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 199.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 199.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 199.0, incorporates data processed by the INSDC databases
as of Tuesday December 10, 2013 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 199.0

1.3.1 Organizational changes

The total number of sequence data files increased by 18 with this release:

  - the BCT division is now composed of 114 files (+2)
  - the CON division is now composed of 231 files (+5)
  - the ENV division is now composed of  67 files (+2)
  - the EST division is now composed of 475 files (+1)
  - the GSS division is now composed of 279 files (+1)
  - the PAT division is now composed of 199 files (+2)
  - the PLN division is now composed of  65 files (+1)
  - the TSA division is now composed of 147 files (+2)
  - the VRL division is now composed of  29 files (+2)

1.3.2 New accession format for CON-division WGS scaffold records

  WGS scaffolds that are constructed from WGS contigs have
traditionally made use of a '2+6' accession number format,
with two leading alphabetic characters followed by six digits.
Here is an example of a WGS-master record that references two
different ranges of scaffold accession numbers:

http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AABR00000000

LOCUS       AABR06000000          112651 rc    DNA     linear   ROD 16-MAR-2012
DEFINITION  Rattus norvegicus strain BN/SsNHsdMCW, whole genome shotgun
            sequencing project.
ACCESSION   AABR00000000
VERSION     AABR00000000.6  GI:380236478
DBLINK      BioProject: PRJNA10629
KEYWORDS    WGS.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
....
....
WGS         AABR06000001-AABR06112651
WGS_SCAFLD  CM000072-CM000092
WGS_SCAFLD  JH612139-JH620698
//

  Many WGS projects have a large number of chromosome-specific scaffolds
(such as the JH accession range for AABR), and a much smaller number of
scaffolds that represent the entirety of the chromosomes (such as the the CM
accession range for AABR). Because of the former, we are consuming '2+6'
prefixes, like JH, at an unsustainable rate.

  So as of the December 2013 GenBank release, a new accession format for
WGS scaffolds which mirrors the format of the underlying WGS contigs will
begin to appear for newly-processed WGS projects:

  4 letter WGS project code
  2 digit assembly-version number
  "S" (for 'scaffold')
  Six or seven digits

  In the above example, the set of 'JH' scaffolds could make use of
accession numbers such as AABR06S000001 and AABR06S112651 :

WGS         AABR06000001-AABR06112651
WGS_SCAFLD  CM000072-CM000092
WGS_SCAFLD  AABR06S000001-AABR06S112651

  We do not currently plan to replace existing '2+6' accessions with the new
'4+2+S+6/7' accessions.

This new accession format will initially be used for WGS projects that :

a) Have a very large number of contigs (typically, greater than 1 million)
b) Have a correspondingly large number of scaffolds
c) Are completely unannotated, at both the contig and scaffold level.

  The first WGS project which has these properties is ALWZ02. Here's an
excerpt of the flatfile for the first ALWZ scaffold, which illustrates
the new accession number format:

LOCUS       ALWZ02S0000001           701 bp    DNA     linear   CON 14-JUN-2013
DEFINITION  Picea glauca scaffold316, whole genome shotgun sequence.
ACCESSION   ALWZ02S0000001 ALWZ000000000
VERSION     ALWZ02S0000001.1
DBLINK      BioProject: PRJNA83435
KEYWORDS    WGS.
SOURCE      Picea glauca (white spruce)

URLs at which these scaffolds can be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#scaffolds
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02S.gbff.1.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.1.gbff.gz

1.3.3 Support for higher-precision /collection_date values

  At the May 2013 meeting of the International Nucleotide Sequence Database 
Collaboration, it was agreed to provide support for collection dates that
include the time, and for collection date ranges.

  The new format for /collection_date is theoretically legal as of this
GenBank Release 199.0, of December 2013. However, given that a large 
number of submission tools and systems will have to be updated, it's 
possible that the new date/time format will not actually be encountered
by users until 2014.

  Here is the working draft of the new /collection_date definition:

Qualifier       /collection_date= 

Definition      The date on which the specimen was collected.

                Date/time ranges are supported by providing two collection
                dates from among the supported value formats, delimited by a
                forward-slash character.

                Collection times are supported by adding "T", then the hour
                and minute, after the date. Collection times must be in
                Coordinated Universal Time (UTC), otherwise known as
                "Zulu Time" (Z).

Value format    "DD-Mmm-YYYY", "Mmm-YYYY", "YYYY"
                YYYY-MM-DDThh:mmZ, YYYY-MM-DDThhZ, YYYY-MM-DD, or YYYY-MM

Example         /collection_date="21-Oct-1952" 
                /collection_date="Oct-1952" 
                /collection_date="1952" 
                /collection_date="1952-10-21T11:43Z"
                /collection_date="1952-10-21T11Z"
                /collection_date="1952-10-21"
                /collection_date="1952-10"
                /collection_date="21-Oct-1952/15-Feb-1953"
                /collection_date="Oct-1952/Feb-1953"
                /collection_date="1952/1953"
                /collection_date="1952-10-21/1953-2-15"
                /collection_date="1952-10/1953-2"
                /collection_date="1952-10-21T11:43Z/1952-10-21T17:43Z"

Comment         'Mmm' represents a three-letter month abbreviation, and can
                be one of the following:
                Jan, Feb, Mar, Apr, May, Jun, Jul, Aug, Sep, Oct, Nov, Dec

                'YYYY' is a four-digit value representing the year. 'MM' is
                a two-digit value representing the month. 'DD' is a two-digit
                value representing the day of the month.

                'hh' is a two-digit value representing the hour of the day
                (00 to 23)

                'mm' is a two-digit value representing the minute of the hour
                (01 to 59)

                Within a date range, value formats that make use of 'Mmm'
                (month abbreviations) cannot be combined with value formats
                that make use of 'MM' (two-digit month number).

                Collection dates that are specified to at least the month,
                day, and year (DD-Mmm-YYYY or YYYY-MM-DD) are strongly
                encouraged. If the day and/or month of the collection date
                are not known, Mmm-YYYY or YYYY-MM or YYYY may be used.

                Within a collection date range, the first date (possibly
                including time) must be prior to the second date (possibly
                including time).

                Within a collection date range for which the day, month,
                and year are identical, the first time value must be prior
                to the second time value.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 118
of the GSS flatfiles in Release 199.0. Consider gbgss162.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        December 15 2013

                NCBI-GenBank Flat File Release 199.0

                           GSS Sequences (Part 1)

   87041 loci,    63875275 bases, from    87041 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "162" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be phased out (slowly!) at NCBI

  The numeric GI sequence identifier that NCBI assigns to all nucleotide
and protein sequences was first introduced for GenBank Release products
as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for nearly 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who utilize
GIs in their own information systems and analysis pipelines, so it will not be
introduced quickly. You can expect that a great deal of additional detail will
be made available via NCBI's various announcement mechanisms.

  *This* particular announcement is chiefly intended to provide some advance
warning to our users. There _will_ be classes of GenBank sequences that
are not assigned GIs in the not-too-distant future. If GIs are central to
your operations, then it might be appropriate to begin planning a switch to
the use of Accession.Version identifiers instead.

  And in fact, NCBI now has at least one WGS submission for which GIs have
not been assigned, for both the contigs and the scaffolds : ALWZ02.

Here are excerpts of the flatfile representation for the first ALWZ02 contig,
and the 'singleton' scaffold which is constructed from it:

LOCUS       ALWZ020000001            701 bp    DNA     linear   PLN 28-MAY-2013
DEFINITION  Picea glauca contig316_0, whole genome shotgun sequence.
ACCESSION   ALWZ020000001 ALWZ020000000
VERSION     ALWZ020000001.1
DBLINK      BioProject: PRJNA83435
....
ORIGIN      
        1 cgttgtgttg gggcacccaa ccttggtgag gccgtattaa aaagtctacc tccaagccaa
       61 aatttgttct tatccatcct ccaactcgtc tttttgccta gtgctcccct atgtggacgt
      121 tttcgttgtg gaggagtttt tcgtttgggc gcccatcttg cgaactcacc ttgcattgcg
      181 tttggtcgcc caacttgtga acgtgccttg gattgcgttg gggcgcccaa gttgcggacg
      241 tgcggacgtg cctttctttg ccgacatgcc ttgcgtttgc gttgcggacg tgcaatgggg
      301 cccccagctt gctgacgtgc cttgcgttgc gttggggtgc ccaacttgcc gacgtgcctt
      361 gcgttgcgtt ggggcaccca accttggtga ggccgtatta aaaagtctac ctccaagata
      421 aaatttgttc ttatccatcc tctagctctt cttttagcct agtgctccct tgtgtggaca
      481 ttttcgttgt ggatcatttt ttcgtttagg tgcccatctt gcagacaagc cttgcgttgc
      541 gtttgggcac ccatcttgcg gacgcgcctt tcattgcgtt ggggcgccca acgttggtga
      601 ggccgtatta aaaagtctac ctccaagaca aaatttgttc ttatccatcc tccatctcgt
      661 ctttttgcct agtgctccct tgtgtggacg ttttcgttgc g
//

LOCUS       ALWZ02S0000001           701 bp    DNA     linear   CON 14-JUN-2013
DEFINITION  Picea glauca scaffold316, whole genome shotgun sequence.
ACCESSION   ALWZ02S0000001 ALWZ000000000
VERSION     ALWZ02S0000001.1
DBLINK      BioProject: PRJNA83435
....
CONTIG      join(ALWZ020000001.1:1..701)
//


**Note the absence of a GI value on the VERSION line of these two records**

Sample URLs from which ALWZ02 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.1.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.1.gbff.gz

Unannotated WGS projects consisting of many millions of contigs and 
scaffolds represent the first class of records for which GIs are no
longer being assigned. ALWZ02 is the only such project at this time,
but more projects will follow, and the practice will ultimately expand
to include other classes of records.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 1948 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct12.seq - Bacterial sequence entries, part 12.
20. gbbct13.seq - Bacterial sequence entries, part 13.
21. gbbct14.seq - Bacterial sequence entries, part 14.
22. gbbct15.seq - Bacterial sequence entries, part 15.
23. gbbct16.seq - Bacterial sequence entries, part 16.
24. gbbct17.seq - Bacterial sequence entries, part 17.
25. gbbct18.seq - Bacterial sequence entries, part 18.
26. gbbct19.seq - Bacterial sequence entries, part 19.
27. gbbct2.seq - Bacterial sequence entries, part 2.
28. gbbct20.seq - Bacterial sequence entries, part 20.
29. gbbct21.seq - Bacterial sequence entries, part 21.
30. gbbct22.seq - Bacterial sequence entries, part 22.
31. gbbct23.seq - Bacterial sequence entries, part 23.
32. gbbct24.seq - Bacterial sequence entries, part 24.
33. gbbct25.seq - Bacterial sequence entries, part 25.
34. gbbct26.seq - Bacterial sequence entries, part 26.
35. gbbct27.seq - Bacterial sequence entries, part 27.
36. gbbct28.seq - Bacterial sequence entries, part 28.
37. gbbct29.seq - Bacterial sequence entries, part 29.
38. gbbct3.seq - Bacterial sequence entries, part 3.
39. gbbct30.seq - Bacterial sequence entries, part 30.
40. gbbct31.seq - Bacterial sequence entries, part 31.
41. gbbct32.seq - Bacterial sequence entries, part 32.
42. gbbct33.seq - Bacterial sequence entries, part 33.
43. gbbct34.seq - Bacterial sequence entries, part 34.
44. gbbct35.seq - Bacterial sequence entries, part 35.
45. gbbct36.seq - Bacterial sequence entries, part 36.
46. gbbct37.seq - Bacterial sequence entries, part 37.
47. gbbct38.seq - Bacterial sequence entries, part 38.
48. gbbct39.seq - Bacterial sequence entries, part 39.
49. gbbct4.seq - Bacterial sequence entries, part 4.
50. gbbct40.seq - Bacterial sequence entries, part 40.
51. gbbct41.seq - Bacterial sequence entries, part 41.
52. gbbct42.seq - Bacterial sequence entries, part 42.
53. gbbct43.seq - Bacterial sequence entries, part 43.
54. gbbct44.seq - Bacterial sequence entries, part 44.
55. gbbct45.seq - Bacterial sequence entries, part 45.
56. gbbct46.seq - Bacterial sequence entries, part 46.
57. gbbct47.seq - Bacterial sequence entries, part 47.
58. gbbct48.seq - Bacterial sequence entries, part 48.
59. gbbct49.seq - Bacterial sequence entries, part 49.
60. gbbct5.seq - Bacterial sequence entries, part 5.
61. gbbct50.seq - Bacterial sequence entries, part 50.
62. gbbct51.seq - Bacterial sequence entries, part 51.
63. gbbct52.seq - Bacterial sequence entries, part 52.
64. gbbct53.seq - Bacterial sequence entries, part 53.
65. gbbct54.seq - Bacterial sequence entries, part 54.
66. gbbct55.seq - Bacterial sequence entries, part 55.
67. gbbct56.seq - Bacterial sequence entries, part 56.
68. gbbct57.seq - Bacterial sequence entries, part 57.
69. gbbct58.seq - Bacterial sequence entries, part 58.
70. gbbct59.seq - Bacterial sequence entries, part 59.
71. gbbct6.seq - Bacterial sequence entries, part 6.
72. gbbct60.seq - Bacterial sequence entries, part 60.
73. gbbct61.seq - Bacterial sequence entries, part 61.
74. gbbct62.seq - Bacterial sequence entries, part 62.
75. gbbct63.seq - Bacterial sequence entries, part 63.
76. gbbct64.seq - Bacterial sequence entries, part 64.
77. gbbct65.seq - Bacterial sequence entries, part 65.
78. gbbct66.seq - Bacterial sequence entries, part 66.
79. gbbct67.seq - Bacterial sequence entries, part 67.
80. gbbct68.seq - Bacterial sequence entries, part 68.
81. gbbct69.seq - Bacterial sequence entries, part 69.
82. gbbct7.seq - Bacterial sequence entries, part 7.
83. gbbct70.seq - Bacterial sequence entries, part 70.
84. gbbct71.seq - Bacterial sequence entries, part 71.
85. gbbct72.seq - Bacterial sequence entries, part 72.
86. gbbct73.seq - Bacterial sequence entries, part 73.
87. gbbct74.seq - Bacterial sequence entries, part 74.
88. gbbct75.seq - Bacterial sequence entries, part 75.
89. gbbct76.seq - Bacterial sequence entries, part 76.
90. gbbct77.seq - Bacterial sequence entries, part 77.
91. gbbct78.seq - Bacterial sequence entries, part 78.
92. gbbct79.seq - Bacterial sequence entries, part 79.
93. gbbct8.seq - Bacterial sequence entries, part 8.
94. gbbct80.seq - Bacterial sequence entries, part 80.
95. gbbct81.seq - Bacterial sequence entries, part 81.
96. gbbct82.seq - Bacterial sequence entries, part 82.
97. gbbct83.seq - Bacterial sequence entries, part 83.
98. gbbct84.seq - Bacterial sequence entries, part 84.
99. gbbct85.seq - Bacterial sequence entries, part 85.
100. gbbct86.seq - Bacterial sequence entries, part 86.
101. gbbct87.seq - Bacterial sequence entries, part 87.
102. gbbct88.seq - Bacterial sequence entries, part 88.
103. gbbct89.seq - Bacterial sequence entries, part 89.
104. gbbct9.seq - Bacterial sequence entries, part 9.
105. gbbct90.seq - Bacterial sequence entries, part 90.
106. gbbct91.seq - Bacterial sequence entries, part 91.
107. gbbct92.seq - Bacterial sequence entries, part 92.
108. gbbct93.seq - Bacterial sequence entries, part 93.
109. gbbct94.seq - Bacterial sequence entries, part 94.
110. gbbct95.seq - Bacterial sequence entries, part 95.
111. gbbct96.seq - Bacterial sequence entries, part 96.
112. gbbct97.seq - Bacterial sequence entries, part 97.
113. gbbct98.seq - Bacterial sequence entries, part 98.
114. gbbct99.seq - Bacterial sequence entries, part 99.
115. gbchg.txt - Accession numbers of entries updated since the previous release.
116. gbcon1.seq - Constructed sequence entries, part 1.
117. gbcon10.seq - Constructed sequence entries, part 10.
118. gbcon100.seq - Constructed sequence entries, part 100.
119. gbcon101.seq - Constructed sequence entries, part 101.
120. gbcon102.seq - Constructed sequence entries, part 102.
121. gbcon103.seq - Constructed sequence entries, part 103.
122. gbcon104.seq - Constructed sequence entries, part 104.
123. gbcon105.seq - Constructed sequence entries, part 105.
124. gbcon106.seq - Constructed sequence entries, part 106.
125. gbcon107.seq - Constructed sequence entries, part 107.
126. gbcon108.seq - Constructed sequence entries, part 108.
127. gbcon109.seq - Constructed sequence entries, part 109.
128. gbcon11.seq - Constructed sequence entries, part 11.
129. gbcon110.seq - Constructed sequence entries, part 110.
130. gbcon111.seq - Constructed sequence entries, part 111.
131. gbcon112.seq - Constructed sequence entries, part 112.
132. gbcon113.seq - Constructed sequence entries, part 113.
133. gbcon114.seq - Constructed sequence entries, part 114.
134. gbcon115.seq - Constructed sequence entries, part 115.
135. gbcon116.seq - Constructed sequence entries, part 116.
136. gbcon117.seq - Constructed sequence entries, part 117.
137. gbcon118.seq - Constructed sequence entries, part 118.
138. gbcon119.seq - Constructed sequence entries, part 119.
139. gbcon12.seq - Constructed sequence entries, part 12.
140. gbcon120.seq - Constructed sequence entries, part 120.
141. gbcon121.seq - Constructed sequence entries, part 121.
142. gbcon122.seq - Constructed sequence entries, part 122.
143. gbcon123.seq - Constructed sequence entries, part 123.
144. gbcon124.seq - Constructed sequence entries, part 124.
145. gbcon125.seq - Constructed sequence entries, part 125.
146. gbcon126.seq - Constructed sequence entries, part 126.
147. gbcon127.seq - Constructed sequence entries, part 127.
148. gbcon128.seq - Constructed sequence entries, part 128.
149. gbcon129.seq - Constructed sequence entries, part 129.
150. gbcon13.seq - Constructed sequence entries, part 13.
151. gbcon130.seq - Constructed sequence entries, part 130.
152. gbcon131.seq - Constructed sequence entries, part 131.
153. gbcon132.seq - Constructed sequence entries, part 132.
154. gbcon133.seq - Constructed sequence entries, part 133.
155. gbcon134.seq - Constructed sequence entries, part 134.
156. gbcon135.seq - Constructed sequence entries, part 135.
157. gbcon136.seq - Constructed sequence entries, part 136.
158. gbcon137.seq - Constructed sequence entries, part 137.
159. gbcon138.seq - Constructed sequence entries, part 138.
160. gbcon139.seq - Constructed sequence entries, part 139.
161. gbcon14.seq - Constructed sequence entries, part 14.
162. gbcon140.seq - Constructed sequence entries, part 140.
163. gbcon141.seq - Constructed sequence entries, part 141.
164. gbcon142.seq - Constructed sequence entries, part 142.
165. gbcon143.seq - Constructed sequence entries, part 143.
166. gbcon144.seq - Constructed sequence entries, part 144.
167. gbcon145.seq - Constructed sequence entries, part 145.
168. gbcon146.seq - Constructed sequence entries, part 146.
169. gbcon147.seq - Constructed sequence entries, part 147.
170. gbcon148.seq - Constructed sequence entries, part 148.
171. gbcon149.seq - Constructed sequence entries, part 149.
172. gbcon15.seq - Constructed sequence entries, part 15.
173. gbcon150.seq - Constructed sequence entries, part 150.
174. gbcon151.seq - Constructed sequence entries, part 151.
175. gbcon152.seq - Constructed sequence entries, part 152.
176. gbcon153.seq - Constructed sequence entries, part 153.
177. gbcon154.seq - Constructed sequence entries, part 154.
178. gbcon155.seq - Constructed sequence entries, part 155.
179. gbcon156.seq - Constructed sequence entries, part 156.
180. gbcon157.seq - Constructed sequence entries, part 157.
181. gbcon158.seq - Constructed sequence entries, part 158.
182. gbcon159.seq - Constructed sequence entries, part 159.
183. gbcon16.seq - Constructed sequence entries, part 16.
184. gbcon160.seq - Constructed sequence entries, part 160.
185. gbcon161.seq - Constructed sequence entries, part 161.
186. gbcon162.seq - Constructed sequence entries, part 162.
187. gbcon163.seq - Constructed sequence entries, part 163.
188. gbcon164.seq - Constructed sequence entries, part 164.
189. gbcon165.seq - Constructed sequence entries, part 165.
190. gbcon166.seq - Constructed sequence entries, part 166.
191. gbcon167.seq - Constructed sequence entries, part 167.
192. gbcon168.seq - Constructed sequence entries, part 168.
193. gbcon169.seq - Constructed sequence entries, part 169.
194. gbcon17.seq - Constructed sequence entries, part 17.
195. gbcon170.seq - Constructed sequence entries, part 170.
196. gbcon171.seq - Constructed sequence entries, part 171.
197. gbcon172.seq - Constructed sequence entries, part 172.
198. gbcon173.seq - Constructed sequence entries, part 173.
199. gbcon174.seq - Constructed sequence entries, part 174.
200. gbcon175.seq - Constructed sequence entries, part 175.
201. gbcon176.seq - Constructed sequence entries, part 176.
202. gbcon177.seq - Constructed sequence entries, part 177.
203. gbcon178.seq - Constructed sequence entries, part 178.
204. gbcon179.seq - Constructed sequence entries, part 179.
205. gbcon18.seq - Constructed sequence entries, part 18.
206. gbcon180.seq - Constructed sequence entries, part 180.
207. gbcon181.seq - Constructed sequence entries, part 181.
208. gbcon182.seq - Constructed sequence entries, part 182.
209. gbcon183.seq - Constructed sequence entries, part 183.
210. gbcon184.seq - Constructed sequence entries, part 184.
211. gbcon185.seq - Constructed sequence entries, part 185.
212. gbcon186.seq - Constructed sequence entries, part 186.
213. gbcon187.seq - Constructed sequence entries, part 187.
214. gbcon188.seq - Constructed sequence entries, part 188.
215. gbcon189.seq - Constructed sequence entries, part 189.
216. gbcon19.seq - Constructed sequence entries, part 19.
217. gbcon190.seq - Constructed sequence entries, part 190.
218. gbcon191.seq - Constructed sequence entries, part 191.
219. gbcon192.seq - Constructed sequence entries, part 192.
220. gbcon193.seq - Constructed sequence entries, part 193.
221. gbcon194.seq - Constructed sequence entries, part 194.
222. gbcon195.seq - Constructed sequence entries, part 195.
223. gbcon196.seq - Constructed sequence entries, part 196.
224. gbcon197.seq - Constructed sequence entries, part 197.
225. gbcon198.seq - Constructed sequence entries, part 198.
226. gbcon199.seq - Constructed sequence entries, part 199.
227. gbcon2.seq - Constructed sequence entries, part 2.
228. gbcon20.seq - Constructed sequence entries, part 20.
229. gbcon200.seq - Constructed sequence entries, part 200.
230. gbcon201.seq - Constructed sequence entries, part 201.
231. gbcon202.seq - Constructed sequence entries, part 202.
232. gbcon203.seq - Constructed sequence entries, part 203.
233. gbcon204.seq - Constructed sequence entries, part 204.
234. gbcon205.seq - Constructed sequence entries, part 205.
235. gbcon206.seq - Constructed sequence entries, part 206.
236. gbcon207.seq - Constructed sequence entries, part 207.
237. gbcon208.seq - Constructed sequence entries, part 208.
238. gbcon209.seq - Constructed sequence entries, part 209.
239. gbcon21.seq - Constructed sequence entries, part 21.
240. gbcon210.seq - Constructed sequence entries, part 210.
241. gbcon211.seq - Constructed sequence entries, part 211.
242. gbcon212.seq - Constructed sequence entries, part 212.
243. gbcon213.seq - Constructed sequence entries, part 213.
244. gbcon214.seq - Constructed sequence entries, part 214.
245. gbcon215.seq - Constructed sequence entries, part 215.
246. gbcon216.seq - Constructed sequence entries, part 216.
247. gbcon217.seq - Constructed sequence entries, part 217.
248. gbcon218.seq - Constructed sequence entries, part 218.
249. gbcon219.seq - Constructed sequence entries, part 219.
250. gbcon22.seq - Constructed sequence entries, part 22.
251. gbcon220.seq - Constructed sequence entries, part 220.
252. gbcon221.seq - Constructed sequence entries, part 221.
253. gbcon222.seq - Constructed sequence entries, part 222.
254. gbcon223.seq - Constructed sequence entries, part 223.
255. gbcon224.seq - Constructed sequence entries, part 224.
256. gbcon225.seq - Constructed sequence entries, part 225.
257. gbcon226.seq - Constructed sequence entries, part 226.
258. gbcon227.seq - Constructed sequence entries, part 227.
259. gbcon228.seq - Constructed sequence entries, part 228.
260. gbcon229.seq - Constructed sequence entries, part 229.
261. gbcon23.seq - Constructed sequence entries, part 23.
262. gbcon230.seq - Constructed sequence entries, part 230.
263. gbcon231.seq - Constructed sequence entries, part 231.
264. gbcon24.seq - Constructed sequence entries, part 24.
265. gbcon25.seq - Constructed sequence entries, part 25.
266. gbcon26.seq - Constructed sequence entries, part 26.
267. gbcon27.seq - Constructed sequence entries, part 27.
268. gbcon28.seq - Constructed sequence entries, part 28.
269. gbcon29.seq - Constructed sequence entries, part 29.
270. gbcon3.seq - Constructed sequence entries, part 3.
271. gbcon30.seq - Constructed sequence entries, part 30.
272. gbcon31.seq - Constructed sequence entries, part 31.
273. gbcon32.seq - Constructed sequence entries, part 32.
274. gbcon33.seq - Constructed sequence entries, part 33.
275. gbcon34.seq - Constructed sequence entries, part 34.
276. gbcon35.seq - Constructed sequence entries, part 35.
277. gbcon36.seq - Constructed sequence entries, part 36.
278. gbcon37.seq - Constructed sequence entries, part 37.
279. gbcon38.seq - Constructed sequence entries, part 38.
280. gbcon39.seq - Constructed sequence entries, part 39.
281. gbcon4.seq - Constructed sequence entries, part 4.
282. gbcon40.seq - Constructed sequence entries, part 40.
283. gbcon41.seq - Constructed sequence entries, part 41.
284. gbcon42.seq - Constructed sequence entries, part 42.
285. gbcon43.seq - Constructed sequence entries, part 43.
286. gbcon44.seq - Constructed sequence entries, part 44.
287. gbcon45.seq - Constructed sequence entries, part 45.
288. gbcon46.seq - Constructed sequence entries, part 46.
289. gbcon47.seq - Constructed sequence entries, part 47.
290. gbcon48.seq - Constructed sequence entries, part 48.
291. gbcon49.seq - Constructed sequence entries, part 49.
292. gbcon5.seq - Constructed sequence entries, part 5.
293. gbcon50.seq - Constructed sequence entries, part 50.
294. gbcon51.seq - Constructed sequence entries, part 51.
295. gbcon52.seq - Constructed sequence entries, part 52.
296. gbcon53.seq - Constructed sequence entries, part 53.
297. gbcon54.seq - Constructed sequence entries, part 54.
298. gbcon55.seq - Constructed sequence entries, part 55.
299. gbcon56.seq - Constructed sequence entries, part 56.
300. gbcon57.seq - Constructed sequence entries, part 57.
301. gbcon58.seq - Constructed sequence entries, part 58.
302. gbcon59.seq - Constructed sequence entries, part 59.
303. gbcon6.seq - Constructed sequence entries, part 6.
304. gbcon60.seq - Constructed sequence entries, part 60.
305. gbcon61.seq - Constructed sequence entries, part 61.
306. gbcon62.seq - Constructed sequence entries, part 62.
307. gbcon63.seq - Constructed sequence entries, part 63.
308. gbcon64.seq - Constructed sequence entries, part 64.
309. gbcon65.seq - Constructed sequence entries, part 65.
310. gbcon66.seq - Constructed sequence entries, part 66.
311. gbcon67.seq - Constructed sequence entries, part 67.
312. gbcon68.seq - Constructed sequence entries, part 68.
313. gbcon69.seq - Constructed sequence entries, part 69.
314. gbcon7.seq - Constructed sequence entries, part 7.
315. gbcon70.seq - Constructed sequence entries, part 70.
316. gbcon71.seq - Constructed sequence entries, part 71.
317. gbcon72.seq - Constructed sequence entries, part 72.
318. gbcon73.seq - Constructed sequence entries, part 73.
319. gbcon74.seq - Constructed sequence entries, part 74.
320. gbcon75.seq - Constructed sequence entries, part 75.
321. gbcon76.seq - Constructed sequence entries, part 76.
322. gbcon77.seq - Constructed sequence entries, part 77.
323. gbcon78.seq - Constructed sequence entries, part 78.
324. gbcon79.seq - Constructed sequence entries, part 79.
325. gbcon8.seq - Constructed sequence entries, part 8.
326. gbcon80.seq - Constructed sequence entries, part 80.
327. gbcon81.seq - Constructed sequence entries, part 81.
328. gbcon82.seq - Constructed sequence entries, part 82.
329. gbcon83.seq - Constructed sequence entries, part 83.
330. gbcon84.seq - Constructed sequence entries, part 84.
331. gbcon85.seq - Constructed sequence entries, part 85.
332. gbcon86.seq - Constructed sequence entries, part 86.
333. gbcon87.seq - Constructed sequence entries, part 87.
334. gbcon88.seq - Constructed sequence entries, part 88.
335. gbcon89.seq - Constructed sequence entries, part 89.
336. gbcon9.seq - Constructed sequence entries, part 9.
337. gbcon90.seq - Constructed sequence entries, part 90.
338. gbcon91.seq - Constructed sequence entries, part 91.
339. gbcon92.seq - Constructed sequence entries, part 92.
340. gbcon93.seq - Constructed sequence entries, part 93.
341. gbcon94.seq - Constructed sequence entries, part 94.
342. gbcon95.seq - Constructed sequence entries, part 95.
343. gbcon96.seq - Constructed sequence entries, part 96.
344. gbcon97.seq - Constructed sequence entries, part 97.
345. gbcon98.seq - Constructed sequence entries, part 98.
346. gbcon99.seq - Constructed sequence entries, part 99.
347. gbdel.txt - Accession numbers of entries deleted since the previous release.
348. gbenv1.seq - Environmental sampling sequence entries, part 1.
349. gbenv10.seq - Environmental sampling sequence entries, part 10.
350. gbenv11.seq - Environmental sampling sequence entries, part 11.
351. gbenv12.seq - Environmental sampling sequence entries, part 12.
352. gbenv13.seq - Environmental sampling sequence entries, part 13.
353. gbenv14.seq - Environmental sampling sequence entries, part 14.
354. gbenv15.seq - Environmental sampling sequence entries, part 15.
355. gbenv16.seq - Environmental sampling sequence entries, part 16.
356. gbenv17.seq - Environmental sampling sequence entries, part 17.
357. gbenv18.seq - Environmental sampling sequence entries, part 18.
358. gbenv19.seq - Environmental sampling sequence entries, part 19.
359. gbenv2.seq - Environmental sampling sequence entries, part 2.
360. gbenv20.seq - Environmental sampling sequence entries, part 20.
361. gbenv21.seq - Environmental sampling sequence entries, part 21.
362. gbenv22.seq - Environmental sampling sequence entries, part 22.
363. gbenv23.seq - Environmental sampling sequence entries, part 23.
364. gbenv24.seq - Environmental sampling sequence entries, part 24.
365. gbenv25.seq - Environmental sampling sequence entries, part 25.
366. gbenv26.seq - Environmental sampling sequence entries, part 26.
367. gbenv27.seq - Environmental sampling sequence entries, part 27.
368. gbenv28.seq - Environmental sampling sequence entries, part 28.
369. gbenv29.seq - Environmental sampling sequence entries, part 29.
370. gbenv3.seq - Environmental sampling sequence entries, part 3.
371. gbenv30.seq - Environmental sampling sequence entries, part 30.
372. gbenv31.seq - Environmental sampling sequence entries, part 31.
373. gbenv32.seq - Environmental sampling sequence entries, part 32.
374. gbenv33.seq - Environmental sampling sequence entries, part 33.
375. gbenv34.seq - Environmental sampling sequence entries, part 34.
376. gbenv35.seq - Environmental sampling sequence entries, part 35.
377. gbenv36.seq - Environmental sampling sequence entries, part 36.
378. gbenv37.seq - Environmental sampling sequence entries, part 37.
379. gbenv38.seq - Environmental sampling sequence entries, part 38.
380. gbenv39.seq - Environmental sampling sequence entries, part 39.
381. gbenv4.seq - Environmental sampling sequence entries, part 4.
382. gbenv40.seq - Environmental sampling sequence entries, part 40.
383. gbenv41.seq - Environmental sampling sequence entries, part 41.
384. gbenv42.seq - Environmental sampling sequence entries, part 42.
385. gbenv43.seq - Environmental sampling sequence entries, part 43.
386. gbenv44.seq - Environmental sampling sequence entries, part 44.
387. gbenv45.seq - Environmental sampling sequence entries, part 45.
388. gbenv46.seq - Environmental sampling sequence entries, part 46.
389. gbenv47.seq - Environmental sampling sequence entries, part 47.
390. gbenv48.seq - Environmental sampling sequence entries, part 48.
391. gbenv49.seq - Environmental sampling sequence entries, part 49.
392. gbenv5.seq - Environmental sampling sequence entries, part 5.
393. gbenv50.seq - Environmental sampling sequence entries, part 50.
394. gbenv51.seq - Environmental sampling sequence entries, part 51.
395. gbenv52.seq - Environmental sampling sequence entries, part 52.
396. gbenv53.seq - Environmental sampling sequence entries, part 53.
397. gbenv54.seq - Environmental sampling sequence entries, part 54.
398. gbenv55.seq - Environmental sampling sequence entries, part 55.
399. gbenv56.seq - Environmental sampling sequence entries, part 56.
400. gbenv57.seq - Environmental sampling sequence entries, part 57.
401. gbenv58.seq - Environmental sampling sequence entries, part 58.
402. gbenv59.seq - Environmental sampling sequence entries, part 59.
403. gbenv6.seq - Environmental sampling sequence entries, part 6.
404. gbenv60.seq - Environmental sampling sequence entries, part 60.
405. gbenv61.seq - Environmental sampling sequence entries, part 61.
406. gbenv62.seq - Environmental sampling sequence entries, part 62.
407. gbenv63.seq - Environmental sampling sequence entries, part 63.
408. gbenv64.seq - Environmental sampling sequence entries, part 64.
409. gbenv65.seq - Environmental sampling sequence entries, part 65.
410. gbenv66.seq - Environmental sampling sequence entries, part 66.
411. gbenv67.seq - Environmental sampling sequence entries, part 67.
412. gbenv7.seq - Environmental sampling sequence entries, part 7.
413. gbenv8.seq - Environmental sampling sequence entries, part 8.
414. gbenv9.seq - Environmental sampling sequence entries, part 9.
415. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
416. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
417. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
418. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
419. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
420. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
421. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
422. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
423. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
424. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
425. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
426. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
427. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
428. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
429. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
430. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
431. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
432. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
433. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
434. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
435. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
436. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
437. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
438. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
439. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
440. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
441. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
442. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
443. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
444. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
445. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
446. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
447. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
448. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
449. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
450. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
451. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
452. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
453. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
454. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
455. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
456. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
457. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
458. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
459. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
460. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
461. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
462. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
463. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
464. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
465. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
466. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
467. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
468. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
469. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
470. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
471. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
472. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
473. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
474. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
475. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
476. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
477. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
478. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
479. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
480. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
481. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
482. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
483. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
484. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
485. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
486. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
487. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
488. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
489. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
490. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
491. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
492. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
493. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
494. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
495. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
496. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
497. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
498. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
499. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
500. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
501. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
502. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
503. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
504. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
505. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
506. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
507. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
508. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
509. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
510. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
511. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
512. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
513. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
514. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
515. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
516. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
517. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
518. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
519. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
520. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
521. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
522. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
523. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
524. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
525. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
526. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
527. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
528. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
529. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
530. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
531. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
532. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
533. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
534. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
535. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
536. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
537. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
538. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
539. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
540. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
541. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
542. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
543. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
544. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
545. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
546. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
547. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
548. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
549. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
550. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
551. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
552. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
553. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
554. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
555. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
556. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
557. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
558. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
559. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
560. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
561. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
562. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
563. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
564. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
565. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
566. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
567. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
568. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
569. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
570. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
571. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
572. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
573. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
574. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
575. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
576. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
577. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
578. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
579. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
580. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
581. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
582. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
583. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
584. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
585. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
586. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
587. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
588. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
589. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
590. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
591. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
592. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
593. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
594. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
595. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
596. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
597. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
598. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
599. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
600. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
601. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
602. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
603. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
604. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
605. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
606. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
607. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
608. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
609. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
610. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
611. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
612. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
613. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
614. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
615. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
616. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
617. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
618. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
619. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
620. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
621. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
622. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
623. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
624. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
625. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
626. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
627. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
628. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
629. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
630. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
631. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
632. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
633. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
634. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
635. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
636. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
637. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
638. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
639. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
640. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
641. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
642. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
643. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
644. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
645. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
646. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
647. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
648. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
649. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
650. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
651. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
652. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
653. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
654. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
655. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
656. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
657. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
658. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
659. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
660. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
661. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
662. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
663. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
664. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
665. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
666. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
667. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
668. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
669. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
670. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
671. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
672. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
673. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
674. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
675. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
676. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
677. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
678. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
679. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
680. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
681. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
682. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
683. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
684. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
685. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
686. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
687. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
688. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
689. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
690. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
691. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
692. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
693. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
694. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
695. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
696. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
697. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
698. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
699. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
700. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
701. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
702. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
703. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
704. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
705. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
706. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
707. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
708. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
709. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
710. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
711. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
712. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
713. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
714. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
715. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
716. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
717. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
718. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
719. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
720. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
721. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
722. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
723. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
724. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
725. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
726. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
727. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
728. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
729. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
730. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
731. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
732. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
733. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
734. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
735. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
736. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
737. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
738. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
739. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
740. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
741. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
742. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
743. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
744. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
745. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
746. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
747. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
748. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
749. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
750. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
751. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
752. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
753. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
754. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
755. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
756. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
757. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
758. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
759. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
760. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
761. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
762. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
763. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
764. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
765. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
766. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
767. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
768. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
769. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
770. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
771. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
772. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
773. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
774. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
775. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
776. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
777. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
778. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
779. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
780. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
781. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
782. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
783. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
784. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
785. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
786. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
787. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
788. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
789. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
790. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
791. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
792. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
793. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
794. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
795. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
796. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
797. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
798. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
799. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
800. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
801. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
802. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
803. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
804. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
805. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
806. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
807. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
808. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
809. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
810. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
811. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
812. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
813. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
814. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
815. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
816. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
817. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
818. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
819. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
820. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
821. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
822. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
823. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
824. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
825. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
826. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
827. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
828. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
829. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
830. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
831. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
832. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
833. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
834. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
835. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
836. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
837. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
838. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
839. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
840. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
841. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
842. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
843. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
844. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
845. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
846. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
847. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
848. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
849. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
850. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
851. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
852. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
853. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
854. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
855. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
856. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
857. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
858. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
859. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
860. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
861. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
862. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
863. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
864. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
865. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
866. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
867. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
868. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
869. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
870. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
871. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
872. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
873. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
874. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
875. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
876. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
877. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
878. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
879. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
880. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
881. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
882. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
883. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
884. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
885. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
886. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
887. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
888. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
889. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
890. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
891. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
892. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
893. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
894. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
895. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
896. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
897. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
898. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
899. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
900. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
901. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
902. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
903. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
904. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
905. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
906. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
907. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
908. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
909. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
910. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
911. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
912. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
913. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
914. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
915. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
916. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
917. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
918. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
919. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
920. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
921. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
922. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
923. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
924. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
925. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
926. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
927. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
928. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
929. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
930. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
931. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
932. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
933. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
934. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
935. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
936. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
937. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
938. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
939. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
940. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
941. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
942. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
943. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
944. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
945. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
946. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
947. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
948. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
949. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
950. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
951. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
952. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
953. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
954. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
955. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
956. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
957. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
958. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
959. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
960. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
961. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
962. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
963. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
964. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
965. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
966. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
967. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
968. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
969. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
970. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
971. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
972. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
973. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
974. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
975. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
976. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
977. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
978. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
979. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
980. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
981. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
982. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
983. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
984. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
985. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
986. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
987. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
988. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
989. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
990. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
991. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
992. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
993. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
994. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
995. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
996. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
997. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
998. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
999. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1000. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1001. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1002. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1003. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1004. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1005. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1006. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1007. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1008. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1009. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1010. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1011. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1012. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1013. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1014. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1015. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1016. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1017. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1018. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1019. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1020. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1021. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1022. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1023. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1024. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1025. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1026. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1027. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1028. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1029. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1030. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1031. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1032. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1033. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1034. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1035. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1036. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1037. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1038. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1039. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1040. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1041. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1042. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1043. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1044. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1045. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1046. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1047. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1048. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1049. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1050. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1051. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1052. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1053. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1054. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1055. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1056. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1057. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1058. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1059. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1060. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1061. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1062. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1063. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1064. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1065. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1066. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1067. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1068. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1069. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1070. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1071. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1072. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1073. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1074. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1075. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1076. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1077. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1078. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1079. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1080. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1081. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1082. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1083. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1084. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1085. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1086. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1087. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1088. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1089. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1090. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1091. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1092. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1093. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1094. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1095. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1096. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1097. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1098. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1099. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1100. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1101. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1102. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1103. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1104. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1105. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1106. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1107. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1108. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1109. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1110. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1111. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1112. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1113. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1114. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1115. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1116. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1117. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1118. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1119. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1120. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1121. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1122. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1123. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1124. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1125. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1126. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1127. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1128. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1129. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1130. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1131. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1132. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1133. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1134. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1135. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1136. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1137. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1138. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1139. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1140. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1141. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1142. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1143. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1144. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1145. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1146. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1147. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1148. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1149. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1150. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1151. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1152. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1153. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1154. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1155. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1156. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1157. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1158. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1159. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1160. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1161. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1162. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1163. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1164. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1165. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1166. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1167. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1168. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1169. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1170. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1171. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1172. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1173. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1174. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1175. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1176. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1177. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1178. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1179. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1180. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1181. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1182. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1183. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1184. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1185. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1186. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1187. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1188. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1189. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1190. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1191. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1192. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1193. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1194. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1195. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1196. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1197. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1198. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1199. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1200. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1201. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1202. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1203. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1204. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1205. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1206. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1207. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1208. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1209. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1210. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1211. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1212. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1213. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1214. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1215. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1216. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1217. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1218. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1219. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1220. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1221. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1222. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1223. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1224. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1225. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1226. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1227. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1228. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1229. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1230. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1231. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1232. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1233. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1234. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1235. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1236. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1237. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1238. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1239. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1240. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1241. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1242. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1243. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1244. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1245. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1246. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1247. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1248. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1249. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1250. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1251. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1252. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1253. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1254. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1255. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1256. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1257. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1258. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1259. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1260. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1261. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1262. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1263. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1264. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1265. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1266. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1267. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1268. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1269. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1270. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1271. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1272. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1273. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1274. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1275. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1276. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1277. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1278. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1279. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1280. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1281. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1282. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1283. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1284. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1285. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1286. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1287. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1288. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1289. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1290. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1291. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1292. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1293. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1294. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1295. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1296. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1297. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1298. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1299. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1300. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1301. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1302. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1303. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1304. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1305. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1306. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1307. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1308. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1309. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1310. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1311. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1312. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1313. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1314. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1315. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1316. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1317. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1318. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1319. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1320. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1321. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1322. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1323. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1324. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1325. gbinv1.seq - Invertebrate sequence entries, part 1.
1326. gbinv10.seq - Invertebrate sequence entries, part 10.
1327. gbinv11.seq - Invertebrate sequence entries, part 11.
1328. gbinv12.seq - Invertebrate sequence entries, part 12.
1329. gbinv13.seq - Invertebrate sequence entries, part 13.
1330. gbinv14.seq - Invertebrate sequence entries, part 14.
1331. gbinv15.seq - Invertebrate sequence entries, part 15.
1332. gbinv16.seq - Invertebrate sequence entries, part 16.
1333. gbinv17.seq - Invertebrate sequence entries, part 17.
1334. gbinv18.seq - Invertebrate sequence entries, part 18.
1335. gbinv19.seq - Invertebrate sequence entries, part 19.
1336. gbinv2.seq - Invertebrate sequence entries, part 2.
1337. gbinv20.seq - Invertebrate sequence entries, part 20.
1338. gbinv21.seq - Invertebrate sequence entries, part 21.
1339. gbinv22.seq - Invertebrate sequence entries, part 22.
1340. gbinv23.seq - Invertebrate sequence entries, part 23.
1341. gbinv24.seq - Invertebrate sequence entries, part 24.
1342. gbinv25.seq - Invertebrate sequence entries, part 25.
1343. gbinv26.seq - Invertebrate sequence entries, part 26.
1344. gbinv27.seq - Invertebrate sequence entries, part 27.
1345. gbinv28.seq - Invertebrate sequence entries, part 28.
1346. gbinv29.seq - Invertebrate sequence entries, part 29.
1347. gbinv3.seq - Invertebrate sequence entries, part 3.
1348. gbinv30.seq - Invertebrate sequence entries, part 30.
1349. gbinv31.seq - Invertebrate sequence entries, part 31.
1350. gbinv32.seq - Invertebrate sequence entries, part 32.
1351. gbinv33.seq - Invertebrate sequence entries, part 33.
1352. gbinv34.seq - Invertebrate sequence entries, part 34.
1353. gbinv35.seq - Invertebrate sequence entries, part 35.
1354. gbinv36.seq - Invertebrate sequence entries, part 36.
1355. gbinv4.seq - Invertebrate sequence entries, part 4.
1356. gbinv5.seq - Invertebrate sequence entries, part 5.
1357. gbinv6.seq - Invertebrate sequence entries, part 6.
1358. gbinv7.seq - Invertebrate sequence entries, part 7.
1359. gbinv8.seq - Invertebrate sequence entries, part 8.
1360. gbinv9.seq - Invertebrate sequence entries, part 9.
1361. gbmam1.seq - Other mammalian sequence entries, part 1.
1362. gbmam2.seq - Other mammalian sequence entries, part 2.
1363. gbmam3.seq - Other mammalian sequence entries, part 3.
1364. gbmam4.seq - Other mammalian sequence entries, part 4.
1365. gbmam5.seq - Other mammalian sequence entries, part 5.
1366. gbmam6.seq - Other mammalian sequence entries, part 6.
1367. gbmam7.seq - Other mammalian sequence entries, part 7.
1368. gbmam8.seq - Other mammalian sequence entries, part 8.
1369. gbnew.txt - Accession numbers of entries new since the previous release.
1370. gbpat1.seq - Patent sequence entries, part 1.
1371. gbpat10.seq - Patent sequence entries, part 10.
1372. gbpat100.seq - Patent sequence entries, part 100.
1373. gbpat101.seq - Patent sequence entries, part 101.
1374. gbpat102.seq - Patent sequence entries, part 102.
1375. gbpat103.seq - Patent sequence entries, part 103.
1376. gbpat104.seq - Patent sequence entries, part 104.
1377. gbpat105.seq - Patent sequence entries, part 105.
1378. gbpat106.seq - Patent sequence entries, part 106.
1379. gbpat107.seq - Patent sequence entries, part 107.
1380. gbpat108.seq - Patent sequence entries, part 108.
1381. gbpat109.seq - Patent sequence entries, part 109.
1382. gbpat11.seq - Patent sequence entries, part 11.
1383. gbpat110.seq - Patent sequence entries, part 110.
1384. gbpat111.seq - Patent sequence entries, part 111.
1385. gbpat112.seq - Patent sequence entries, part 112.
1386. gbpat113.seq - Patent sequence entries, part 113.
1387. gbpat114.seq - Patent sequence entries, part 114.
1388. gbpat115.seq - Patent sequence entries, part 115.
1389. gbpat116.seq - Patent sequence entries, part 116.
1390. gbpat117.seq - Patent sequence entries, part 117.
1391. gbpat118.seq - Patent sequence entries, part 118.
1392. gbpat119.seq - Patent sequence entries, part 119.
1393. gbpat12.seq - Patent sequence entries, part 12.
1394. gbpat120.seq - Patent sequence entries, part 120.
1395. gbpat121.seq - Patent sequence entries, part 121.
1396. gbpat122.seq - Patent sequence entries, part 122.
1397. gbpat123.seq - Patent sequence entries, part 123.
1398. gbpat124.seq - Patent sequence entries, part 124.
1399. gbpat125.seq - Patent sequence entries, part 125.
1400. gbpat126.seq - Patent sequence entries, part 126.
1401. gbpat127.seq - Patent sequence entries, part 127.
1402. gbpat128.seq - Patent sequence entries, part 128.
1403. gbpat129.seq - Patent sequence entries, part 129.
1404. gbpat13.seq - Patent sequence entries, part 13.
1405. gbpat130.seq - Patent sequence entries, part 130.
1406. gbpat131.seq - Patent sequence entries, part 131.
1407. gbpat132.seq - Patent sequence entries, part 132.
1408. gbpat133.seq - Patent sequence entries, part 133.
1409. gbpat134.seq - Patent sequence entries, part 134.
1410. gbpat135.seq - Patent sequence entries, part 135.
1411. gbpat136.seq - Patent sequence entries, part 136.
1412. gbpat137.seq - Patent sequence entries, part 137.
1413. gbpat138.seq - Patent sequence entries, part 138.
1414. gbpat139.seq - Patent sequence entries, part 139.
1415. gbpat14.seq - Patent sequence entries, part 14.
1416. gbpat140.seq - Patent sequence entries, part 140.
1417. gbpat141.seq - Patent sequence entries, part 141.
1418. gbpat142.seq - Patent sequence entries, part 142.
1419. gbpat143.seq - Patent sequence entries, part 143.
1420. gbpat144.seq - Patent sequence entries, part 144.
1421. gbpat145.seq - Patent sequence entries, part 145.
1422. gbpat146.seq - Patent sequence entries, part 146.
1423. gbpat147.seq - Patent sequence entries, part 147.
1424. gbpat148.seq - Patent sequence entries, part 148.
1425. gbpat149.seq - Patent sequence entries, part 149.
1426. gbpat15.seq - Patent sequence entries, part 15.
1427. gbpat150.seq - Patent sequence entries, part 150.
1428. gbpat151.seq - Patent sequence entries, part 151.
1429. gbpat152.seq - Patent sequence entries, part 152.
1430. gbpat153.seq - Patent sequence entries, part 153.
1431. gbpat154.seq - Patent sequence entries, part 154.
1432. gbpat155.seq - Patent sequence entries, part 155.
1433. gbpat156.seq - Patent sequence entries, part 156.
1434. gbpat157.seq - Patent sequence entries, part 157.
1435. gbpat158.seq - Patent sequence entries, part 158.
1436. gbpat159.seq - Patent sequence entries, part 159.
1437. gbpat16.seq - Patent sequence entries, part 16.
1438. gbpat160.seq - Patent sequence entries, part 160.
1439. gbpat161.seq - Patent sequence entries, part 161.
1440. gbpat162.seq - Patent sequence entries, part 162.
1441. gbpat163.seq - Patent sequence entries, part 163.
1442. gbpat164.seq - Patent sequence entries, part 164.
1443. gbpat165.seq - Patent sequence entries, part 165.
1444. gbpat166.seq - Patent sequence entries, part 166.
1445. gbpat167.seq - Patent sequence entries, part 167.
1446. gbpat168.seq - Patent sequence entries, part 168.
1447. gbpat169.seq - Patent sequence entries, part 169.
1448. gbpat17.seq - Patent sequence entries, part 17.
1449. gbpat170.seq - Patent sequence entries, part 170.
1450. gbpat171.seq - Patent sequence entries, part 171.
1451. gbpat172.seq - Patent sequence entries, part 172.
1452. gbpat173.seq - Patent sequence entries, part 173.
1453. gbpat174.seq - Patent sequence entries, part 174.
1454. gbpat175.seq - Patent sequence entries, part 175.
1455. gbpat176.seq - Patent sequence entries, part 176.
1456. gbpat177.seq - Patent sequence entries, part 177.
1457. gbpat178.seq - Patent sequence entries, part 178.
1458. gbpat179.seq - Patent sequence entries, part 179.
1459. gbpat18.seq - Patent sequence entries, part 18.
1460. gbpat180.seq - Patent sequence entries, part 180.
1461. gbpat181.seq - Patent sequence entries, part 181.
1462. gbpat182.seq - Patent sequence entries, part 182.
1463. gbpat183.seq - Patent sequence entries, part 183.
1464. gbpat184.seq - Patent sequence entries, part 184.
1465. gbpat185.seq - Patent sequence entries, part 185.
1466. gbpat186.seq - Patent sequence entries, part 186.
1467. gbpat187.seq - Patent sequence entries, part 187.
1468. gbpat188.seq - Patent sequence entries, part 188.
1469. gbpat189.seq - Patent sequence entries, part 189.
1470. gbpat19.seq - Patent sequence entries, part 19.
1471. gbpat190.seq - Patent sequence entries, part 190.
1472. gbpat191.seq - Patent sequence entries, part 191.
1473. gbpat192.seq - Patent sequence entries, part 192.
1474. gbpat193.seq - Patent sequence entries, part 193.
1475. gbpat194.seq - Patent sequence entries, part 194.
1476. gbpat195.seq - Patent sequence entries, part 195.
1477. gbpat196.seq - Patent sequence entries, part 196.
1478. gbpat197.seq - Patent sequence entries, part 197.
1479. gbpat198.seq - Patent sequence entries, part 198.
1480. gbpat199.seq - Patent sequence entries, part 199.
1481. gbpat2.seq - Patent sequence entries, part 2.
1482. gbpat20.seq - Patent sequence entries, part 20.
1483. gbpat21.seq - Patent sequence entries, part 21.
1484. gbpat22.seq - Patent sequence entries, part 22.
1485. gbpat23.seq - Patent sequence entries, part 23.
1486. gbpat24.seq - Patent sequence entries, part 24.
1487. gbpat25.seq - Patent sequence entries, part 25.
1488. gbpat26.seq - Patent sequence entries, part 26.
1489. gbpat27.seq - Patent sequence entries, part 27.
1490. gbpat28.seq - Patent sequence entries, part 28.
1491. gbpat29.seq - Patent sequence entries, part 29.
1492. gbpat3.seq - Patent sequence entries, part 3.
1493. gbpat30.seq - Patent sequence entries, part 30.
1494. gbpat31.seq - Patent sequence entries, part 31.
1495. gbpat32.seq - Patent sequence entries, part 32.
1496. gbpat33.seq - Patent sequence entries, part 33.
1497. gbpat34.seq - Patent sequence entries, part 34.
1498. gbpat35.seq - Patent sequence entries, part 35.
1499. gbpat36.seq - Patent sequence entries, part 36.
1500. gbpat37.seq - Patent sequence entries, part 37.
1501. gbpat38.seq - Patent sequence entries, part 38.
1502. gbpat39.seq - Patent sequence entries, part 39.
1503. gbpat4.seq - Patent sequence entries, part 4.
1504. gbpat40.seq - Patent sequence entries, part 40.
1505. gbpat41.seq - Patent sequence entries, part 41.
1506. gbpat42.seq - Patent sequence entries, part 42.
1507. gbpat43.seq - Patent sequence entries, part 43.
1508. gbpat44.seq - Patent sequence entries, part 44.
1509. gbpat45.seq - Patent sequence entries, part 45.
1510. gbpat46.seq - Patent sequence entries, part 46.
1511. gbpat47.seq - Patent sequence entries, part 47.
1512. gbpat48.seq - Patent sequence entries, part 48.
1513. gbpat49.seq - Patent sequence entries, part 49.
1514. gbpat5.seq - Patent sequence entries, part 5.
1515. gbpat50.seq - Patent sequence entries, part 50.
1516. gbpat51.seq - Patent sequence entries, part 51.
1517. gbpat52.seq - Patent sequence entries, part 52.
1518. gbpat53.seq - Patent sequence entries, part 53.
1519. gbpat54.seq - Patent sequence entries, part 54.
1520. gbpat55.seq - Patent sequence entries, part 55.
1521. gbpat56.seq - Patent sequence entries, part 56.
1522. gbpat57.seq - Patent sequence entries, part 57.
1523. gbpat58.seq - Patent sequence entries, part 58.
1524. gbpat59.seq - Patent sequence entries, part 59.
1525. gbpat6.seq - Patent sequence entries, part 6.
1526. gbpat60.seq - Patent sequence entries, part 60.
1527. gbpat61.seq - Patent sequence entries, part 61.
1528. gbpat62.seq - Patent sequence entries, part 62.
1529. gbpat63.seq - Patent sequence entries, part 63.
1530. gbpat64.seq - Patent sequence entries, part 64.
1531. gbpat65.seq - Patent sequence entries, part 65.
1532. gbpat66.seq - Patent sequence entries, part 66.
1533. gbpat67.seq - Patent sequence entries, part 67.
1534. gbpat68.seq - Patent sequence entries, part 68.
1535. gbpat69.seq - Patent sequence entries, part 69.
1536. gbpat7.seq - Patent sequence entries, part 7.
1537. gbpat70.seq - Patent sequence entries, part 70.
1538. gbpat71.seq - Patent sequence entries, part 71.
1539. gbpat72.seq - Patent sequence entries, part 72.
1540. gbpat73.seq - Patent sequence entries, part 73.
1541. gbpat74.seq - Patent sequence entries, part 74.
1542. gbpat75.seq - Patent sequence entries, part 75.
1543. gbpat76.seq - Patent sequence entries, part 76.
1544. gbpat77.seq - Patent sequence entries, part 77.
1545. gbpat78.seq - Patent sequence entries, part 78.
1546. gbpat79.seq - Patent sequence entries, part 79.
1547. gbpat8.seq - Patent sequence entries, part 8.
1548. gbpat80.seq - Patent sequence entries, part 80.
1549. gbpat81.seq - Patent sequence entries, part 81.
1550. gbpat82.seq - Patent sequence entries, part 82.
1551. gbpat83.seq - Patent sequence entries, part 83.
1552. gbpat84.seq - Patent sequence entries, part 84.
1553. gbpat85.seq - Patent sequence entries, part 85.
1554. gbpat86.seq - Patent sequence entries, part 86.
1555. gbpat87.seq - Patent sequence entries, part 87.
1556. gbpat88.seq - Patent sequence entries, part 88.
1557. gbpat89.seq - Patent sequence entries, part 89.
1558. gbpat9.seq - Patent sequence entries, part 9.
1559. gbpat90.seq - Patent sequence entries, part 90.
1560. gbpat91.seq - Patent sequence entries, part 91.
1561. gbpat92.seq - Patent sequence entries, part 92.
1562. gbpat93.seq - Patent sequence entries, part 93.
1563. gbpat94.seq - Patent sequence entries, part 94.
1564. gbpat95.seq - Patent sequence entries, part 95.
1565. gbpat96.seq - Patent sequence entries, part 96.
1566. gbpat97.seq - Patent sequence entries, part 97.
1567. gbpat98.seq - Patent sequence entries, part 98.
1568. gbpat99.seq - Patent sequence entries, part 99.
1569. gbphg1.seq - Phage sequence entries, part 1.
1570. gbphg2.seq - Phage sequence entries, part 2.
1571. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1572. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1573. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1574. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1575. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1576. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1577. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1578. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1579. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1580. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1581. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1582. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1583. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1584. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1585. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1586. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1587. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1588. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1589. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1590. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1591. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1592. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1593. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1594. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1595. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1596. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1597. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1598. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1599. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1600. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1601. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1602. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1603. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1604. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1605. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1606. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1607. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1608. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1609. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1610. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1611. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1612. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1613. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1614. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1615. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1616. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1617. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1618. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1619. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1620. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1621. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1622. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1623. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1624. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1625. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1626. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1627. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
1628. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
1629. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
1630. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
1631. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
1632. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
1633. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1634. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1635. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1636. gbpri1.seq - Primate sequence entries, part 1.
1637. gbpri10.seq - Primate sequence entries, part 10.
1638. gbpri11.seq - Primate sequence entries, part 11.
1639. gbpri12.seq - Primate sequence entries, part 12.
1640. gbpri13.seq - Primate sequence entries, part 13.
1641. gbpri14.seq - Primate sequence entries, part 14.
1642. gbpri15.seq - Primate sequence entries, part 15.
1643. gbpri16.seq - Primate sequence entries, part 16.
1644. gbpri17.seq - Primate sequence entries, part 17.
1645. gbpri18.seq - Primate sequence entries, part 18.
1646. gbpri19.seq - Primate sequence entries, part 19.
1647. gbpri2.seq - Primate sequence entries, part 2.
1648. gbpri20.seq - Primate sequence entries, part 20.
1649. gbpri21.seq - Primate sequence entries, part 21.
1650. gbpri22.seq - Primate sequence entries, part 22.
1651. gbpri23.seq - Primate sequence entries, part 23.
1652. gbpri24.seq - Primate sequence entries, part 24.
1653. gbpri25.seq - Primate sequence entries, part 25.
1654. gbpri26.seq - Primate sequence entries, part 26.
1655. gbpri27.seq - Primate sequence entries, part 27.
1656. gbpri28.seq - Primate sequence entries, part 28.
1657. gbpri29.seq - Primate sequence entries, part 29.
1658. gbpri3.seq - Primate sequence entries, part 3.
1659. gbpri30.seq - Primate sequence entries, part 30.
1660. gbpri31.seq - Primate sequence entries, part 31.
1661. gbpri32.seq - Primate sequence entries, part 32.
1662. gbpri33.seq - Primate sequence entries, part 33.
1663. gbpri34.seq - Primate sequence entries, part 34.
1664. gbpri35.seq - Primate sequence entries, part 35.
1665. gbpri36.seq - Primate sequence entries, part 36.
1666. gbpri37.seq - Primate sequence entries, part 37.
1667. gbpri38.seq - Primate sequence entries, part 38.
1668. gbpri39.seq - Primate sequence entries, part 39.
1669. gbpri4.seq - Primate sequence entries, part 4.
1670. gbpri40.seq - Primate sequence entries, part 40.
1671. gbpri41.seq - Primate sequence entries, part 41.
1672. gbpri42.seq - Primate sequence entries, part 42.
1673. gbpri43.seq - Primate sequence entries, part 43.
1674. gbpri44.seq - Primate sequence entries, part 44.
1675. gbpri45.seq - Primate sequence entries, part 45.
1676. gbpri46.seq - Primate sequence entries, part 46.
1677. gbpri5.seq - Primate sequence entries, part 5.
1678. gbpri6.seq - Primate sequence entries, part 6.
1679. gbpri7.seq - Primate sequence entries, part 7.
1680. gbpri8.seq - Primate sequence entries, part 8.
1681. gbpri9.seq - Primate sequence entries, part 9.
1682. gbrel.txt - Release notes (this document).
1683. gbrod1.seq - Rodent sequence entries, part 1.
1684. gbrod10.seq - Rodent sequence entries, part 10.
1685. gbrod11.seq - Rodent sequence entries, part 11.
1686. gbrod12.seq - Rodent sequence entries, part 12.
1687. gbrod13.seq - Rodent sequence entries, part 13.
1688. gbrod14.seq - Rodent sequence entries, part 14.
1689. gbrod15.seq - Rodent sequence entries, part 15.
1690. gbrod16.seq - Rodent sequence entries, part 16.
1691. gbrod17.seq - Rodent sequence entries, part 17.
1692. gbrod18.seq - Rodent sequence entries, part 18.
1693. gbrod19.seq - Rodent sequence entries, part 19.
1694. gbrod2.seq - Rodent sequence entries, part 2.
1695. gbrod20.seq - Rodent sequence entries, part 20.
1696. gbrod21.seq - Rodent sequence entries, part 21.
1697. gbrod22.seq - Rodent sequence entries, part 22.
1698. gbrod23.seq - Rodent sequence entries, part 23.
1699. gbrod24.seq - Rodent sequence entries, part 24.
1700. gbrod25.seq - Rodent sequence entries, part 25.
1701. gbrod26.seq - Rodent sequence entries, part 26.
1702. gbrod27.seq - Rodent sequence entries, part 27.
1703. gbrod28.seq - Rodent sequence entries, part 28.
1704. gbrod29.seq - Rodent sequence entries, part 29.
1705. gbrod3.seq - Rodent sequence entries, part 3.
1706. gbrod30.seq - Rodent sequence entries, part 30.
1707. gbrod31.seq - Rodent sequence entries, part 31.
1708. gbrod4.seq - Rodent sequence entries, part 4.
1709. gbrod5.seq - Rodent sequence entries, part 5.
1710. gbrod6.seq - Rodent sequence entries, part 6.
1711. gbrod7.seq - Rodent sequence entries, part 7.
1712. gbrod8.seq - Rodent sequence entries, part 8.
1713. gbrod9.seq - Rodent sequence entries, part 9.
1714. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1715. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1716. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1717. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1718. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1719. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1720. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1721. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1722. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1723. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1724. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1725. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1726. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1727. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1728. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1729. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1730. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1731. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1732. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1733. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1734. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1735. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1736. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1737. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1738. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1739. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1740. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1741. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1742. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1743. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
1744. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
1745. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
1746. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
1747. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
1748. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
1749. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
1750. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
1751. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
1752. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
1753. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1754. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
1755. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
1756. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
1757. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
1758. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
1759. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
1760. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
1761. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
1762. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
1763. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
1764. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1765. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
1766. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
1767. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
1768. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
1769. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
1770. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
1771. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
1772. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
1773. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
1774. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
1775. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1776. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
1777. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
1778. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
1779. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
1780. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
1781. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
1782. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
1783. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
1784. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
1785. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
1786. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1787. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
1788. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
1789. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
1790. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
1791. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
1792. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
1793. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
1794. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
1795. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1796. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1797. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1798. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1799. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1800. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1801. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1802. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1803. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1804. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1805. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1806. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1807. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1808. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1809. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1810. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1811. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1812. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1813. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1814. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1815. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1816. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1817. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1818. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1819. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1820. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1821. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1822. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1823. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1824. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1825. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1826. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1827. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1828. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1829. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1830. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1831. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1832. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1833. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1834. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1835. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1836. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1837. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1838. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1839. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1840. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1841. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1842. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1843. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1844. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1845. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1846. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1847. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1848. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1849. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1850. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1851. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1852. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1853. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1854. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1855. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1856. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1857. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1858. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1859. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1860. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1861. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1862. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1863. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1864. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1865. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1866. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1867. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1868. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1869. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1870. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1871. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1872. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1873. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1874. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
1875. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
1876. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
1877. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1878. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
1879. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
1880. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
1881. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
1882. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
1883. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
1884. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
1885. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
1886. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
1887. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
1888. gbuna1.seq - Unannotated sequence entries, part 1.
1889. gbvrl1.seq - Viral sequence entries, part 1.
1890. gbvrl10.seq - Viral sequence entries, part 10.
1891. gbvrl11.seq - Viral sequence entries, part 11.
1892. gbvrl12.seq - Viral sequence entries, part 12.
1893. gbvrl13.seq - Viral sequence entries, part 13.
1894. gbvrl14.seq - Viral sequence entries, part 14.
1895. gbvrl15.seq - Viral sequence entries, part 15.
1896. gbvrl16.seq - Viral sequence entries, part 16.
1897. gbvrl17.seq - Viral sequence entries, part 17.
1898. gbvrl18.seq - Viral sequence entries, part 18.
1899. gbvrl19.seq - Viral sequence entries, part 19.
1900. gbvrl2.seq - Viral sequence entries, part 2.
1901. gbvrl20.seq - Viral sequence entries, part 20.
1902. gbvrl21.seq - Viral sequence entries, part 21.
1903. gbvrl22.seq - Viral sequence entries, part 22.
1904. gbvrl23.seq - Viral sequence entries, part 23.
1905. gbvrl24.seq - Viral sequence entries, part 24.
1906. gbvrl25.seq - Viral sequence entries, part 25.
1907. gbvrl26.seq - Viral sequence entries, part 26.
1908. gbvrl27.seq - Viral sequence entries, part 27.
1909. gbvrl28.seq - Viral sequence entries, part 28.
1910. gbvrl29.seq - Viral sequence entries, part 29.
1911. gbvrl3.seq - Viral sequence entries, part 3.
1912. gbvrl4.seq - Viral sequence entries, part 4.
1913. gbvrl5.seq - Viral sequence entries, part 5.
1914. gbvrl6.seq - Viral sequence entries, part 6.
1915. gbvrl7.seq - Viral sequence entries, part 7.
1916. gbvrl8.seq - Viral sequence entries, part 8.
1917. gbvrl9.seq - Viral sequence entries, part 9.
1918. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1919. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1920. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1921. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1922. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1923. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1924. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1925. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1926. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1927. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1928. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1929. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1930. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1931. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1932. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1933. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1934. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1935. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1936. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1937. gbvrt27.seq - Other vertebrate sequence entries, part 27.
1938. gbvrt28.seq - Other vertebrate sequence entries, part 28.
1939. gbvrt29.seq - Other vertebrate sequence entries, part 29.
1940. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1941. gbvrt30.seq - Other vertebrate sequence entries, part 30.
1942. gbvrt31.seq - Other vertebrate sequence entries, part 31.
1943. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1944. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1945. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1946. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1947. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1948. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 199.0 flatfiles require roughly 618 GB (sequence
files only) or 618 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249920034     gbbct1.seq
 245785318     gbbct10.seq
 247122945     gbbct100.seq
 243608710     gbbct101.seq
 245299471     gbbct102.seq
 248781902     gbbct103.seq
 143192975     gbbct104.seq
 246453894     gbbct105.seq
 242696000     gbbct106.seq
 245360184     gbbct107.seq
 248574022     gbbct108.seq
 249997849     gbbct109.seq
 248280739     gbbct11.seq
 249997621     gbbct110.seq
 249998411     gbbct111.seq
 249997662     gbbct112.seq
 249999188     gbbct113.seq
 120740474     gbbct114.seq
 239032384     gbbct12.seq
 247488101     gbbct13.seq
 244736213     gbbct14.seq
 249995395     gbbct15.seq
  31176899     gbbct16.seq
 243328246     gbbct17.seq
 249805279     gbbct18.seq
 248191347     gbbct19.seq
 249211973     gbbct2.seq
 249684372     gbbct20.seq
 244051801     gbbct21.seq
 245378227     gbbct22.seq
 242875625     gbbct23.seq
 239676754     gbbct24.seq
 217807723     gbbct25.seq
 242803966     gbbct26.seq
 241842051     gbbct27.seq
 248678800     gbbct28.seq
 247876261     gbbct29.seq
 245075862     gbbct3.seq
 249388696     gbbct30.seq
 244187652     gbbct31.seq
 247337907     gbbct32.seq
 249983201     gbbct33.seq
 249762098     gbbct34.seq
 240930753     gbbct35.seq
 244674501     gbbct36.seq
 249621028     gbbct37.seq
 164788286     gbbct38.seq
 248676366     gbbct39.seq
 244741545     gbbct4.seq
 246939606     gbbct40.seq
 248189326     gbbct41.seq
 246576496     gbbct42.seq
 241882757     gbbct43.seq
 246671495     gbbct44.seq
 249218298     gbbct45.seq
 243124941     gbbct46.seq
 249787519     gbbct47.seq
 247016044     gbbct48.seq
 243076126     gbbct49.seq
 249996050     gbbct5.seq
 246069189     gbbct50.seq
   9238607     gbbct51.seq
 244556348     gbbct52.seq
 245263506     gbbct53.seq
 240388741     gbbct54.seq
 247754654     gbbct55.seq
 246179677     gbbct56.seq
 248410732     gbbct57.seq
 248718488     gbbct58.seq
 241361678     gbbct59.seq
   8544447     gbbct6.seq
 243726933     gbbct60.seq
 245980754     gbbct61.seq
 249931420     gbbct62.seq
 239967850     gbbct63.seq
 249076682     gbbct64.seq
  28683480     gbbct65.seq
 245633132     gbbct66.seq
 243550821     gbbct67.seq
 248852669     gbbct68.seq
 245515801     gbbct69.seq
 249447248     gbbct7.seq
 247451181     gbbct70.seq
 240907564     gbbct71.seq
 242567092     gbbct72.seq
 247388795     gbbct73.seq
 248780765     gbbct74.seq
 246826743     gbbct75.seq
 248328736     gbbct76.seq
 248725680     gbbct77.seq
 112663087     gbbct78.seq
 245344393     gbbct79.seq
 249744918     gbbct8.seq
 246119448     gbbct80.seq
 247350812     gbbct81.seq
 244745216     gbbct82.seq
 241183526     gbbct83.seq
 247447451     gbbct84.seq
 246570825     gbbct85.seq
 248561654     gbbct86.seq
 238275699     gbbct87.seq
  83128007     gbbct88.seq
   6893041     gbbct89.seq
 227652599     gbbct9.seq
  14225130     gbbct90.seq
  23056045     gbbct91.seq
  45137115     gbbct92.seq
  87821710     gbbct93.seq
 170392832     gbbct94.seq
 249997357     gbbct95.seq
 249827942     gbbct96.seq
 246912223     gbbct97.seq
 240357350     gbbct98.seq
 244804912     gbbct99.seq
   7744472     gbchg.txt
 249999095     gbcon1.seq
 249995757     gbcon10.seq
 249996033     gbcon100.seq
 249999285     gbcon101.seq
 135141019     gbcon102.seq
 249999018     gbcon103.seq
 249995506     gbcon104.seq
 249999938     gbcon105.seq
 249996196     gbcon106.seq
 249994668     gbcon107.seq
 158184767     gbcon108.seq
 249997662     gbcon109.seq
 248969630     gbcon11.seq
 249996981     gbcon110.seq
 249998026     gbcon111.seq
 237160749     gbcon112.seq
 212966179     gbcon113.seq
 249999151     gbcon114.seq
 249991357     gbcon115.seq
 249995392     gbcon116.seq
 249984324     gbcon117.seq
  79054526     gbcon118.seq
 249998674     gbcon119.seq
 249278565     gbcon12.seq
 249998935     gbcon120.seq
 239420323     gbcon121.seq
 245419438     gbcon122.seq
 177983294     gbcon123.seq
 249996898     gbcon124.seq
 249948812     gbcon125.seq
 249998574     gbcon126.seq
 249997541     gbcon127.seq
 249998858     gbcon128.seq
 206513049     gbcon129.seq
 247958251     gbcon13.seq
 249998604     gbcon130.seq
 249664036     gbcon131.seq
 248604395     gbcon132.seq
 249867670     gbcon133.seq
 249997704     gbcon134.seq
 249913955     gbcon135.seq
 249993318     gbcon136.seq
 140074867     gbcon137.seq
 249995202     gbcon138.seq
 250000037     gbcon139.seq
 249876098     gbcon14.seq
 249997247     gbcon140.seq
 249998610     gbcon141.seq
 249997849     gbcon142.seq
 249691853     gbcon143.seq
 249983484     gbcon144.seq
 249999852     gbcon145.seq
 222899048     gbcon146.seq
 249999250     gbcon147.seq
 250000022     gbcon148.seq
 249732899     gbcon149.seq
 245013746     gbcon15.seq
 249997936     gbcon150.seq
 249991123     gbcon151.seq
 249999415     gbcon152.seq
 249997427     gbcon153.seq
 249999961     gbcon154.seq
 249999807     gbcon155.seq
 151287910     gbcon156.seq
 249999135     gbcon157.seq
 249996807     gbcon158.seq
 249997937     gbcon159.seq
 212446696     gbcon16.seq
 249996491     gbcon160.seq
 249985208     gbcon161.seq
 249454867     gbcon162.seq
  30840412     gbcon163.seq
 249998107     gbcon164.seq
 249755226     gbcon165.seq
 249998125     gbcon166.seq
 249963190     gbcon167.seq
 249998811     gbcon168.seq
 249997973     gbcon169.seq
 249997684     gbcon17.seq
 249998464     gbcon170.seq
 249997758     gbcon171.seq
 249948992     gbcon172.seq
 165749775     gbcon173.seq
 248961058     gbcon174.seq
 249979149     gbcon175.seq
 249996267     gbcon176.seq
 249872307     gbcon177.seq
 249998949     gbcon178.seq
 249986141     gbcon179.seq
 249997673     gbcon18.seq
 183692680     gbcon180.seq
 249999617     gbcon181.seq
 249999521     gbcon182.seq
 249998425     gbcon183.seq
 249998723     gbcon184.seq
 241596974     gbcon185.seq
 249878344     gbcon186.seq
 249998441     gbcon187.seq
 249997881     gbcon188.seq
 249980353     gbcon189.seq
 249997544     gbcon19.seq
 249959920     gbcon190.seq
 249999506     gbcon191.seq
 249994195     gbcon192.seq
 249994245     gbcon193.seq
  67596998     gbcon194.seq
 249998885     gbcon195.seq
 249999422     gbcon196.seq
 249999751     gbcon197.seq
 249998203     gbcon198.seq
 178583557     gbcon199.seq
 249741088     gbcon2.seq
 246186142     gbcon20.seq
 250000110     gbcon200.seq
 249999468     gbcon201.seq
 249999605     gbcon202.seq
 249999663     gbcon203.seq
 138364205     gbcon204.seq
 249998741     gbcon205.seq
 249999903     gbcon206.seq
 249998308     gbcon207.seq
 249963573     gbcon208.seq
 249998975     gbcon209.seq
 249997122     gbcon21.seq
 112329134     gbcon210.seq
 249994549     gbcon211.seq
 249997249     gbcon212.seq
 249997675     gbcon213.seq
 249998605     gbcon214.seq
 249993660     gbcon215.seq
 249930708     gbcon216.seq
  77511065     gbcon217.seq
 249998257     gbcon218.seq
 249994642     gbcon219.seq
 207275244     gbcon22.seq
 249999210     gbcon220.seq
 249999493     gbcon221.seq
 218942266     gbcon222.seq
 249998623     gbcon223.seq
 249995747     gbcon224.seq
 249999243     gbcon225.seq
 249997925     gbcon226.seq
 249999058     gbcon227.seq
 249995939     gbcon228.seq
 249998692     gbcon229.seq
 249996485     gbcon23.seq
 126175356     gbcon230.seq
  18896972     gbcon231.seq
 249150042     gbcon24.seq
 134018248     gbcon25.seq
 249998736     gbcon26.seq
 119794062     gbcon27.seq
 249993709     gbcon28.seq
 249890362     gbcon29.seq
 248799977     gbcon3.seq
 249999593     gbcon30.seq
 249990483     gbcon31.seq
 173320925     gbcon32.seq
 249998917     gbcon33.seq
 249996531     gbcon34.seq
 249997326     gbcon35.seq
 249998915     gbcon36.seq
 250000229     gbcon37.seq
 212324938     gbcon38.seq
 249997270     gbcon39.seq
 249999336     gbcon4.seq
 249999221     gbcon40.seq
 249994732     gbcon41.seq
 249996897     gbcon42.seq
 249997078     gbcon43.seq
 249997414     gbcon44.seq
  63412389     gbcon45.seq
 249995423     gbcon46.seq
 249997315     gbcon47.seq
 249997250     gbcon48.seq
 249997590     gbcon49.seq
 249997392     gbcon5.seq
 249996159     gbcon50.seq
  44928861     gbcon51.seq
 249994872     gbcon52.seq
 249995799     gbcon53.seq
 249997684     gbcon54.seq
 249996690     gbcon55.seq
 249997782     gbcon56.seq
  38241897     gbcon57.seq
 249998302     gbcon58.seq
 249999150     gbcon59.seq
 250000045     gbcon6.seq
 249998346     gbcon60.seq
 249994564     gbcon61.seq
 249999492     gbcon62.seq
 154672375     gbcon63.seq
 249999016     gbcon64.seq
 249996777     gbcon65.seq
 249999159     gbcon66.seq
 249995190     gbcon67.seq
 185611272     gbcon68.seq
 249996810     gbcon69.seq
  84912200     gbcon7.seq
 249998700     gbcon70.seq
 249997155     gbcon71.seq
 249997874     gbcon72.seq
 247616447     gbcon73.seq
 249998269     gbcon74.seq
 249995941     gbcon75.seq
 249998068     gbcon76.seq
 249999277     gbcon77.seq
 249999797     gbcon78.seq
  98773033     gbcon79.seq
 249993190     gbcon8.seq
 249997150     gbcon80.seq
 249997442     gbcon81.seq
 249995516     gbcon82.seq
 249996111     gbcon83.seq
 249995971     gbcon84.seq
  64633499     gbcon85.seq
 249998451     gbcon86.seq
 249995859     gbcon87.seq
 249994386     gbcon88.seq
 249994858     gbcon89.seq
 249997980     gbcon9.seq
 249998199     gbcon90.seq
  23638323     gbcon91.seq
 249997115     gbcon92.seq
 249995538     gbcon93.seq
 249998987     gbcon94.seq
 249999150     gbcon95.seq
 199759401     gbcon96.seq
 249994089     gbcon97.seq
 249998565     gbcon98.seq
 249998526     gbcon99.seq
    532138     gbdel.txt
 249999508     gbenv1.seq
 249999985     gbenv10.seq
 249999446     gbenv11.seq
  60748658     gbenv12.seq
 249999738     gbenv13.seq
 249999011     gbenv14.seq
 249997227     gbenv15.seq
 249998985     gbenv16.seq
 249998937     gbenv17.seq
 249999085     gbenv18.seq
 249999165     gbenv19.seq
 249998995     gbenv2.seq
 237279757     gbenv20.seq
 249997197     gbenv21.seq
 249999379     gbenv22.seq
 249998521     gbenv23.seq
 250000012     gbenv24.seq
 165218490     gbenv25.seq
 249998139     gbenv26.seq
 249918275     gbenv27.seq
 249999180     gbenv28.seq
 249999795     gbenv29.seq
 249999535     gbenv3.seq
 249998797     gbenv30.seq
 249997043     gbenv31.seq
  16823016     gbenv32.seq
 249999624     gbenv33.seq
 249999875     gbenv34.seq
 249998494     gbenv35.seq
 249997438     gbenv36.seq
 187533106     gbenv37.seq
 249999944     gbenv38.seq
 249999778     gbenv39.seq
 249998770     gbenv4.seq
 249997391     gbenv40.seq
 249999867     gbenv41.seq
 249999585     gbenv42.seq
 250000125     gbenv43.seq
  51700069     gbenv44.seq
 249999776     gbenv45.seq
 249999871     gbenv46.seq
 249998770     gbenv47.seq
 249999001     gbenv48.seq
 194450313     gbenv49.seq
 250000005     gbenv5.seq
 249999421     gbenv50.seq
 249998665     gbenv51.seq
 249995174     gbenv52.seq
 249998244     gbenv53.seq
 249998818     gbenv54.seq
  82056383     gbenv55.seq
 249998116     gbenv56.seq
 249999222     gbenv57.seq
 249998381     gbenv58.seq
 249999051     gbenv59.seq
 249999591     gbenv6.seq
 249999957     gbenv60.seq
  11028780     gbenv61.seq
 249999037     gbenv62.seq
 249997997     gbenv63.seq
 249998275     gbenv64.seq
 249998260     gbenv65.seq
 249999640     gbenv66.seq
  28085621     gbenv67.seq
 101338196     gbenv7.seq
 249998679     gbenv8.seq
 249998154     gbenv9.seq
 524290767     gbest1.seq
 524288976     gbest10.seq
 524291812     gbest100.seq
 524289318     gbest101.seq
 524290587     gbest102.seq
 524290773     gbest103.seq
 376247029     gbest104.seq
 524292224     gbest105.seq
 524288929     gbest106.seq
 524292343     gbest107.seq
 385846799     gbest108.seq
 389663417     gbest109.seq
 524289178     gbest11.seq
 383421037     gbest110.seq
 384185283     gbest111.seq
 381057820     gbest112.seq
 385304382     gbest113.seq
 390041543     gbest114.seq
 388177484     gbest115.seq
 387309952     gbest116.seq
 383864390     gbest117.seq
 407509351     gbest118.seq
 510464690     gbest119.seq
 524290684     gbest12.seq
 524288742     gbest120.seq
 524289583     gbest121.seq
 524290651     gbest122.seq
 524291441     gbest123.seq
 425900601     gbest124.seq
 524290040     gbest125.seq
 524291374     gbest126.seq
 524290828     gbest127.seq
 524289100     gbest128.seq
 524289094     gbest129.seq
 159701371     gbest13.seq
 524288934     gbest130.seq
 524289661     gbest131.seq
 524289430     gbest132.seq
 524290855     gbest133.seq
 524292365     gbest134.seq
 524291204     gbest135.seq
 524289726     gbest136.seq
 305688820     gbest137.seq
 524289775     gbest138.seq
 524290405     gbest139.seq
 524290133     gbest14.seq
 524291849     gbest140.seq
 524289751     gbest141.seq
 524292168     gbest142.seq
 524290082     gbest143.seq
 524290893     gbest144.seq
 524292915     gbest145.seq
 524292915     gbest146.seq
 524292163     gbest147.seq
 524292380     gbest148.seq
 524288834     gbest149.seq
 524292038     gbest15.seq
 524289302     gbest150.seq
 481275498     gbest151.seq
 524288992     gbest152.seq
 524291612     gbest153.seq
 524291129     gbest154.seq
 524289224     gbest155.seq
 524291237     gbest156.seq
 524289673     gbest157.seq
 524289527     gbest158.seq
 524288956     gbest159.seq
 524290584     gbest16.seq
 524289302     gbest160.seq
 524290027     gbest161.seq
 524290310     gbest162.seq
 524289951     gbest163.seq
 250256659     gbest164.seq
 524292158     gbest165.seq
 524291150     gbest166.seq
 524290923     gbest167.seq
 524291893     gbest168.seq
 524290330     gbest169.seq
 524291362     gbest17.seq
 524289544     gbest170.seq
 524289260     gbest171.seq
 524291429     gbest172.seq
 524292918     gbest173.seq
 524289899     gbest174.seq
 524288802     gbest175.seq
 524290353     gbest176.seq
 524290337     gbest177.seq
 114959814     gbest178.seq
 524288990     gbest179.seq
 524290620     gbest18.seq
 524290341     gbest180.seq
 524289665     gbest181.seq
 524289660     gbest182.seq
 524291910     gbest183.seq
 524288845     gbest184.seq
 524290757     gbest185.seq
 524290357     gbest186.seq
 524291253     gbest187.seq
 524291163     gbest188.seq
 524288819     gbest189.seq
 524289630     gbest19.seq
 524288975     gbest190.seq
 476792227     gbest191.seq
 524292439     gbest192.seq
 524290029     gbest193.seq
 524291680     gbest194.seq
 524290032     gbest195.seq
 524292440     gbest196.seq
 524289498     gbest197.seq
 524291769     gbest198.seq
 524289369     gbest199.seq
 524289981     gbest2.seq
 524289642     gbest20.seq
 524290365     gbest200.seq
 524288957     gbest201.seq
 524290930     gbest202.seq
 524291141     gbest203.seq
 524289492     gbest204.seq
  79149752     gbest205.seq
 524291411     gbest206.seq
 524289142     gbest207.seq
 524290607     gbest208.seq
 524288842     gbest209.seq
 524289115     gbest21.seq
 524288890     gbest210.seq
 524290391     gbest211.seq
 524289220     gbest212.seq
 524289400     gbest213.seq
 524290173     gbest214.seq
 524290622     gbest215.seq
 417115646     gbest216.seq
 524289678     gbest217.seq
 524290676     gbest218.seq
 524289301     gbest219.seq
 512638181     gbest22.seq
 524291285     gbest220.seq
 524292997     gbest221.seq
 524290695     gbest222.seq
 524291817     gbest223.seq
 524290699     gbest224.seq
 524288936     gbest225.seq
 524292429     gbest226.seq
 524290242     gbest227.seq
 524292902     gbest228.seq
 524289380     gbest229.seq
 500185454     gbest23.seq
 365035258     gbest230.seq
 524292298     gbest231.seq
 524290374     gbest232.seq
 524290051     gbest233.seq
 524289377     gbest234.seq
 524289322     gbest235.seq
 524290599     gbest236.seq
 524289195     gbest237.seq
 524290360     gbest238.seq
 524290606     gbest239.seq
 509262335     gbest24.seq
 524290817     gbest240.seq
 524290047     gbest241.seq
 524291051     gbest242.seq
 524290671     gbest243.seq
 524290094     gbest244.seq
  37562446     gbest245.seq
 524290388     gbest246.seq
 524289041     gbest247.seq
 524290197     gbest248.seq
 524290094     gbest249.seq
 321688189     gbest25.seq
 524289330     gbest250.seq
 524290059     gbest251.seq
 524289020     gbest252.seq
 524290996     gbest253.seq
 524289203     gbest254.seq
 524290047     gbest255.seq
 524290821     gbest256.seq
 271460829     gbest257.seq
 524288853     gbest258.seq
 524289625     gbest259.seq
 524289794     gbest26.seq
 524289793     gbest260.seq
 524290443     gbest261.seq
 524288790     gbest262.seq
 524290282     gbest263.seq
 524289011     gbest264.seq
 524290253     gbest265.seq
 524290098     gbest266.seq
 524289303     gbest267.seq
 303194355     gbest268.seq
 524290513     gbest269.seq
 524290673     gbest27.seq
 524291931     gbest270.seq
 524290380     gbest271.seq
 524291303     gbest272.seq
 524290612     gbest273.seq
 524289177     gbest274.seq
 524289713     gbest275.seq
 524290727     gbest276.seq
 524290938     gbest277.seq
 524290350     gbest278.seq
 524291718     gbest279.seq
 524289150     gbest28.seq
 314461078     gbest280.seq
 524288823     gbest281.seq
 524289585     gbest282.seq
 524291840     gbest283.seq
 524290505     gbest284.seq
 524289740     gbest285.seq
 524291511     gbest286.seq
 524290645     gbest287.seq
 524289922     gbest288.seq
 524291555     gbest289.seq
 524291316     gbest29.seq
 524289422     gbest290.seq
 524290472     gbest291.seq
 233315006     gbest292.seq
 524290933     gbest293.seq
 524288955     gbest294.seq
 524290136     gbest295.seq
 524290496     gbest296.seq
 524290061     gbest297.seq
 524289312     gbest298.seq
 524289126     gbest299.seq
 497602506     gbest3.seq
 524292856     gbest30.seq
 524290531     gbest300.seq
 477182360     gbest301.seq
 484792233     gbest302.seq
 487418980     gbest303.seq
 336054711     gbest304.seq
 524290558     gbest305.seq
 524288764     gbest306.seq
 524291291     gbest307.seq
 524291047     gbest308.seq
 524290916     gbest309.seq
 524290849     gbest31.seq
 524289480     gbest310.seq
 524289120     gbest311.seq
 524290051     gbest312.seq
 524291243     gbest313.seq
 524290372     gbest314.seq
 524290292     gbest315.seq
 524289223     gbest316.seq
 513054478     gbest317.seq
 524289998     gbest318.seq
 524290275     gbest319.seq
 524290240     gbest32.seq
 524290516     gbest320.seq
 524289623     gbest321.seq
 524291084     gbest322.seq
 524290876     gbest323.seq
 524289554     gbest324.seq
 524289826     gbest325.seq
 524290760     gbest326.seq
 524291153     gbest327.seq
 524289491     gbest328.seq
 524290351     gbest329.seq
 524289158     gbest33.seq
 524290915     gbest330.seq
 257771747     gbest331.seq
 524290741     gbest332.seq
 524288745     gbest333.seq
 524290161     gbest334.seq
 524292662     gbest335.seq
 500736156     gbest336.seq
 524292614     gbest337.seq
 524289992     gbest338.seq
 524290441     gbest339.seq
 520245746     gbest34.seq
 524289325     gbest340.seq
 524288901     gbest341.seq
 524292670     gbest342.seq
 524290279     gbest343.seq
 524292525     gbest344.seq
 354744296     gbest345.seq
 524290121     gbest346.seq
 524292580     gbest347.seq
 524290962     gbest348.seq
 524292422     gbest349.seq
 492761257     gbest35.seq
 524290752     gbest350.seq
 524289815     gbest351.seq
 524294337     gbest352.seq
 524292378     gbest353.seq
 524290247     gbest354.seq
 524292672     gbest355.seq
 524291811     gbest356.seq
 524291916     gbest357.seq
 524291212     gbest358.seq
 524289984     gbest359.seq
 494457989     gbest36.seq
  45874076     gbest360.seq
 524289752     gbest361.seq
 524289985     gbest362.seq
 524290272     gbest363.seq
 524291942     gbest364.seq
 524290643     gbest365.seq
 524290187     gbest366.seq
 524290445     gbest367.seq
 524290161     gbest368.seq
 524290107     gbest369.seq
 493332346     gbest37.seq
 524288824     gbest370.seq
 395267254     gbest371.seq
 524289652     gbest372.seq
 524291736     gbest373.seq
 524289012     gbest374.seq
 524291374     gbest375.seq
 524290885     gbest376.seq
 524289043     gbest377.seq
 524291031     gbest378.seq
 524290253     gbest379.seq
 487987774     gbest38.seq
 524288729     gbest380.seq
 524289316     gbest381.seq
 524290284     gbest382.seq
 336386235     gbest383.seq
 524289007     gbest384.seq
 524291513     gbest385.seq
 524288776     gbest386.seq
 524289953     gbest387.seq
 524289416     gbest388.seq
 524290624     gbest389.seq
 493150165     gbest39.seq
 524289341     gbest390.seq
 524289197     gbest391.seq
 524291084     gbest392.seq
 524291706     gbest393.seq
 322332934     gbest394.seq
 524290559     gbest395.seq
 524290756     gbest396.seq
 524289510     gbest397.seq
 524289625     gbest398.seq
 524292270     gbest399.seq
 524289442     gbest4.seq
 112629988     gbest40.seq
 524288754     gbest400.seq
 524289582     gbest401.seq
 524289510     gbest402.seq
 524288944     gbest403.seq
 524288806     gbest404.seq
 524290955     gbest405.seq
 524290430     gbest406.seq
 524291390     gbest407.seq
  93370097     gbest408.seq
 524289636     gbest409.seq
 524290390     gbest41.seq
 524289766     gbest410.seq
 524290103     gbest411.seq
 524292031     gbest412.seq
 524289938     gbest413.seq
 524289129     gbest414.seq
 524289990     gbest415.seq
 524290570     gbest416.seq
 524292361     gbest417.seq
 524289492     gbest418.seq
 524290169     gbest419.seq
 524290644     gbest42.seq
 524290477     gbest420.seq
 461220374     gbest421.seq
 524291082     gbest422.seq
 524290989     gbest423.seq
 524290824     gbest424.seq
 524289565     gbest425.seq
 524289791     gbest426.seq
 524294484     gbest427.seq
 524290296     gbest428.seq
 524290131     gbest429.seq
 524290721     gbest43.seq
 524290253     gbest430.seq
 524289841     gbest431.seq
 524290758     gbest432.seq
 524290169     gbest433.seq
 524291335     gbest434.seq
 524290678     gbest435.seq
  59780701     gbest436.seq
 524288811     gbest437.seq
 524289519     gbest438.seq
 524290713     gbest439.seq
 524289035     gbest44.seq
 524288948     gbest440.seq
 524289367     gbest441.seq
 524290533     gbest442.seq
 524292789     gbest443.seq
 524289783     gbest444.seq
 524293337     gbest445.seq
 524289369     gbest446.seq
 524289135     gbest447.seq
 524290558     gbest448.seq
 200653003     gbest449.seq
 524290715     gbest45.seq
 524290948     gbest450.seq
 524290433     gbest451.seq
 524289485     gbest452.seq
 524289286     gbest453.seq
 524290490     gbest454.seq
 524290562     gbest455.seq
 524289342     gbest456.seq
 524290990     gbest457.seq
 524289985     gbest458.seq
 524292301     gbest459.seq
 524290410     gbest46.seq
 447615017     gbest460.seq
 524290474     gbest461.seq
 524290614     gbest462.seq
 524289891     gbest463.seq
 524289688     gbest464.seq
 524291771     gbest465.seq
 524289568     gbest466.seq
 524291026     gbest467.seq
 524291244     gbest468.seq
 524290567     gbest469.seq
 524289913     gbest47.seq
 524290505     gbest470.seq
 524290798     gbest471.seq
 524290967     gbest472.seq
  71206177     gbest473.seq
 524288861     gbest474.seq
 339469219     gbest475.seq
 524290751     gbest48.seq
 524292062     gbest49.seq
 524289672     gbest5.seq
 524290052     gbest50.seq
 524291187     gbest51.seq
 524290166     gbest52.seq
 524290974     gbest53.seq
 254633406     gbest54.seq
 524289283     gbest55.seq
 524292031     gbest56.seq
 524290864     gbest57.seq
 524289676     gbest58.seq
 524291692     gbest59.seq
 524290963     gbest6.seq
 524289844     gbest60.seq
 524292148     gbest61.seq
 524288918     gbest62.seq
 524289354     gbest63.seq
 524290401     gbest64.seq
 524289978     gbest65.seq
 524291741     gbest66.seq
 465827746     gbest67.seq
 524290848     gbest68.seq
 524289658     gbest69.seq
 524289343     gbest7.seq
 524290546     gbest70.seq
 524289043     gbest71.seq
 524290092     gbest72.seq
 524289504     gbest73.seq
 524291233     gbest74.seq
 524290530     gbest75.seq
 524289119     gbest76.seq
 524290238     gbest77.seq
 524290669     gbest78.seq
 524290493     gbest79.seq
 524290453     gbest8.seq
 180183534     gbest80.seq
 524289006     gbest81.seq
 524290766     gbest82.seq
 524288754     gbest83.seq
 524289113     gbest84.seq
 524290966     gbest85.seq
 524289148     gbest86.seq
 524291057     gbest87.seq
 524290031     gbest88.seq
 524291371     gbest89.seq
 524289449     gbest9.seq
 524288906     gbest90.seq
 524290281     gbest91.seq
 464692260     gbest92.seq
 524288935     gbest93.seq
 524290758     gbest94.seq
 524289614     gbest95.seq
 524291574     gbest96.seq
 524290574     gbest97.seq
 524291723     gbest98.seq
 524290015     gbest99.seq
 524290368     gbgss1.seq
 524289285     gbgss10.seq
 524292593     gbgss100.seq
 524289703     gbgss101.seq
 524291138     gbgss102.seq
 524288836     gbgss103.seq
 419400305     gbgss104.seq
 524291381     gbgss105.seq
 524291510     gbgss106.seq
 524291130     gbgss107.seq
 524290272     gbgss108.seq
 524289580     gbgss109.seq
 524289812     gbgss11.seq
 524289571     gbgss110.seq
 524291366     gbgss111.seq
 524290918     gbgss112.seq
 524289384     gbgss113.seq
 524290332     gbgss114.seq
 524289322     gbgss115.seq
  62720055     gbgss116.seq
 524289651     gbgss117.seq
 524289701     gbgss118.seq
 524290340     gbgss119.seq
 524291324     gbgss12.seq
 524288835     gbgss120.seq
 524290562     gbgss121.seq
 524291375     gbgss122.seq
 524290616     gbgss123.seq
 524289686     gbgss124.seq
 524289961     gbgss125.seq
 524291699     gbgss126.seq
 524292086     gbgss127.seq
 524289979     gbgss128.seq
 205700123     gbgss129.seq
 524288807     gbgss13.seq
 524291458     gbgss130.seq
 524289987     gbgss131.seq
 524290828     gbgss132.seq
 524289982     gbgss133.seq
 524289617     gbgss134.seq
 524290275     gbgss135.seq
 524290602     gbgss136.seq
 524288736     gbgss137.seq
 524291230     gbgss138.seq
 517569855     gbgss139.seq
 524290718     gbgss14.seq
 516021531     gbgss140.seq
 157689539     gbgss141.seq
 524289201     gbgss142.seq
 524290732     gbgss143.seq
 524290513     gbgss144.seq
 524291343     gbgss145.seq
 524288923     gbgss146.seq
 524291284     gbgss147.seq
 524291131     gbgss148.seq
 524289994     gbgss149.seq
 524289280     gbgss15.seq
 524289140     gbgss150.seq
 524289046     gbgss151.seq
 333390914     gbgss152.seq
 524290921     gbgss153.seq
 524291116     gbgss154.seq
 524291843     gbgss155.seq
 524289605     gbgss156.seq
 524290463     gbgss157.seq
 524290568     gbgss158.seq
 524288886     gbgss159.seq
 524289143     gbgss16.seq
 524290948     gbgss160.seq
 498478304     gbgss161.seq
 250000073     gbgss162.seq
 249997859     gbgss163.seq
 249998312     gbgss164.seq
 249996855     gbgss165.seq
  30232015     gbgss166.seq
 249997137     gbgss167.seq
 250000033     gbgss168.seq
 249998542     gbgss169.seq
 524289552     gbgss17.seq
 249998333     gbgss170.seq
 224919493     gbgss171.seq
 249998415     gbgss172.seq
 249998695     gbgss173.seq
 249998511     gbgss174.seq
 249998296     gbgss175.seq
 193193879     gbgss176.seq
 249998797     gbgss177.seq
 249999676     gbgss178.seq
 249999350     gbgss179.seq
 524289885     gbgss18.seq
 249998311     gbgss180.seq
 249999139     gbgss181.seq
  77095281     gbgss182.seq
 249999189     gbgss183.seq
   2090297     gbgss184.seq
  80345119     gbgss185.seq
 249998428     gbgss186.seq
 249999779     gbgss187.seq
  87362036     gbgss188.seq
 249999685     gbgss189.seq
 318269089     gbgss19.seq
 249998355     gbgss190.seq
 249998984     gbgss191.seq
 202702168     gbgss192.seq
 249999232     gbgss193.seq
 249998752     gbgss194.seq
 250000079     gbgss195.seq
 246010499     gbgss196.seq
 249997836     gbgss197.seq
 249999811     gbgss198.seq
 249999021     gbgss199.seq
 524289021     gbgss2.seq
 524291240     gbgss20.seq
 244314369     gbgss200.seq
 249999336     gbgss201.seq
 249999697     gbgss202.seq
 249996378     gbgss203.seq
 249997194     gbgss204.seq
 124981522     gbgss205.seq
 249998013     gbgss206.seq
 249999792     gbgss207.seq
 249998459     gbgss208.seq
 249998343     gbgss209.seq
 524289092     gbgss21.seq
  95905540     gbgss210.seq
 249999742     gbgss211.seq
 249999443     gbgss212.seq
 249998678     gbgss213.seq
 249998232     gbgss214.seq
 249999410     gbgss215.seq
 143582412     gbgss216.seq
 249999236     gbgss217.seq
 249997993     gbgss218.seq
 249998006     gbgss219.seq
 524290305     gbgss22.seq
 249999353     gbgss220.seq
  95926739     gbgss221.seq
 249999461     gbgss222.seq
 249999350     gbgss223.seq
 249998406     gbgss224.seq
 249998619     gbgss225.seq
 249999398     gbgss226.seq
 249998623     gbgss227.seq
  99517682     gbgss228.seq
 249999424     gbgss229.seq
 524289091     gbgss23.seq
 249999963     gbgss230.seq
 249997369     gbgss231.seq
  43648880     gbgss232.seq
  52925443     gbgss233.seq
 249997818     gbgss234.seq
 250000212     gbgss235.seq
 249999182     gbgss236.seq
 249997928     gbgss237.seq
  19185922     gbgss238.seq
 249997670     gbgss239.seq
 524290039     gbgss24.seq
 249997588     gbgss240.seq
 249999018     gbgss241.seq
 250000000     gbgss242.seq
  28042636     gbgss243.seq
 249997661     gbgss244.seq
 250000032     gbgss245.seq
 249998867     gbgss246.seq
 249999716     gbgss247.seq
 249999456     gbgss248.seq
 249997806     gbgss249.seq
 524292286     gbgss25.seq
 195661895     gbgss250.seq
 249999488     gbgss251.seq
 250000164     gbgss252.seq
 249999959     gbgss253.seq
 225557804     gbgss254.seq
 250000034     gbgss255.seq
 249999411     gbgss256.seq
 249998949     gbgss257.seq
 249998290     gbgss258.seq
 249997495     gbgss259.seq
 524289860     gbgss26.seq
  66032842     gbgss260.seq
 249999961     gbgss261.seq
 249999246     gbgss262.seq
 249997183     gbgss263.seq
 249998878     gbgss264.seq
 249998009     gbgss265.seq
 249998219     gbgss266.seq
 249999976     gbgss267.seq
 201471569     gbgss268.seq
 249999562     gbgss269.seq
 524290353     gbgss27.seq
 249998752     gbgss270.seq
 249999600     gbgss271.seq
 249999029     gbgss272.seq
 221982324     gbgss273.seq
 249999142     gbgss274.seq
 249998695     gbgss275.seq
 249999858     gbgss276.seq
 249999896     gbgss277.seq
 249999864     gbgss278.seq
 176275379     gbgss279.seq
 524290186     gbgss28.seq
 524289979     gbgss29.seq
 524290442     gbgss3.seq
 524290278     gbgss30.seq
  45687775     gbgss31.seq
 524291118     gbgss32.seq
 524290113     gbgss33.seq
 524289714     gbgss34.seq
 524289477     gbgss35.seq
 524289253     gbgss36.seq
 524289652     gbgss37.seq
 524288816     gbgss38.seq
 509250467     gbgss39.seq
 524291860     gbgss4.seq
 524291875     gbgss40.seq
 524291577     gbgss41.seq
 524291529     gbgss42.seq
  27687318     gbgss43.seq
 524289879     gbgss44.seq
 524289822     gbgss45.seq
 524291003     gbgss46.seq
 524290659     gbgss47.seq
 225663594     gbgss48.seq
 524290426     gbgss49.seq
 169147819     gbgss5.seq
 524289735     gbgss50.seq
 524291269     gbgss51.seq
 524290370     gbgss52.seq
 524290963     gbgss53.seq
 524289130     gbgss54.seq
 524291286     gbgss55.seq
 524291130     gbgss56.seq
 524289089     gbgss57.seq
 524288761     gbgss58.seq
 524289215     gbgss59.seq
 524289010     gbgss6.seq
  38426780     gbgss60.seq
 524289366     gbgss61.seq
 524291778     gbgss62.seq
 524289131     gbgss63.seq
 462144384     gbgss64.seq
 524288915     gbgss65.seq
 524289683     gbgss66.seq
 524291165     gbgss67.seq
 524290958     gbgss68.seq
 524290440     gbgss69.seq
 524288953     gbgss7.seq
 524290262     gbgss70.seq
 524290903     gbgss71.seq
 524290190     gbgss72.seq
 524288765     gbgss73.seq
 524290216     gbgss74.seq
 524288816     gbgss75.seq
 524289675     gbgss76.seq
  50354005     gbgss77.seq
 524289532     gbgss78.seq
 524291930     gbgss79.seq
 524291058     gbgss8.seq
 524289712     gbgss80.seq
 524289310     gbgss81.seq
 524291767     gbgss82.seq
 524291327     gbgss83.seq
 524288828     gbgss84.seq
 524289939     gbgss85.seq
 524291780     gbgss86.seq
 524288896     gbgss87.seq
 524289448     gbgss88.seq
 391810834     gbgss89.seq
 524291559     gbgss9.seq
 524292172     gbgss90.seq
 524291677     gbgss91.seq
 524291807     gbgss92.seq
 524292003     gbgss93.seq
 524289134     gbgss94.seq
 524289592     gbgss95.seq
 524289866     gbgss96.seq
 524291875     gbgss97.seq
 524291048     gbgss98.seq
 524291620     gbgss99.seq
 249986566     gbhtc1.seq
 249994204     gbhtc10.seq
 249997343     gbhtc11.seq
 106641820     gbhtc12.seq
 249997337     gbhtc13.seq
 249997157     gbhtc14.seq
 107697209     gbhtc15.seq
 249998271     gbhtc2.seq
 249993125     gbhtc3.seq
 249988171     gbhtc4.seq
 249990143     gbhtc5.seq
 249997249     gbhtc6.seq
 249998042     gbhtc7.seq
  83887395     gbhtc8.seq
 249997566     gbhtc9.seq
 249909480     gbhtg1.seq
 249953476     gbhtg10.seq
 249912301     gbhtg100.seq
 249866447     gbhtg101.seq
 249548804     gbhtg102.seq
 249760556     gbhtg103.seq
   3945954     gbhtg104.seq
 249883907     gbhtg105.seq
 249900009     gbhtg106.seq
 249863636     gbhtg107.seq
 249992303     gbhtg108.seq
 249881962     gbhtg109.seq
    799345     gbhtg11.seq
 249917706     gbhtg110.seq
 168251142     gbhtg111.seq
 249860776     gbhtg112.seq
 249854435     gbhtg113.seq
 249790554     gbhtg114.seq
 249920554     gbhtg115.seq
 249895428     gbhtg116.seq
 249905195     gbhtg117.seq
 249788918     gbhtg118.seq
 154533407     gbhtg119.seq
 249888634     gbhtg12.seq
 249944102     gbhtg120.seq
 249905963     gbhtg121.seq
 249976951     gbhtg122.seq
 249801679     gbhtg123.seq
 249987230     gbhtg124.seq
 102371272     gbhtg125.seq
 249860712     gbhtg126.seq
 249838140     gbhtg127.seq
 249821140     gbhtg128.seq
 249919248     gbhtg129.seq
 249970616     gbhtg13.seq
 249980002     gbhtg130.seq
 134314079     gbhtg131.seq
 249756647     gbhtg132.seq
 249966901     gbhtg133.seq
 249810959     gbhtg134.seq
 249845635     gbhtg135.seq
 249993011     gbhtg136.seq
 249987459     gbhtg137.seq
 249850922     gbhtg138.seq
 249794413     gbhtg139.seq
 249587452     gbhtg14.seq
 249981732     gbhtg140.seq
 117421000     gbhtg141.seq
 249775919     gbhtg15.seq
 249742407     gbhtg16.seq
 249169910     gbhtg17.seq
 249983710     gbhtg18.seq
 249677604     gbhtg19.seq
 249996481     gbhtg2.seq
 249988869     gbhtg20.seq
 237145248     gbhtg21.seq
 249760635     gbhtg22.seq
 249868504     gbhtg23.seq
 249987789     gbhtg24.seq
 249921840     gbhtg25.seq
 249761262     gbhtg26.seq
 249891641     gbhtg27.seq
 249961480     gbhtg28.seq
 249842227     gbhtg29.seq
 249996431     gbhtg3.seq
 249993327     gbhtg30.seq
 225325084     gbhtg31.seq
 249827888     gbhtg32.seq
 249920914     gbhtg33.seq
 249929530     gbhtg34.seq
 249919058     gbhtg35.seq
 249858247     gbhtg36.seq
 249814872     gbhtg37.seq
 249768165     gbhtg38.seq
 249627620     gbhtg39.seq
 249972999     gbhtg4.seq
 249840054     gbhtg40.seq
 224363625     gbhtg41.seq
 249890056     gbhtg42.seq
 249787035     gbhtg43.seq
 249974606     gbhtg44.seq
 249775813     gbhtg45.seq
 249970808     gbhtg46.seq
 249705822     gbhtg47.seq
 249863885     gbhtg48.seq
 249890301     gbhtg49.seq
 249908886     gbhtg5.seq
 249900410     gbhtg50.seq
 234810619     gbhtg51.seq
 249734873     gbhtg52.seq
 249975148     gbhtg53.seq
 249784986     gbhtg54.seq
 249720695     gbhtg55.seq
 249962503     gbhtg56.seq
  18795923     gbhtg57.seq
 249861371     gbhtg58.seq
 249826895     gbhtg59.seq
 249993224     gbhtg6.seq
 249998389     gbhtg60.seq
 249924511     gbhtg61.seq
 225131050     gbhtg62.seq
 249972744     gbhtg63.seq
 249907195     gbhtg64.seq
 249800734     gbhtg65.seq
 249765032     gbhtg66.seq
 249829971     gbhtg67.seq
  16219827     gbhtg68.seq
 249979624     gbhtg69.seq
 249808927     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249765180     gbhtg72.seq
 223423355     gbhtg73.seq
 249942260     gbhtg74.seq
 249842799     gbhtg75.seq
 249910752     gbhtg76.seq
 249845923     gbhtg77.seq
 235439656     gbhtg78.seq
 249875996     gbhtg79.seq
 249827069     gbhtg8.seq
 249973504     gbhtg80.seq
 249883500     gbhtg81.seq
 249894122     gbhtg82.seq
 202307548     gbhtg83.seq
 249860907     gbhtg84.seq
 249956619     gbhtg85.seq
 249853021     gbhtg86.seq
 249877961     gbhtg87.seq
 206015973     gbhtg88.seq
 249886713     gbhtg89.seq
 249952721     gbhtg9.seq
 249869247     gbhtg90.seq
 249775862     gbhtg91.seq
 249874689     gbhtg92.seq
 194411465     gbhtg93.seq
 249975865     gbhtg94.seq
 249999399     gbhtg95.seq
 249903744     gbhtg96.seq
 249804831     gbhtg97.seq
 161658952     gbhtg98.seq
 249871688     gbhtg99.seq
 249997553     gbinv1.seq
 249999051     gbinv10.seq
 249998447     gbinv11.seq
 195908653     gbinv12.seq
 249997682     gbinv13.seq
 249996820     gbinv14.seq
 249998608     gbinv15.seq
 163648903     gbinv16.seq
 249999660     gbinv17.seq
 248949600     gbinv18.seq
 249999843     gbinv19.seq
 249973138     gbinv2.seq
 249998195     gbinv20.seq
 249999232     gbinv21.seq
  26743205     gbinv22.seq
 228795487     gbinv23.seq
 175506967     gbinv24.seq
 249999285     gbinv25.seq
 249998136     gbinv26.seq
 176604909     gbinv27.seq
 249999167     gbinv28.seq
 249997907     gbinv29.seq
 249995225     gbinv3.seq
 249999499     gbinv30.seq
 249998348     gbinv31.seq
 249997501     gbinv32.seq
 249999509     gbinv33.seq
 249997776     gbinv34.seq
 249998859     gbinv35.seq
 247827059     gbinv36.seq
 245969455     gbinv4.seq
 249998728     gbinv5.seq
 249995381     gbinv6.seq
 249999153     gbinv7.seq
 111209762     gbinv8.seq
 249999031     gbinv9.seq
 249719989     gbmam1.seq
 249999381     gbmam2.seq
 249996985     gbmam3.seq
 249863508     gbmam4.seq
 249999956     gbmam5.seq
 249998108     gbmam6.seq
 249999956     gbmam7.seq
 224186731     gbmam8.seq
  21333653     gbnew.txt
 250000027     gbpat1.seq
 249973434     gbpat10.seq
 249999065     gbpat100.seq
 249999793     gbpat101.seq
 149112469     gbpat102.seq
 249999880     gbpat103.seq
 249999565     gbpat104.seq
 249929731     gbpat105.seq
 249824879     gbpat106.seq
 249998856     gbpat107.seq
 192960282     gbpat108.seq
 249999931     gbpat109.seq
 179864905     gbpat11.seq
 249999610     gbpat110.seq
 250000197     gbpat111.seq
  80194649     gbpat112.seq
 249999957     gbpat113.seq
 249999618     gbpat114.seq
 249966232     gbpat115.seq
 249999449     gbpat116.seq
 249935711     gbpat117.seq
  66835452     gbpat118.seq
 249999441     gbpat119.seq
 250000133     gbpat12.seq
 249999845     gbpat120.seq
 249999888     gbpat121.seq
 249999095     gbpat122.seq
 160256390     gbpat123.seq
 249999974     gbpat124.seq
 249999633     gbpat125.seq
 234784218     gbpat126.seq
 249991591     gbpat127.seq
 249970935     gbpat128.seq
 249999681     gbpat129.seq
 249995797     gbpat13.seq
 249997397     gbpat130.seq
 249997452     gbpat131.seq
  66832984     gbpat132.seq
 249992315     gbpat133.seq
 249999867     gbpat134.seq
 250000197     gbpat135.seq
 249999821     gbpat136.seq
 249998337     gbpat137.seq
  18437114     gbpat138.seq
 249999655     gbpat139.seq
 249999778     gbpat14.seq
 249998828     gbpat140.seq
 249999803     gbpat141.seq
 249999630     gbpat142.seq
  46945969     gbpat143.seq
 249999271     gbpat144.seq
 249999873     gbpat145.seq
 249999008     gbpat146.seq
 234349056     gbpat147.seq
 249999644     gbpat148.seq
 249999868     gbpat149.seq
 249998758     gbpat15.seq
 250000015     gbpat150.seq
  86183914     gbpat151.seq
 249999922     gbpat152.seq
 249997644     gbpat153.seq
 249999277     gbpat154.seq
  63641523     gbpat155.seq
 249996829     gbpat156.seq
 249999772     gbpat157.seq
 249999986     gbpat158.seq
 249999342     gbpat159.seq
 249998679     gbpat16.seq
 249999835     gbpat160.seq
 249999666     gbpat161.seq
 222750207     gbpat162.seq
 250000249     gbpat163.seq
 249999893     gbpat164.seq
 249999893     gbpat165.seq
 220539897     gbpat166.seq
 249999753     gbpat167.seq
 250000193     gbpat168.seq
 249999956     gbpat169.seq
  65958097     gbpat17.seq
  12441501     gbpat170.seq
 249998024     gbpat171.seq
 249999923     gbpat172.seq
 250000126     gbpat173.seq
 249999132     gbpat174.seq
 249981980     gbpat175.seq
 249999944     gbpat176.seq
 150977257     gbpat177.seq
 249999674     gbpat178.seq
 249999079     gbpat179.seq
 250000027     gbpat18.seq
 249999396     gbpat180.seq
 250000223     gbpat181.seq
 214729049     gbpat182.seq
 249999331     gbpat183.seq
 249188871     gbpat184.seq
 249998721     gbpat185.seq
 249998830     gbpat186.seq
 249884865     gbpat187.seq
 249999635     gbpat188.seq
 250000047     gbpat189.seq
 249999801     gbpat19.seq
 249967437     gbpat190.seq
 212790470     gbpat191.seq
 249999356     gbpat192.seq
 249999839     gbpat193.seq
 249999090     gbpat194.seq
 250000032     gbpat195.seq
 250000121     gbpat196.seq
 250000174     gbpat197.seq
 249999997     gbpat198.seq
 146984029     gbpat199.seq
 249998159     gbpat2.seq
 249999814     gbpat20.seq
 249998697     gbpat21.seq
 186210806     gbpat22.seq
 249999884     gbpat23.seq
 249973601     gbpat24.seq
 249999928     gbpat25.seq
 249999948     gbpat26.seq
  71398617     gbpat27.seq
 249996311     gbpat28.seq
 249999890     gbpat29.seq
 249999030     gbpat3.seq
 250000179     gbpat30.seq
 249999880     gbpat31.seq
 249999958     gbpat32.seq
 180289878     gbpat33.seq
 249998387     gbpat34.seq
 249999242     gbpat35.seq
 250000073     gbpat36.seq
 249998624     gbpat37.seq
 250000127     gbpat38.seq
  53339842     gbpat39.seq
 249998670     gbpat4.seq
 249998616     gbpat40.seq
 249942643     gbpat41.seq
 249999613     gbpat42.seq
 249999602     gbpat43.seq
 249997129     gbpat44.seq
 249911848     gbpat45.seq
 249999213     gbpat46.seq
 249996650     gbpat47.seq
 171734662     gbpat48.seq
 249997855     gbpat49.seq
  71721496     gbpat5.seq
 249999139     gbpat50.seq
 249996276     gbpat51.seq
 249999732     gbpat52.seq
 222942647     gbpat53.seq
 249999057     gbpat54.seq
 249999815     gbpat55.seq
 250000246     gbpat56.seq
 165001552     gbpat57.seq
 249898280     gbpat58.seq
 249997852     gbpat59.seq
 249999527     gbpat6.seq
 249998810     gbpat60.seq
 249999887     gbpat61.seq
 135148112     gbpat62.seq
 249998399     gbpat63.seq
 249998801     gbpat64.seq
 249997619     gbpat65.seq
 249998578     gbpat66.seq
 249999274     gbpat67.seq
 249999241     gbpat68.seq
 144894652     gbpat69.seq
 249999146     gbpat7.seq
 249999757     gbpat70.seq
 249999899     gbpat71.seq
 249998837     gbpat72.seq
 244413604     gbpat73.seq
 248969093     gbpat74.seq
 244459306     gbpat75.seq
 247876384     gbpat76.seq
 249999624     gbpat77.seq
 160624439     gbpat78.seq
 250000121     gbpat79.seq
 249995913     gbpat8.seq
 249999657     gbpat80.seq
 249999470     gbpat81.seq
 249999644     gbpat82.seq
 249995072     gbpat83.seq
 249998647     gbpat84.seq
  93410370     gbpat85.seq
 249158931     gbpat86.seq
 249999214     gbpat87.seq
 249999116     gbpat88.seq
 249999380     gbpat89.seq
 249999433     gbpat9.seq
 249999186     gbpat90.seq
 249999693     gbpat91.seq
 145303563     gbpat92.seq
 249999103     gbpat93.seq
 249998964     gbpat94.seq
 249999939     gbpat95.seq
 250000257     gbpat96.seq
 196970502     gbpat97.seq
 249999051     gbpat98.seq
 249998995     gbpat99.seq
 249971198     gbphg1.seq
  60044872     gbphg2.seq
 249998054     gbpln1.seq
  12467701     gbpln10.seq
 249999109     gbpln11.seq
 249997693     gbpln12.seq
 249997779     gbpln13.seq
 249913791     gbpln14.seq
 215330499     gbpln15.seq
 249996685     gbpln16.seq
 249997108     gbpln17.seq
 249999352     gbpln18.seq
 249312793     gbpln19.seq
 249944165     gbpln2.seq
 249998546     gbpln20.seq
 248909656     gbpln21.seq
 249999039     gbpln22.seq
  51903392     gbpln23.seq
 249998545     gbpln24.seq
  99801623     gbpln25.seq
 249999527     gbpln26.seq
 249997476     gbpln27.seq
 249977442     gbpln28.seq
 221263938     gbpln29.seq
 249820591     gbpln3.seq
 181013449     gbpln30.seq
 247205819     gbpln31.seq
 250000032     gbpln32.seq
 246991729     gbpln33.seq
 249995280     gbpln34.seq
 249999048     gbpln35.seq
 183626570     gbpln36.seq
 250000131     gbpln37.seq
 249998092     gbpln38.seq
 249998547     gbpln39.seq
 249945490     gbpln4.seq
 249997945     gbpln40.seq
 145059086     gbpln41.seq
 250000189     gbpln42.seq
 249998337     gbpln43.seq
 249997983     gbpln44.seq
 249997573     gbpln45.seq
 249992200     gbpln46.seq
 238466572     gbpln47.seq
 249999936     gbpln48.seq
 249885691     gbpln49.seq
 249997428     gbpln5.seq
 249998640     gbpln50.seq
 250000033     gbpln51.seq
 249998811     gbpln52.seq
 207613857     gbpln53.seq
 249998935     gbpln54.seq
 249997847     gbpln55.seq
 250000154     gbpln56.seq
 249998381     gbpln57.seq
 239384080     gbpln58.seq
 249998364     gbpln59.seq
 249813015     gbpln6.seq
 249998057     gbpln60.seq
 249999580     gbpln61.seq
 249998113     gbpln62.seq
 249756720     gbpln63.seq
 249999777     gbpln64.seq
 155417238     gbpln65.seq
 249915630     gbpln7.seq
 249999168     gbpln8.seq
 249998847     gbpln9.seq
 149065996     gbpri1.seq
 249857398     gbpri10.seq
 136347763     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249865833     gbpri16.seq
 249867629     gbpri17.seq
 249758014     gbpri18.seq
 249922775     gbpri19.seq
 249925764     gbpri2.seq
 249959135     gbpri20.seq
 249960838     gbpri21.seq
 249999262     gbpri22.seq
  74315704     gbpri23.seq
 177508525     gbpri24.seq
 249999894     gbpri25.seq
 211357951     gbpri26.seq
 249925296     gbpri27.seq
 249919042     gbpri28.seq
 249998469     gbpri29.seq
 249780866     gbpri3.seq
 249893395     gbpri30.seq
 249950984     gbpri31.seq
 249970932     gbpri32.seq
 249999192     gbpri33.seq
 249995702     gbpri34.seq
  27100713     gbpri35.seq
 249993971     gbpri36.seq
 249995513     gbpri37.seq
 249732887     gbpri38.seq
 249998318     gbpri39.seq
 249926351     gbpri4.seq
 249998251     gbpri40.seq
 188758513     gbpri41.seq
 249983738     gbpri42.seq
 249983023     gbpri43.seq
 249998112     gbpri44.seq
 249997761     gbpri45.seq
 233856803     gbpri46.seq
 249956042     gbpri5.seq
 249819981     gbpri6.seq
 249962258     gbpri7.seq
 249970204     gbpri8.seq
 249935851     gbpri9.seq
    344694     gbrel.txt
 249776884     gbrod1.seq
 249888550     gbrod10.seq
  69705195     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249939922     gbrod18.seq
 249999354     gbrod19.seq
 249776647     gbrod2.seq
   5744990     gbrod20.seq
 250000039     gbrod21.seq
 249878655     gbrod22.seq
 190756435     gbrod23.seq
 249998400     gbrod24.seq
 249993317     gbrod25.seq
 249933161     gbrod26.seq
 249877526     gbrod27.seq
 249999449     gbrod28.seq
 249991486     gbrod29.seq
 249871455     gbrod3.seq
 249999695     gbrod30.seq
  49224469     gbrod31.seq
 249782177     gbrod4.seq
 249857866     gbrod5.seq
 249911265     gbrod6.seq
 249860680     gbrod7.seq
 249828463     gbrod8.seq
 249985052     gbrod9.seq
 249996830     gbsts1.seq
 249997655     gbsts10.seq
 210923828     gbsts11.seq
 249996524     gbsts12.seq
 249997430     gbsts13.seq
 249998689     gbsts14.seq
 249998468     gbsts15.seq
  24537594     gbsts16.seq
 249999107     gbsts17.seq
 249997705     gbsts18.seq
 249999642     gbsts19.seq
 249999038     gbsts2.seq
 149726286     gbsts20.seq
 250000160     gbsts3.seq
 249996269     gbsts4.seq
  39572975     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249997893     gbsts9.seq
 249998002     gbsyn1.seq
 249996166     gbsyn2.seq
 249955700     gbsyn3.seq
 249975743     gbsyn4.seq
 249952424     gbsyn5.seq
 249950871     gbsyn6.seq
 189729593     gbsyn7.seq
 249998303     gbtsa1.seq
  60152536     gbtsa10.seq
 249996588     gbtsa100.seq
 226769068     gbtsa101.seq
 249998448     gbtsa102.seq
 250000236     gbtsa103.seq
 249999226     gbtsa104.seq
 249999184     gbtsa105.seq
 249998732     gbtsa106.seq
   1347714     gbtsa107.seq
 249998403     gbtsa108.seq
 249999879     gbtsa109.seq
 249997036     gbtsa11.seq
 249998407     gbtsa110.seq
 220793968     gbtsa111.seq
 249995782     gbtsa112.seq
 250000119     gbtsa113.seq
 249997372     gbtsa114.seq
 249999805     gbtsa115.seq
 249998375     gbtsa116.seq
 249999925     gbtsa117.seq
 145172904     gbtsa118.seq
 249999536     gbtsa119.seq
 249996246     gbtsa12.seq
 249998915     gbtsa120.seq
 250000174     gbtsa121.seq
 249999584     gbtsa122.seq
 249997105     gbtsa123.seq
 196200322     gbtsa124.seq
 249999600     gbtsa125.seq
 249997177     gbtsa126.seq
 249997962     gbtsa127.seq
 249998551     gbtsa128.seq
 132390455     gbtsa129.seq
 249998875     gbtsa13.seq
 249995766     gbtsa130.seq
 249998592     gbtsa131.seq
 249997954     gbtsa132.seq
 249998165     gbtsa133.seq
  38380736     gbtsa134.seq
 249997812     gbtsa135.seq
 249998297     gbtsa136.seq
 249997389     gbtsa137.seq
 250000156     gbtsa138.seq
 249997003     gbtsa139.seq
 249999728     gbtsa14.seq
 249998847     gbtsa140.seq
 249999963     gbtsa141.seq
   9419233     gbtsa142.seq
 249998152     gbtsa143.seq
 249994438     gbtsa144.seq
 249997230     gbtsa145.seq
 249998645     gbtsa146.seq
 129708395     gbtsa147.seq
 249999164     gbtsa15.seq
 249998961     gbtsa16.seq
 119262843     gbtsa17.seq
 249998989     gbtsa18.seq
 249996697     gbtsa19.seq
 249997872     gbtsa2.seq
 250000256     gbtsa20.seq
 250000004     gbtsa21.seq
 176116574     gbtsa22.seq
 249999624     gbtsa23.seq
 249998425     gbtsa24.seq
 249999518     gbtsa25.seq
 249998454     gbtsa26.seq
 249999704     gbtsa27.seq
 249997373     gbtsa28.seq
  41990985     gbtsa29.seq
 249998023     gbtsa3.seq
 249999943     gbtsa30.seq
 249997667     gbtsa31.seq
 249998332     gbtsa32.seq
 249997293     gbtsa33.seq
 250000199     gbtsa34.seq
 249998422     gbtsa35.seq
 249998637     gbtsa36.seq
  32471810     gbtsa37.seq
 249997659     gbtsa38.seq
 250000158     gbtsa39.seq
 249998905     gbtsa4.seq
 250000015     gbtsa40.seq
 249998675     gbtsa41.seq
  76090011     gbtsa42.seq
 249998923     gbtsa43.seq
 249998706     gbtsa44.seq
 249998710     gbtsa45.seq
 249999373     gbtsa46.seq
 142739968     gbtsa47.seq
 249999615     gbtsa48.seq
 250000263     gbtsa49.seq
 150834352     gbtsa5.seq
 249998054     gbtsa50.seq
 249998672     gbtsa51.seq
 249998887     gbtsa52.seq
 249997945     gbtsa53.seq
 249998700     gbtsa54.seq
 245108339     gbtsa55.seq
 249998676     gbtsa56.seq
 249997805     gbtsa57.seq
 249999758     gbtsa58.seq
 249998991     gbtsa59.seq
 250000053     gbtsa6.seq
 249997663     gbtsa60.seq
 249997606     gbtsa61.seq
 232800544     gbtsa62.seq
 249999409     gbtsa63.seq
 249999342     gbtsa64.seq
 249998820     gbtsa65.seq
 249998552     gbtsa66.seq
 249996484     gbtsa67.seq
 249998810     gbtsa68.seq
 181457818     gbtsa69.seq
 250000072     gbtsa7.seq
 249999943     gbtsa70.seq
 249998189     gbtsa71.seq
 249998585     gbtsa72.seq
 249998484     gbtsa73.seq
 249998659     gbtsa74.seq
 102484631     gbtsa75.seq
 249998629     gbtsa76.seq
 249999030     gbtsa77.seq
 249999380     gbtsa78.seq
 249997717     gbtsa79.seq
 250000052     gbtsa8.seq
 250000237     gbtsa80.seq
  40935574     gbtsa81.seq
 249999631     gbtsa82.seq
 249997623     gbtsa83.seq
 249998061     gbtsa84.seq
 249999918     gbtsa85.seq
 200921540     gbtsa86.seq
 249994299     gbtsa87.seq
 249999343     gbtsa88.seq
 249998872     gbtsa89.seq
 249997923     gbtsa9.seq
 249999227     gbtsa90.seq
 249996638     gbtsa91.seq
 249997682     gbtsa92.seq
 250000194     gbtsa93.seq
  98484102     gbtsa94.seq
 249999742     gbtsa95.seq
 249999761     gbtsa96.seq
 249998863     gbtsa97.seq
 250000023     gbtsa98.seq
 249999533     gbtsa99.seq
    550046     gbuna1.seq
 249999078     gbvrl1.seq
 249958602     gbvrl10.seq
 249991268     gbvrl11.seq
 250000030     gbvrl12.seq
 186448982     gbvrl13.seq
 249994198     gbvrl14.seq
 249985455     gbvrl15.seq
 249996685     gbvrl16.seq
 249998689     gbvrl17.seq
 201903787     gbvrl18.seq
 249990362     gbvrl19.seq
 250000025     gbvrl2.seq
 249996314     gbvrl20.seq
 249998196     gbvrl21.seq
 249999433     gbvrl22.seq
 126575816     gbvrl23.seq
 249996760     gbvrl24.seq
 249997469     gbvrl25.seq
 249998747     gbvrl26.seq
 249998423     gbvrl27.seq
 249996652     gbvrl28.seq
   9445228     gbvrl29.seq
 249998701     gbvrl3.seq
 249996792     gbvrl4.seq
 249993673     gbvrl5.seq
  29534352     gbvrl6.seq
 249997871     gbvrl7.seq
 249995212     gbvrl8.seq
 249995160     gbvrl9.seq
 249960259     gbvrt1.seq
 249845613     gbvrt10.seq
 249984441     gbvrt11.seq
 162886552     gbvrt12.seq
 249944896     gbvrt13.seq
 249978626     gbvrt14.seq
 249946089     gbvrt15.seq
 249999981     gbvrt16.seq
 249999116     gbvrt17.seq
 249998426     gbvrt18.seq
  90245767     gbvrt19.seq
 249847198     gbvrt2.seq
 249989136     gbvrt20.seq
 249999038     gbvrt21.seq
 249996646     gbvrt22.seq
 249997135     gbvrt23.seq
 250000219     gbvrt24.seq
  88240676     gbvrt25.seq
 249996751     gbvrt26.seq
 249997609     gbvrt27.seq
 249998924     gbvrt28.seq
 249997887     gbvrt29.seq
 249998683     gbvrt3.seq
 249999906     gbvrt30.seq
 204087896     gbvrt31.seq
 249999300     gbvrt4.seq
 150374258     gbvrt5.seq
 249997452     gbvrt6.seq
 249996459     gbvrt7.seq
 249805990     gbvrt8.seq
 249903060     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63962      86081028
BCT10        6838       96099579
BCT100       135        104808719
BCT101       67         112963475
BCT102       3935       105455059
BCT103       5656       104656677
BCT104       39913      44111843
BCT105       71135      76241105
BCT106       3700       109848341
BCT107       4201       110474544
BCT108       6532       108963945
BCT109       66485      80250883
BCT11        66         116730258
BCT110       74755      78666760
BCT111       75635      78547886
BCT112       71891      79712193
BCT113       63390      84698790
BCT114       22262      43511659
BCT12        74         112572581
BCT13        110        114781209
BCT14        61         114342630
BCT15        7676       117587993
BCT16        8482       10184194
BCT17        53935      85395991
BCT18        93         110189094
BCT19        143        97370339
BCT2         19378      104721436
BCT20        58         112869568
BCT21        52         109549606
BCT22        46         112848421
BCT23        57         112994744
BCT24        66         108817610
BCT25        36         96325907
BCT26        40         106881287
BCT27        58         105533856
BCT28        74         111675186
BCT29        55         110045255
BCT3         48         110803900
BCT30        63         106845575
BCT31        55         109391288
BCT32        53         108650404
BCT33        46         110496749
BCT34        95         109522868
BCT35        58         106383536
BCT36        67         109486091
BCT37        125        110095719
BCT38        37         71643089
BCT39        200        111474100
BCT4         60         109207734
BCT40        54         111189314
BCT41        35         108859141
BCT42        59         107860764
BCT43        56         105257887
BCT44        45         109560296
BCT45        74         109517239
BCT46        63         107793781
BCT47        44         108985775
BCT48        59         109351725
BCT49        73         107282687
BCT5         36140      99065296
BCT50        87         110422444
BCT51        1          4316707
BCT52        67         109336234
BCT53        60         104664634
BCT54        53         103112814
BCT55        56         108908758
BCT56        58         107145869
BCT57        57         111394309
BCT58        62         107729562
BCT59        62         104168872
BCT6         2185       2893946
BCT60        68         109676809
BCT61        40         114440980
BCT62        74         109870437
BCT63        53         108383484
BCT64        63         112440937
BCT65        17         12922018
BCT66        43         108446257
BCT67        49         114265418
BCT68        67         111168592
BCT69        47         110446428
BCT7         39034      85133211
BCT70        54         113959265
BCT71        108        111454104
BCT72        63         106743596
BCT73        82         108955714
BCT74        63         116455996
BCT75        54         115710032
BCT76        64         116970930
BCT77        45         111009427
BCT78        23         52499759
BCT79        61         115961577
BCT8         5504       96546226
BCT80        63         113893655
BCT81        44         109573093
BCT82        67         110418313
BCT83        43         107373471
BCT84        56         108101646
BCT85        62         111230179
BCT86        81         107876058
BCT87        228        94923590
BCT88        327        30405177
BCT89        1589       2511877
BCT9         13772      81354333
BCT90        3180       5275409
BCT91        6346       7804593
BCT92        12648      15077034
BCT93        25619      27729818
BCT94        50524      54036309
BCT95        76002      77712655
BCT96        71300      76842190
BCT97        10178      95018948
BCT98        5443       100113517
BCT99        3168       107675130
ENV1         92622      71865747
ENV10        93141      72878564
ENV11        82348      86654140
ENV12        21750      18597919
ENV13        84735      80838450
ENV14        118359     43039383
ENV15        89204      77152573
ENV16        96463      67762668
ENV17        96091      63295409
ENV18        109816     66809211
ENV19        121935     64659450
ENV2         96886      69249554
ENV20        61091      82480060
ENV21        70040      85924755
ENV22        90596      74881364
ENV23        127000     36593750
ENV24        122969     29005551
ENV25        82094      18866859
ENV26        123109     49770398
ENV27        97808      67164566
ENV28        115093     56544138
ENV29        136122     52767325
ENV3         80465      77513313
ENV30        108155     60800808
ENV31        94581      66449685
ENV32        4204       5735443
ENV33        62536      84995133
ENV34        88894      73357412
ENV35        102578     44146186
ENV36        96893      56164626
ENV37        70793      54817894
ENV38        111204     47238824
ENV39        101010     61191961
ENV4         81497      83095901
ENV40        106845     61728334
ENV41        63551      90721891
ENV42        72567      78873360
ENV43        62027      84269229
ENV44        12822      17450150
ENV45        70538      78327816
ENV46        108110     49651572
ENV47        112484     56283950
ENV48        104683     61452443
ENV49        79077      40855278
ENV5         89662      79128348
ENV50        100706     44111563
ENV51        42822      53354069
ENV52        41980      54594330
ENV53        57618      57104441
ENV54        96884      61099959
ENV55        32169      18217070
ENV56        92147      66865222
ENV57        81156      71713292
ENV58        82461      72032540
ENV59        86900      68932338
ENV6         89236      83922866
ENV60        85218      72581793
ENV61        5164       1625090
ENV62        109954     46118424
ENV63        90410      60761418
ENV64        91957      62162239
ENV65        78102      75569596
ENV66        88290      63590670
ENV67        9814       7976753
ENV7         48630      17775971
ENV8         131425     31030486
ENV9         86254      70388166
EST1         158915     61570508
EST10        167040     71930425
EST100       234596     142333128
EST101       237741     125214266
EST102       188590     103916303
EST103       186089     102498118
EST104       107455     74182142
EST105       160241     119780721
EST106       172254     105453804
EST107       135069     84912340
EST108       64416      24039677
EST109       63774      22429611
EST11        169762     74127463
EST110       64301      23295817
EST111       64312      27059903
EST112       64823      23114625
EST113       65041      24780944
EST114       63924      27188214
EST115       64306      26427027
EST116       64500      27444826
EST117       64330      25259281
EST118       61689      34876761
EST119       142835     68812150
EST12        166530     69978668
EST120       163148     85878076
EST121       176074     92855602
EST122       149371     96416074
EST123       156198     91778416
EST124       119368     77679092
EST125       189228     90742027
EST126       156221     83079001
EST127       157047     84289857
EST128       156233     84592909
EST129       151836     85083166
EST13        73409      35099785
EST130       172618     92656321
EST131       182609     116589948
EST132       203118     102670976
EST133       159011     87326513
EST134       163307     82848749
EST135       141766     83400224
EST136       145219     89825063
EST137       101661     54090910
EST138       172788     97571950
EST139       245368     113343252
EST14        217312     108936476
EST140       154711     83476919
EST141       166877     92001746
EST142       150835     88400521
EST143       133045     80989467
EST144       154140     97184220
EST145       156449     85704089
EST146       124116     63217344
EST147       121084     64837104
EST148       127317     58115375
EST149       126897     51267349
EST15        168881     105417583
EST150       128337     51097111
EST151       118030     44057356
EST152       163636     82591166
EST153       176185     73802638
EST154       162441     110181611
EST155       199762     122589154
EST156       214307     121791034
EST157       175385     97179799
EST158       154568     108152798
EST159       141991     94974667
EST16        178883     112616285
EST160       154506     96207203
EST161       157665     82562397
EST162       139085     78348439
EST163       167356     93072227
EST164       73046      45158285
EST165       149959     91721937
EST166       191387     110044266
EST167       145809     84012802
EST168       143187     72573482
EST169       148716     86868237
EST17        195684     112874624
EST170       190918     104858982
EST171       156624     96024182
EST172       168602     82342282
EST173       125044     86521088
EST174       169811     99516718
EST175       173021     100600350
EST176       122773     68053207
EST177       157060     90373461
EST178       37032      21498531
EST179       169726     102594150
EST18        190469     121547775
EST180       180437     118949157
EST181       143081     116867813
EST182       194732     99587917
EST183       153346     101872210
EST184       154467     102214347
EST185       141782     82023774
EST186       175251     70741231
EST187       150684     85302903
EST188       158199     98971373
EST189       154600     95969103
EST19        159551     114257029
EST190       138837     82362663
EST191       166756     100957685
EST192       145563     93169884
EST193       129238     90350734
EST194       144339     88210025
EST195       135687     88342215
EST196       129834     92814779
EST197       162594     86773903
EST198       173953     95603331
EST199       173384     96524955
EST2         161832     61542648
EST20        186410     99306817
EST200       171663     95213841
EST201       168867     95309503
EST202       171370     95652951
EST203       173215     95037714
EST204       173937     95725547
EST205       26349      14290377
EST206       188652     105150015
EST207       204744     104584208
EST208       172248     101984201
EST209       180080     101624597
EST21        216900     106100192
EST210       201597     123107546
EST211       193336     111660838
EST212       193386     123590630
EST213       160688     105699262
EST214       218395     142350505
EST215       236253     113740174
EST216       143458     102362065
EST217       162298     109338427
EST218       147472     94968808
EST219       177360     98392210
EST22        199033     66290949
EST220       189924     118104830
EST221       111613     87617790
EST222       134797     121546193
EST223       159814     92676034
EST224       147985     94955018
EST225       194393     107786084
EST226       166717     103980723
EST227       133053     91805759
EST228       139554     103503203
EST229       122005     88170132
EST23        141210     40147507
EST230       93015      62525747
EST231       144750     89814924
EST232       132133     93844771
EST233       142209     101236725
EST234       120299     86745356
EST235       125464     84285493
EST236       152794     105512994
EST237       160480     115781724
EST238       118183     122225079
EST239       147965     88916799
EST24        103792     28096129
EST240       182772     118406079
EST241       150823     92646649
EST242       170839     108015854
EST243       166443     121652342
EST244       147402     106897631
EST245       10048      7188775
EST246       151655     100093494
EST247       206481     97814935
EST248       197249     110504045
EST249       146673     91271474
EST25        121584     50845983
EST250       220509     24591462
EST251       220742     90196028
EST252       164692     118565055
EST253       177320     103373788
EST254       160955     107388637
EST255       174782     114830849
EST256       157124     114255400
EST257       101789     56736758
EST258       185315     97818880
EST259       177012     102292089
EST26        213498     97009751
EST260       165937     121344187
EST261       210470     102256156
EST262       269366     117319814
EST263       214437     122815348
EST264       182399     44246362
EST265       240164     106915659
EST266       174888     100598304
EST267       166379     104462571
EST268       93632      57808841
EST269       163955     113419660
EST27        218818     110028409
EST270       201500     103888007
EST271       152034     104581466
EST272       197932     116769852
EST273       195358     52751195
EST274       210329     39353913
EST275       182336     101484668
EST276       164394     115987676
EST277       189831     115480222
EST278       180210     107290681
EST279       160317     104535654
EST28        190242     88578884
EST280       106416     40671811
EST281       147567     85587068
EST282       116845     78117880
EST283       157506     106374585
EST284       244194     39085353
EST285       263887     24180614
EST286       171415     88568388
EST287       166681     109383090
EST288       156002     102650283
EST289       149827     93092054
EST29        158120     68950083
EST290       256990     40299212
EST291       178902     93864551
EST292       68627      49365196
EST293       192085     109367354
EST294       144690     79403243
EST295       178728     121718271
EST296       189079     110668798
EST297       151687     112638918
EST298       189847     105273271
EST299       178132     99296284
EST3         153582     54412684
EST30        171834     69752616
EST300       172467     112395645
EST301       188937     63223544
EST302       187280     68497797
EST303       187734     72884256
EST304       130647     48239217
EST305       192237     88841726
EST306       179866     125331059
EST307       160613     94488705
EST308       154549     91305074
EST309       128009     97494977
EST31        148799     63213563
EST310       148234     98973648
EST311       162305     99173234
EST312       165987     92675372
EST313       169465     103382431
EST314       150429     96760683
EST315       150117     101627445
EST316       164313     107982834
EST317       153447     106072654
EST318       178341     149547030
EST319       172741     115076689
EST32        168141     75965869
EST320       140527     74589122
EST321       144562     98668081
EST322       147151     101618268
EST323       134194     90188917
EST324       148449     98675802
EST325       147217     100291802
EST326       177602     112848718
EST327       153433     83482290
EST328       150359     86425577
EST329       149930     104540742
EST33        173523     66275945
EST330       154057     97359845
EST331       81437      48496845
EST332       143333     91122057
EST333       141556     89158013
EST334       203397     110748102
EST335       138080     75351133
EST336       92264      54939453
EST337       129514     85213421
EST338       137061     87013317
EST339       125393     80371572
EST34        123790     43872598
EST340       157523     84698907
EST341       216902     84808042
EST342       171733     87015816
EST343       170124     103322074
EST344       166078     98762586
EST345       86295      57525047
EST346       132576     88318663
EST347       135764     88400242
EST348       185391     121456784
EST349       160450     97050146
EST35        97390      29902697
EST350       157993     80495728
EST351       186663     127088294
EST352       117134     81203388
EST353       73311      44112887
EST354       136953     75362526
EST355       130187     78034327
EST356       147373     58328955
EST357       158696     32261168
EST358       158521     32655531
EST359       181766     103455730
EST36        97799      30571487
EST360       16329      11915795
EST361       226476     117668490
EST362       250995     114583271
EST363       201899     104350223
EST364       146865     94734486
EST365       135866     87092049
EST366       144543     86528305
EST367       182183     113072610
EST368       225262     81967249
EST369       191433     97318940
EST37        96709      29352089
EST370       211667     119279260
EST371       158105     81297565
EST372       200144     124779694
EST373       161772     79447502
EST374       178282     101413651
EST375       154089     99838055
EST376       192577     134859656
EST377       175222     136620873
EST378       171337     115053644
EST379       163944     97925683
EST38        98625      29824331
EST380       179847     112099253
EST381       181892     102292308
EST382       204544     114346123
EST383       116349     58365495
EST384       196053     123081216
EST385       192722     127039085
EST386       195599     130747569
EST387       214176     134334492
EST388       219158     131430233
EST389       198695     160105013
EST39        99394      31255592
EST390       213847     152707263
EST391       188787     111646567
EST392       184070     99286390
EST393       171595     60643557
EST394       103870     7940680
EST395       157591     13586764
EST396       157734     28607354
EST397       158861     31845433
EST398       158625     32404453
EST399       148187     83254260
EST4         170772     67082155
EST40        23318      5938239
EST400       179831     105838479
EST401       165604     113876929
EST402       166561     97086144
EST403       154944     107282742
EST404       139546     97238780
EST405       147436     99029195
EST406       164348     108915297
EST407       148486     105615230
EST408       24017      14108376
EST409       180748     107286621
EST41        101055     52959813
EST410       168473     30219676
EST411       164862     62530324
EST412       155027     109417516
EST413       164796     104107587
EST414       158067     98799218
EST415       159169     92056941
EST416       189099     124569559
EST417       144065     95114132
EST418       132502     90774901
EST419       154384     95484820
EST42        119457     50840676
EST420       159286     94858807
EST421       149434     80103900
EST422       164456     96958169
EST423       160270     95033754
EST424       176950     106627886
EST425       139798     87732502
EST426       107517     75175957
EST427       81449      62758211
EST428       100458     66910684
EST429       156210     86685526
EST43        165635     91600986
EST430       122969     75342565
EST431       142194     90992126
EST432       140710     83194349
EST433       158710     96020842
EST434       156989     85771901
EST435       196048     116815591
EST436       21060      11392277
EST437       126433     83957057
EST438       186922     98255342
EST439       184056     95740034
EST44        170295     72395653
EST440       155504     88816781
EST441       157735     86943439
EST442       216301     126118208
EST443       180749     110074178
EST444       172650     104227943
EST445       142670     104671950
EST446       138417     89173429
EST447       148480     79050008
EST448       200534     86003561
EST449       68232      30783161
EST45        167156     84760833
EST450       206498     85997664
EST451       201965     83076632
EST452       186658     100959036
EST453       181082     107879202
EST454       189531     109860436
EST455       189760     116687311
EST456       195416     110375662
EST457       187057     87140828
EST458       197129     101539225
EST459       204662     120353382
EST46        168582     86860498
EST460       139946     86104579
EST461       199174     123562553
EST462       163140     98110694
EST463       142782     107791159
EST464       156523     87035152
EST465       191175     98330858
EST466       142000     76218950
EST467       154970     84631721
EST468       186350     98493188
EST469       165752     107989767
EST47        163166     87791369
EST470       180097     108895426
EST471       172476     126986889
EST472       173271     82774312
EST473       22036      7795018
EST474       169355     59850417
EST475       104744     41715427
EST48        162204     83350724
EST49        160162     91072799
EST5         168868     66162356
EST50        161408     87978365
EST51        157201     98974757
EST52        159509     69730634
EST53        145816     81615309
EST54        78354      50777515
EST55        166973     69852473
EST56        164731     74783711
EST57        164273     90667037
EST58        159198     97205660
EST59        156474     101427902
EST6         171441     66899476
EST60        164517     98835554
EST61        160040     107925960
EST62        170997     81605362
EST63        173010     92280530
EST64        155521     84240106
EST65        148886     81838988
EST66        158784     98509206
EST67        136595     77344164
EST68        149501     91702539
EST69        194741     107986620
EST7         169838     72844527
EST70        183136     96177335
EST71        220941     121165187
EST72        186831     111675977
EST73        203091     120791471
EST74        164877     90758149
EST75        132572     60455409
EST76        138718     68349853
EST77        156394     95922240
EST78        157101     98811248
EST79        142171     78570635
EST8         179253     72758387
EST80        49911      23223483
EST81        163910     100395371
EST82        211852     114695498
EST83        223578     123704784
EST84        200446     94217006
EST85        210848     93351019
EST86        162326     92763612
EST87        144175     87006658
EST88        164224     80924763
EST89        157909     79882233
EST9         168741     69435082
EST90        152782     102192942
EST91        152223     88875695
EST92        135672     87370989
EST93        155468     112619379
EST94        140686     103037963
EST95        141495     101211548
EST96        141031     97546087
EST97        145938     81198683
EST98        179958     111071714
EST99        220953     133969634
GSS1         200001     87585749
GSS10        131936     60178674
GSS100       145362     114337340
GSS101       141643     116113759
GSS102       143263     116656493
GSS103       167236     128919983
GSS104       149785     82570423
GSS105       191512     120843231
GSS106       167626     112043039
GSS107       195980     114602251
GSS108       203829     133933692
GSS109       209651     138437459
GSS11        137117     74095275
GSS110       207829     140524252
GSS111       206109     142610742
GSS112       205238     143755873
GSS113       205328     143725894
GSS114       202140     146619573
GSS115       182323     140506346
GSS116       20919      12270693
GSS117       132842     84047557
GSS118       169508     79978306
GSS119       183284     78712481
GSS12        147874     75942002
GSS120       169941     147924970
GSS121       177674     120411780
GSS122       179754     146215341
GSS123       187296     120330916
GSS124       187054     139554050
GSS125       192011     126823925
GSS126       191940     92778637
GSS127       167954     157249601
GSS128       162805     113503816
GSS129       63368      38560942
GSS13        145428     68513548
GSS130       171035     155494570
GSS131       172357     154451587
GSS132       172394     155154911
GSS133       173791     154156510
GSS134       171955     154868504
GSS135       180242     138335567
GSS136       178128     146380016
GSS137       165402     118896908
GSS138       189569     95359844
GSS139       265793     41895333
GSS14        169560     84512016
GSS140       265731     40965381
GSS141       81236      12474441
GSS142       254308     58601633
GSS143       260127     56236960
GSS144       190605     86336741
GSS145       196014     65967693
GSS146       186151     147935566
GSS147       182778     151058468
GSS148       167949     155157420
GSS149       171117     157877984
GSS15        161140     97734025
GSS150       234922     72866749
GSS151       228011     79342953
GSS152       136251     57412096
GSS153       208402     55977130
GSS154       157113     96136689
GSS155       196081     122152910
GSS156       173123     159767551
GSS157       190509     161874529
GSS158       187321     141328364
GSS159       212850     131908813
GSS16        172812     87071982
GSS160       219642     140553491
GSS161       199775     120280437
GSS162       87041      63875275
GSS163       83570      62792054
GSS164       103516     48561854
GSS165       68745      58550093
GSS166       8121       7360725
GSS167       68591      57924394
GSS168       69224      56650935
GSS169       69460      56187403
GSS17        183230     113225679
GSS170       71202      55998401
GSS171       68561      51865315
GSS172       75915      58209304
GSS173       86719      74437329
GSS174       81366      44383585
GSS175       92208      44999174
GSS176       64724      48331809
GSS177       77364      61293357
GSS178       69657      58696354
GSS179       67712      62704325
GSS18        192345     114314348
GSS180       61915      53366768
GSS181       95634      42961809
GSS182       21181      4939211
GSS183       112938     70877522
GSS184       822        559311
GSS185       23226      28867035
GSS186       109092     70683886
GSS187       84492      34641045
GSS188       35807      22218610
GSS189       103304     62490220
GSS19        115212     52832105
GSS190       102329     63761256
GSS191       104268     67656826
GSS192       82099      41276456
GSS193       83102      54651503
GSS194       95684      61343347
GSS195       107373     78577773
GSS196       106314     76646515
GSS197       106101     79982459
GSS198       104005     80017874
GSS199       75971      50780596
GSS2         182168     92121551
GSS20        181772     101757754
GSS200       104923     63514380
GSS201       109868     66415305
GSS202       105989     59192789
GSS203       68149      37285003
GSS204       69272      38618302
GSS205       37892      18174795
GSS206       85481      46023427
GSS207       96935      55799967
GSS208       95009      49632000
GSS209       95897      55649530
GSS21        166209     114177136
GSS210       42678      23961360
GSS211       114055     43442995
GSS212       116422     39251295
GSS213       108546     52732208
GSS214       108722     67128836
GSS215       101583     78242275
GSS216       56617      33766188
GSS217       95891      36542252
GSS218       95417      37268709
GSS219       96671      35161518
GSS22        169505     97607942
GSS220       94285      39167432
GSS221       37736      17626556
GSS222       103939     66277823
GSS223       94551      61190929
GSS224       95128      60357048
GSS225       94773      60868501
GSS226       75675      70017159
GSS227       80727      68566483
GSS228       32616      33649557
GSS229       83736      28233267
GSS23        187259     126685915
GSS230       84219      27346468
GSS231       84926      25909272
GSS232       14851      4422302
GSS233       16547      7508221
GSS234       92128      59308050
GSS235       88464      46227015
GSS236       93701      50284626
GSS237       88584      48344863
GSS238       6801       3705316
GSS239       90648      56882510
GSS24        194049     130220259
GSS240       89662      61882079
GSS241       88553      63641206
GSS242       89283      62505584
GSS243       9890       7129098
GSS244       87995      63795538
GSS245       90151      62444409
GSS246       94367      59805167
GSS247       74143      62678833
GSS248       84189      78959221
GSS249       83078      80516319
GSS25        177486     105211560
GSS250       71019      53174669
GSS251       114962     62986486
GSS252       109218     55657098
GSS253       107534     52124665
GSS254       99001      44352446
GSS255       109801     49060015
GSS256       97917      46046727
GSS257       73058      72226496
GSS258       77174      72621583
GSS259       92147      71194681
GSS26        185730     107674444
GSS260       24563      18498472
GSS261       92250      71055526
GSS262       85869      83025280
GSS263       83675      87061685
GSS264       82362      86366324
GSS265       87240      67099066
GSS266       90053      72027971
GSS267       90218      71428159
GSS268       75200      48045357
GSS269       94787      57200301
GSS27        169309     149905798
GSS270       93517      59081345
GSS271       93900      58510429
GSS272       94714      57307691
GSS273       83843      51265303
GSS274       104611     69763654
GSS275       105287     75066211
GSS276       110489     69022026
GSS277       108021     71886884
GSS278       110248     69303823
GSS279       69485      45058873
GSS28        190021     146714273
GSS29        150482     105636405
GSS3         174912     87828869
GSS30        192758     132484639
GSS31        15951      10394779
GSS32        195895     127234153
GSS33        216654     116238131
GSS34        218577     113597712
GSS35        219716     112030658
GSS36        213973     121865192
GSS37        198556     156436983
GSS38        194972     146785202
GSS39        197296     73467554
GSS4         167136     85060122
GSS40        184975     97563143
GSS41        189640     125875561
GSS42        171015     159208114
GSS43        8722       5677601
GSS44        183796     100214059
GSS45        172608     121367486
GSS46        182843     123141509
GSS47        188561     120724304
GSS48        75880      66158618
GSS49        171545     101809563
GSS5         53685      31757768
GSS50        167648     103033730
GSS51        167797     102601882
GSS52        181951     120021184
GSS53        183670     115951023
GSS54        180307     122112367
GSS55        186463     112386396
GSS56        188773     135350051
GSS57        177293     103596646
GSS58        193544     118768690
GSS59        179870     130363558
GSS6         161430     84379225
GSS60        12445      11296285
GSS61        172737     138877725
GSS62        161634     111555904
GSS63        161673     111571598
GSS64        158935     107661992
GSS65        156723     129033805
GSS66        170186     142548800
GSS67        178803     116411047
GSS68        202004     126663939
GSS69        193335     110227162
GSS7         165280     79357967
GSS70        243808     125941953
GSS71        161480     107432891
GSS72        157961     118013461
GSS73        162106     124122311
GSS74        162075     124177367
GSS75        173981     108807578
GSS76        191284     140108750
GSS77        18596      11890309
GSS78        196325     124728127
GSS79        169671     110723834
GSS8         165276     88727600
GSS80        198931     130320281
GSS81        209379     89418955
GSS82        190678     95421035
GSS83        133290     93273321
GSS84        145957     117201518
GSS85        139708     116893398
GSS86        142737     113860947
GSS87        144079     119937429
GSS88        141640     115489892
GSS89        111005     92588398
GSS9         138134     67214742
GSS90        149425     122240891
GSS91        147663     117692857
GSS92        143995     113064403
GSS93        142869     115422868
GSS94        144203     119656289
GSS95        148069     121684067
GSS96        147696     117745472
GSS97        146077     121054040
GSS98        146145     120923099
GSS99        146569     120073651
HTC1         25070      27067745
HTC10        70424      71575117
HTC11        72186      70048980
HTC12        25515      31208557
HTC13        66993      60073171
HTC14        68529      69481866
HTC15        41628      26362030
HTC2         16086      36248594
HTC3         16029      36625145
HTC4         16251      35561378
HTC5         15980      40342205
HTC6         16068      37475860
HTC7         53862      31518631
HTC8         31094      19381346
HTC9         60764      77671655
HTG1         1318       188778000
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191233997
HTG104       23         3026945
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191618641
HTG109       1639       191077915
HTG11        4          606452
HTG110       1332       192017007
HTG111       890        129166022
HTG112       1439       190873532
HTG113       1518       189527436
HTG114       1397       176270675
HTG115       1216       154265619
HTG116       1335       175214595
HTG117       1343       189811707
HTG118       1064       185762670
HTG119       715        116217368
HTG12        1452       184004673
HTG120       1510       183444531
HTG121       1182       191173330
HTG122       990        187592865
HTG123       1087       193635107
HTG124       1103       193191452
HTG125       426        79306457
HTG126       1031       189469892
HTG127       1055       192678789
HTG128       1163       191852916
HTG129       1080       192399955
HTG13        875        191786413
HTG130       1084       193090210
HTG131       588        103686357
HTG132       1122       192519796
HTG133       1080       192499490
HTG134       1078       192326016
HTG135       1166       191911933
HTG136       1663       191915445
HTG137       1070       192384273
HTG138       1076       192254928
HTG139       1118       191927332
HTG14        753        191921309
HTG140       1320       189266115
HTG141       651        83291998
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192170442
HTG76        1147       192487651
HTG77        1188       192461752
HTG78        1071       181302309
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93681      48159943
INV10        52671      89339452
INV11        82572      65290903
INV12        65445      51709568
INV13        84572      65935933
INV14        80776      66752947
INV15        78672      66830288
INV16        49154      46374231
INV17        27551      112442539
INV18        9470       141369930
INV19        40798      113844641
INV2         42647      120057392
INV20        77488      56882146
INV21        73395      62859498
INV22        7167       4672847
INV23        22752      127076724
INV24        6          133712559
INV25        56084      100975247
INV26        74355      49606421
INV27        55139      40861113
INV28        78248      56085220
INV29        75490      57898402
INV3         1591       185707895
INV30        78383      61096555
INV31        70859      47563398
INV32        78164      54601396
INV33        77800      56240237
INV34        73307      60908191
INV35        76474      57207360
INV36        49381      85789724
INV4         368        137801648
INV5         64816      84315833
INV6         71296      77307614
INV7         35148      108159674
INV8         29189      32861635
INV9         80284      71517741
MAM1         19452      156947077
MAM2         15819      162671743
MAM3         61798      80007994
MAM4         4141       188036771
MAM5         79577      75021792
MAM6         46024      131726967
MAM7         75671      62646537
MAM8         59241      67796390
PAT1         222550     70114048
PAT10        124409     102499750
PAT100       178198     3385762
PAT101       178185     3385515
PAT102       132610     2848492
PAT103       342935     8573375
PAT104       188806     88519660
PAT105       111348     132068608
PAT106       3850       194703659
PAT107       131292     110979300
PAT108       158599     54826034
PAT109       224689     34110877
PAT11        98821      64201126
PAT110       250080     15844301
PAT111       180710     63637989
PAT112       51659      26087958
PAT113       114176     110461877
PAT114       137664     83263898
PAT115       164207     99296866
PAT116       158793     103369255
PAT117       137503     115011287
PAT118       42311      27994848
PAT119       193712     81686401
PAT12        142051     62828492
PAT120       150217     108404022
PAT121       356051     11379688
PAT122       257211     57607099
PAT123       138161     48226925
PAT124       322021     22795469
PAT125       155639     102753887
PAT126       132727     110696284
PAT127       128341     121313309
PAT128       21664      184390005
PAT129       144888     112900567
PAT13        105886     59872737
PAT130       171997     96403773
PAT131       44618      171217879
PAT132       9167       47581637
PAT133       33645      178334734
PAT134       153558     109675196
PAT135       178705     90913377
PAT136       136049     115324159
PAT137       120392     123342367
PAT138       8527       8992390
PAT139       155429     101473147
PAT14        103627     50159051
PAT140       184764     88815933
PAT141       182409     85292093
PAT142       174403     93928365
PAT143       28829      20461016
PAT144       147929     108545966
PAT145       160945     101973668
PAT146       185311     90980420
PAT147       231649     49265020
PAT148       203540     47701039
PAT149       277765     9659534
PAT15        121155     53309227
PAT150       220401     46464935
PAT151       106912     2885967
PAT152       270386     21672571
PAT153       186719     61208540
PAT154       109755     106072419
PAT155       47594      9566097
PAT156       87280      88188488
PAT157       78380      95559258
PAT158       144977     77776914
PAT159       167627     71290291
PAT16        113124     61269109
PAT160       121399     92989624
PAT161       103110     85216849
PAT162       165699     46236574
PAT163       270022     5130418
PAT164       269978     5129582
PAT165       269978     5129582
PAT166       237888     4519872
PAT167       269396     5118524
PAT168       235462     25562012
PAT169       203694     47165535
PAT17        39196      16252571
PAT170       12091      424545
PAT171       165317     74871979
PAT172       91686      126656173
PAT173       172574     71662477
PAT174       213438     66978573
PAT175       189437     87808835
PAT176       168932     93481241
PAT177       67367      41362212
PAT178       93072      87231074
PAT179       91815      79966559
PAT18        146771     52594264
PAT180       83773      91674866
PAT181       108705     54184635
PAT182       101033     56673421
PAT183       150190     24637668
PAT184       93816      82452709
PAT185       26010      162900357
PAT186       113946     65760783
PAT187       83571      79408867
PAT188       3998       191513255
PAT189       117923     39497070
PAT19        153705     78039102
PAT190       136765     34571633
PAT191       98063      92895273
PAT192       86789      129976514
PAT193       158978     78755289
PAT194       212088     48093832
PAT195       170185     66218432
PAT196       203424     48687193
PAT197       111290     109690335
PAT198       167850     74508497
PAT199       130158     25581290
PAT2         194513     84657431
PAT20        104712     118084998
PAT21        133773     95343235
PAT22        84658      79569499
PAT23        123528     103394407
PAT24        119450     105667379
PAT25        145377     86648214
PAT26        175067     64315752
PAT27        71578      1789450
PAT28        102171     77387698
PAT29        93923      87635969
PAT3         171982     95896546
PAT30        119952     61671400
PAT31        96625      78963843
PAT32        128380     55028321
PAT33        92259      51135603
PAT34        118111     69083196
PAT35        105236     63069110
PAT36        162032     21539329
PAT37        134847     41764388
PAT38        102051     67006829
PAT39        23539      17469732
PAT4         153750     106056419
PAT40        95721      83165220
PAT41        100234     70851403
PAT42        136071     39459525
PAT43        143784     35448202
PAT44        123825     64575866
PAT45        104398     81176714
PAT46        93299      74375876
PAT47        113234     66602624
PAT48        65388      54850684
PAT49        135191     107998311
PAT5         57142      23925643
PAT50        167081     97032801
PAT51        116396     127553842
PAT52        196336     76726384
PAT53        80312      127991532
PAT54        27631      180872621
PAT55        185408     93066629
PAT56        274259     6856475
PAT57        129447     31627433
PAT58        161320     77719729
PAT59        92772      89353191
PAT6         170642     91909261
PAT60        106450     74811319
PAT61        122363     64031482
PAT62        67530      30318703
PAT63        70749      109767380
PAT64        87947      82758205
PAT65        92970      78936927
PAT66        93166      72442104
PAT67        93383      75086630
PAT68        115772     60531684
PAT69        102742     9941933
PAT7         154749     88219682
PAT70        175930     10547617
PAT71        171510     10872561
PAT72        171496     10866737
PAT73        99862      86225235
PAT74        99         196466297
PAT75        67         192869889
PAT76        103        195600591
PAT77        1137       196318757
PAT78        97599      5772236
PAT79        151009     9636510
PAT8         131231     96890419
PAT80        151022     9621259
PAT81        151024     9622125
PAT82        151021     9620837
PAT83        94629      88051226
PAT84        93648      93465421
PAT85        34117      33989618
PAT86        83459      93185861
PAT87        15568      180450145
PAT88        164893     19209787
PAT89        178944     3399936
PAT9         129233     101151638
PAT90        177434     3371246
PAT91        175305     3330795
PAT92        101398     1926562
PAT93        169167     12412170
PAT94        178699     3395281
PAT95        178691     3395129
PAT96        178677     3394863
PAT97        140784     2674896
PAT98        178683     3394977
PAT99        178342     3388498
PHG1         5947       104124512
PHG2         2232       23785854
PLN1         59870      93455128
PLN10        4121       3417172
PLN11        73038      75854182
PLN12        37341      49227005
PLN13        40214      65558311
PLN14        22607      123747725
PLN15        21108      99979363
PLN16        17550      144652121
PLN17        17609      146073091
PLN18        17535      146188952
PLN19        24716      127531452
PLN2         65977      86740934
PLN20        5973       146559791
PLN21        1287       167995407
PLN22        7141       162935529
PLN23        14145      11926915
PLN24        67044      69828216
PLN25        30027      32237040
PLN26        76820      76458236
PLN27        64743      80327381
PLN28        61775      100562331
PLN29        76         95744252
PLN3         1462       168070327
PLN30        3          61743175
PLN31        54         123504479
PLN32        11479      135284160
PLN33        16231      136001589
PLN34        71486      78720423
PLN35        75196      78294304
PLN36        77459      35239508
PLN37        80320      71618302
PLN38        77755      75817266
PLN39        80063      70416067
PLN4         1631       182775955
PLN40        82075      75383755
PLN41        58485      32276571
PLN42        98697      55001383
PLN43        82382      68545039
PLN44        45267      99008056
PLN45        15539      129171791
PLN46        32908      123933972
PLN47        66298      79960343
PLN48        81180      72372283
PLN49        64900      80787474
PLN5         1938       192538036
PLN50        23375      112590665
PLN51        49680      93766249
PLN52        85000      61648624
PLN53        77432      50485595
PLN54        76891      71801642
PLN55        71306      83582256
PLN56        76506      68092148
PLN57        70723      75667569
PLN58        76553      64881130
PLN59        78065      63108467
PLN6         1653       194536101
PLN60        74710      70879934
PLN61        89356      47605320
PLN62        72054      68661011
PLN63        68739      69587851
PLN64        63570      82649015
PLN65        31834      57500698
PLN7         1699       193909746
PLN8         20041      149663644
PLN9         75419      79016441
PRI1         23024      59718385
PRI10        1262       179160453
PRI11        819        98726530
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         20185      146917278
PRI20        1737       191814810
PRI21        2630       189824612
PRI22        6774       182696989
PRI23        14325      32661145
PRI24        31572      84623832
PRI25        61951      78208013
PRI26        31350      70628098
PRI27        8758       172032991
PRI28        2266       191526296
PRI29        1666       190957810
PRI3         1435       175018079
PRI30        2074       192186893
PRI31        2197       191169864
PRI32        13063      162311426
PRI33        2085       170473464
PRI34        58192      87724690
PRI35        5414       10850199
PRI36        32189      63608729
PRI37        20541      119199459
PRI38        18966      150691220
PRI39        67763      85232288
PRI4         1279       185701003
PRI40        50262      89186651
PRI41        40308      78276393
PRI42        47100      95058311
PRI43        25721      102059997
PRI44        34003      107394991
PRI45        37004      96868745
PRI46        56261      93936360
PRI5         1331       184377339
PRI6         1180       179843578
PRI7         1236       180618801
PRI8         1220       178947741
PRI9         1365       174779923
ROD1         34899      136525419
ROD10        990        181582717
ROD11        265        50364751
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190636468
ROD19        15550      158887048
ROD2         912        175605809
ROD20        1264       2318133
ROD21        20404      157291286
ROD22        1220       193758752
ROD23        936        147576744
ROD24        15500      168688032
ROD25        37955      68986756
ROD26        20901      110928067
ROD27        1538       193229228
ROD28        146522     23269577
ROD29        77696      76201974
ROD3         907        173350346
ROD30        83578      58905254
ROD31        12714      15636807
ROD4         901        173568824
ROD5         919        174466364
ROD6         964        177880700
ROD7         973        179532125
ROD8         975        181220683
ROD9         995        181842358
STS1         85191      36719989
STS10        57907      44420216
STS11        48911      37504044
STS12        57924      43637361
STS13        64256      42838370
STS14        93606      34190384
STS15        104286     26516184
STS16        10144      2748184
STS17        103611     27476228
STS18        86876      34422367
STS19        99699      33374315
STS2         84267      49866896
STS20        55279      21136307
STS3         66824      26334881
STS4         77114      36955161
STS5         8546       5010003
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55715      37766563
SYN1         37312      82415762
SYN2         50310      67238591
SYN3         16403      146957422
SYN4         4596       176617163
SYN5         4593       176451612
SYN6         4602       176547713
SYN7         8900       123908751
TSA1         119977     38112352
TSA10        19782      21876029
TSA100       99391      69728593
TSA101       58738      96465771
TSA102       109175     49378845
TSA103       67047      70017492
TSA104       80456      88837233
TSA105       72181      75576035
TSA106       57294      120580436
TSA107       597        352744
TSA108       106689     67779914
TSA109       93410      83369889
TSA11        134006     34557030
TSA110       98615      76609458
TSA111       88033      68056906
TSA112       85006      59043187
TSA113       80821      64548358
TSA114       81083      77838945
TSA115       99856      58431426
TSA116       94376      41918103
TSA117       77604      56950105
TSA118       38159      36219333
TSA119       64087      65481741
TSA12        60174      19766028
TSA120       62776      67314514
TSA121       62796      68082050
TSA122       83597      81259826
TSA123       77368      53642425
TSA124       52890      45157231
TSA125       78372      34800123
TSA126       74786      67822110
TSA127       81274      78630897
TSA128       74923      64502870
TSA129       40732      33765147
TSA13        62046      77379530
TSA130       87573      70203780
TSA131       88950      68200532
TSA132       84674      76995574
TSA133       76162      80752164
TSA134       12729      10682558
TSA135       82608      57086769
TSA136       82199      67401062
TSA137       67265      79183768
TSA138       91948      67094904
TSA139       85265      76860872
TSA14        108030     40280953
TSA140       70271      95063387
TSA141       93842      74931211
TSA142       3028       2878256
TSA143       81126      73338160
TSA144       77937      75416129
TSA145       78026      74205219
TSA146       89954      61432310
TSA147       49350      38699391
TSA15        98909      60219518
TSA16        98552      47595241
TSA17        49362      16636737
TSA18        85797      70106183
TSA19        120080     38852195
TSA2         113082     41399259
TSA20        135073     34045322
TSA21        61631      79372321
TSA22        41270      56085777
TSA23        70040      97061853
TSA24        99922      57201815
TSA25        109221     51855791
TSA26        103373     51392529
TSA27        101585     54001694
TSA28        101922     46128235
TSA29        14227      8886198
TSA3         109975     40913799
TSA30        66220      59270523
TSA31        92600      67995596
TSA32        93161      62437337
TSA33        79811      86106639
TSA34        99869      49543566
TSA35        113620     34159915
TSA36        95049      68098314
TSA37        12744      7711151
TSA38        94663      35557227
TSA39        77654      35932776
TSA4         111166     47512411
TSA40        106330     43414621
TSA41        113933     45546670
TSA42        29148      20211503
TSA43        105982     50234310
TSA44        100439     54422418
TSA45        94558      62973458
TSA46        83180      83729725
TSA47        63622      25694610
TSA48        90399      71322568
TSA49        97516      54414484
TSA5         76274      23027277
TSA50        60130      105507080
TSA51        87079      65496741
TSA52        78767      70580680
TSA53        83139      72101345
TSA54        82731      72138233
TSA55        68625      90505898
TSA56        90791      66764547
TSA57        75894      84479037
TSA58        71730      73091823
TSA59        68710      60730594
TSA6         111608     58989548
TSA60        84935      78061436
TSA61        85284      78137963
TSA62        70312      97834546
TSA63        85540      69665112
TSA64        85377      51825800
TSA65        102335     68625492
TSA66        87062      58804082
TSA67        103741     57056442
TSA68        73922      73105102
TSA69        78269      44322145
TSA7         87587      57991023
TSA70        89929      79960169
TSA71        90772      69540680
TSA72        78575      53772777
TSA73        79370      56721646
TSA74        96668      62079475
TSA75        36755      32696846
TSA76        89143      76913554
TSA77        96849      56339444
TSA78        110765     44928331
TSA79        96821      58686027
TSA8         103411     71945868
TSA80        65394      96465349
TSA81        13728      13469264
TSA82        95583      57940123
TSA83        93192      44526589
TSA84        89477      62783234
TSA85        77592      74256127
TSA86        50912      62590474
TSA87        77437      80992651
TSA88        77545      54883790
TSA89        84162      38596063
TSA9         108865     60366586
TSA90        76609      52801780
TSA91        67558      69924777
TSA92        64760      74965775
TSA93        88673      55519337
TSA94        47913      25279266
TSA95        74245      86358066
TSA96        80250      75631818
TSA97        84872      72355416
TSA98        77869      83736599
TSA99        94553      52001543
UNA1         265        138571
VRL1         65437      70781784
VRL10        61989      70590997
VRL11        63902      70417769
VRL12        64741      69891904
VRL13        40079      55495570
VRL14        62808      70936775
VRL15        57417      72671458
VRL16        63129      64509202
VRL17        56387      73559680
VRL18        47719      58191651
VRL19        54731      72448379
VRL2         69749      62710884
VRL20        58727      71319626
VRL21        56097      73615492
VRL22        56121      72652342
VRL23        24333      42308687
VRL24        52624      75365858
VRL25        40471      80291323
VRL26        48874      74028874
VRL27        48711      71487652
VRL28        57186      77916677
VRL29        3565       1837259
VRL3         71697      60362141
VRL4         70116      67103276
VRL5         66938      68642236
VRL6         5507       9225753
VRL7         48122      77456264
VRL8         46630      71884477
VRL9         43919      71434770
VRT1         53310      102508015
VRT10        1291       193391461
VRT11        8317       181926800
VRT12        3885       121190212
VRT13        13344      172295744
VRT14        5314       185863555
VRT15        3951       188765078
VRT16        41794      127868957
VRT17        78965      68741349
VRT18        77595      66336136
VRT19        28271      21975075
VRT2         1197       194219142
VRT20        71449      75853238
VRT21        43990      124441356
VRT22        76653      63110455
VRT23        78527      61968712
VRT24        81365      57342331
VRT25        29166      20267646
VRT26        102867     65939617
VRT27        81396      55927815
VRT28        85025      58589517
VRT29        76820      58970346
VRT3         66060      91294170
VRT30        89164      51747162
VRT31        62260      50596810
VRT4         8004       177488620
VRT5         38709      45653728
VRT6         72839      66503465
VRT7         31760      63622129
VRT8         30942      112043548
VRT9         1233       193555871

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 199.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

20473370 17308640578   Homo sapiens
9708910   9984135573   Mus musculus
2190512   6524712232   Rattus norvegicus
2202620   5390647206   Bos taurus
3954149   5075086532   Zea mays
3288927   4889947687   Sus scrofa
1726419   3122148986   Danio rerio
1029510   1463354455   Hordeum vulgare subsp. vulgare
257585    1435237072   Strongylocentrotus purpuratus
1376032   1264604937   Oryza sativa Japonica Group
453837    1256959295   Macaca mulatta
1588296   1249744831   Xenopus (Silurana) tropicalis
1777660   1199383172   Nicotiana tabacum
2337788   1155184393   Arabidopsis thaliana
1783169   1141020853   Triticum aestivum
1261166   1128554084   Drosophila melanogaster
808034    1070124243   Vitis vinifera
217042    1008827115   Pan troglodytes
743986     984058874   Solanum lycopersicum
1457390    953343792   Canis lupus familiaris

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2013

                NCBI-GenBank Flat File Release 199.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         October 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ02).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 199.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Jianli Dai, Francescopaolo di Cello,
	Michel Eschenbrenner, Irene Fang, Michael Fetchko, Linda Frisse,
	Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry, Suzanne Mate,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Ilya Dondoshansky, J. Bradley Holmes, WonHee Jang, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh, Jim Ostell,
	Vasuki Palanigobu, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov,
	Elena Starchenko, Hanzhen Sun, Tatiana Tatusova, Kamen Todorov,
	Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center