Release Notes For GenBank Release 200

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2014

               NCBI-GenBank Flat File Release 200.0

                    Distribution Release Notes

 171123749 loci, 157943793171 bases, from 171123749 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 200.0
1.2 Cutoff Date
1.3 Important Changes in Release 200.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 200.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 200.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 200.0, incorporates data processed by the INSDC databases
as of Wednesday February 12, 2014 at approximately 1:30am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 200.0

1.3.1 Organizational changes

The total number of sequence data files increased by 34 with this release:

  - the BCT division is now composed of 118 files (+4)
  - the CON division is now composed of 242 files (+11)
  - the GSS division is now composed of 284 files (+5)
  - the INV division is now composed of  38 files (+2)
  - the PAT division is now composed of 204 files (+5)
  - the PLN division is now composed of  67 files (+2)
  - the PRI division is now composed of  47 files (+1)
  - the TSA division is now composed of 150 files (+3)
  - the VRT division is now composed of  32 files (+1)

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 121
of the GSS flatfiles in Release 200.0. Consider gbgss164.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2014

                NCBI-GenBank Flat File Release 200.0

                           GSS Sequences (Part 1)

   87039 loci,    63873952 bases, from    87039 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "164" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be phased out (slowly!) at NCBI

  The numeric GI sequence identifier that NCBI assigns to all nucleotide
and protein sequences was first introduced for GenBank Release products
as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for nearly 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who utilize
GIs in their own information systems and analysis pipelines, so it will not be
introduced quickly. You can expect that a great deal of additional detail will
be made available via NCBI's various announcement mechanisms.

  *This* particular announcement is chiefly intended to provide some advance
warning to our users. There _will_ be classes of GenBank sequences that
are not assigned GIs in the not-too-distant future. If GIs are central to
your operations, then it might be appropriate to begin planning a switch to
the use of Accession.Version identifiers instead.

  And in fact, NCBI now has at least one WGS submission for which GIs have
not been assigned, for both the contigs and the scaffolds : ALWZ02.

Here are excerpts of the flatfile representation for the first ALWZ02 contig,
and the 'singleton' scaffold which is constructed from it:

LOCUS       ALWZ020000001            701 bp    DNA     linear   PLN 28-MAY-2013
DEFINITION  Picea glauca contig316_0, whole genome shotgun sequence.
ACCESSION   ALWZ020000001 ALWZ020000000
VERSION     ALWZ020000001.1
DBLINK      BioProject: PRJNA83435
....
ORIGIN      
        1 cgttgtgttg gggcacccaa ccttggtgag gccgtattaa aaagtctacc tccaagccaa
       61 aatttgttct tatccatcct ccaactcgtc tttttgccta gtgctcccct atgtggacgt
      121 tttcgttgtg gaggagtttt tcgtttgggc gcccatcttg cgaactcacc ttgcattgcg
      181 tttggtcgcc caacttgtga acgtgccttg gattgcgttg gggcgcccaa gttgcggacg
      241 tgcggacgtg cctttctttg ccgacatgcc ttgcgtttgc gttgcggacg tgcaatgggg
      301 cccccagctt gctgacgtgc cttgcgttgc gttggggtgc ccaacttgcc gacgtgcctt
      361 gcgttgcgtt ggggcaccca accttggtga ggccgtatta aaaagtctac ctccaagata
      421 aaatttgttc ttatccatcc tctagctctt cttttagcct agtgctccct tgtgtggaca
      481 ttttcgttgt ggatcatttt ttcgtttagg tgcccatctt gcagacaagc cttgcgttgc
      541 gtttgggcac ccatcttgcg gacgcgcctt tcattgcgtt ggggcgccca acgttggtga
      601 ggccgtatta aaaagtctac ctccaagaca aaatttgttc ttatccatcc tccatctcgt
      661 ctttttgcct agtgctccct tgtgtggacg ttttcgttgc g
//

LOCUS       ALWZ02S0000001           701 bp    DNA     linear   CON 14-JUN-2013
DEFINITION  Picea glauca scaffold316, whole genome shotgun sequence.
ACCESSION   ALWZ02S0000001 ALWZ000000000
VERSION     ALWZ02S0000001.1
DBLINK      BioProject: PRJNA83435
....
CONTIG      join(ALWZ020000001.1:1..701)
//


**Note the absence of a GI value on the VERSION line of these two records**

Sample URLs from which ALWZ02 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.1.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.1.gbff.gz

Unannotated WGS projects consisting of many millions of contigs and 
scaffolds represent the first class of records for which GIs are no
longer being assigned. But the practice will ultimately expand to
include other classes of records.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 1982 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct12.seq - Bacterial sequence entries, part 12.
24. gbbct13.seq - Bacterial sequence entries, part 13.
25. gbbct14.seq - Bacterial sequence entries, part 14.
26. gbbct15.seq - Bacterial sequence entries, part 15.
27. gbbct16.seq - Bacterial sequence entries, part 16.
28. gbbct17.seq - Bacterial sequence entries, part 17.
29. gbbct18.seq - Bacterial sequence entries, part 18.
30. gbbct19.seq - Bacterial sequence entries, part 19.
31. gbbct2.seq - Bacterial sequence entries, part 2.
32. gbbct20.seq - Bacterial sequence entries, part 20.
33. gbbct21.seq - Bacterial sequence entries, part 21.
34. gbbct22.seq - Bacterial sequence entries, part 22.
35. gbbct23.seq - Bacterial sequence entries, part 23.
36. gbbct24.seq - Bacterial sequence entries, part 24.
37. gbbct25.seq - Bacterial sequence entries, part 25.
38. gbbct26.seq - Bacterial sequence entries, part 26.
39. gbbct27.seq - Bacterial sequence entries, part 27.
40. gbbct28.seq - Bacterial sequence entries, part 28.
41. gbbct29.seq - Bacterial sequence entries, part 29.
42. gbbct3.seq - Bacterial sequence entries, part 3.
43. gbbct30.seq - Bacterial sequence entries, part 30.
44. gbbct31.seq - Bacterial sequence entries, part 31.
45. gbbct32.seq - Bacterial sequence entries, part 32.
46. gbbct33.seq - Bacterial sequence entries, part 33.
47. gbbct34.seq - Bacterial sequence entries, part 34.
48. gbbct35.seq - Bacterial sequence entries, part 35.
49. gbbct36.seq - Bacterial sequence entries, part 36.
50. gbbct37.seq - Bacterial sequence entries, part 37.
51. gbbct38.seq - Bacterial sequence entries, part 38.
52. gbbct39.seq - Bacterial sequence entries, part 39.
53. gbbct4.seq - Bacterial sequence entries, part 4.
54. gbbct40.seq - Bacterial sequence entries, part 40.
55. gbbct41.seq - Bacterial sequence entries, part 41.
56. gbbct42.seq - Bacterial sequence entries, part 42.
57. gbbct43.seq - Bacterial sequence entries, part 43.
58. gbbct44.seq - Bacterial sequence entries, part 44.
59. gbbct45.seq - Bacterial sequence entries, part 45.
60. gbbct46.seq - Bacterial sequence entries, part 46.
61. gbbct47.seq - Bacterial sequence entries, part 47.
62. gbbct48.seq - Bacterial sequence entries, part 48.
63. gbbct49.seq - Bacterial sequence entries, part 49.
64. gbbct5.seq - Bacterial sequence entries, part 5.
65. gbbct50.seq - Bacterial sequence entries, part 50.
66. gbbct51.seq - Bacterial sequence entries, part 51.
67. gbbct52.seq - Bacterial sequence entries, part 52.
68. gbbct53.seq - Bacterial sequence entries, part 53.
69. gbbct54.seq - Bacterial sequence entries, part 54.
70. gbbct55.seq - Bacterial sequence entries, part 55.
71. gbbct56.seq - Bacterial sequence entries, part 56.
72. gbbct57.seq - Bacterial sequence entries, part 57.
73. gbbct58.seq - Bacterial sequence entries, part 58.
74. gbbct59.seq - Bacterial sequence entries, part 59.
75. gbbct6.seq - Bacterial sequence entries, part 6.
76. gbbct60.seq - Bacterial sequence entries, part 60.
77. gbbct61.seq - Bacterial sequence entries, part 61.
78. gbbct62.seq - Bacterial sequence entries, part 62.
79. gbbct63.seq - Bacterial sequence entries, part 63.
80. gbbct64.seq - Bacterial sequence entries, part 64.
81. gbbct65.seq - Bacterial sequence entries, part 65.
82. gbbct66.seq - Bacterial sequence entries, part 66.
83. gbbct67.seq - Bacterial sequence entries, part 67.
84. gbbct68.seq - Bacterial sequence entries, part 68.
85. gbbct69.seq - Bacterial sequence entries, part 69.
86. gbbct7.seq - Bacterial sequence entries, part 7.
87. gbbct70.seq - Bacterial sequence entries, part 70.
88. gbbct71.seq - Bacterial sequence entries, part 71.
89. gbbct72.seq - Bacterial sequence entries, part 72.
90. gbbct73.seq - Bacterial sequence entries, part 73.
91. gbbct74.seq - Bacterial sequence entries, part 74.
92. gbbct75.seq - Bacterial sequence entries, part 75.
93. gbbct76.seq - Bacterial sequence entries, part 76.
94. gbbct77.seq - Bacterial sequence entries, part 77.
95. gbbct78.seq - Bacterial sequence entries, part 78.
96. gbbct79.seq - Bacterial sequence entries, part 79.
97. gbbct8.seq - Bacterial sequence entries, part 8.
98. gbbct80.seq - Bacterial sequence entries, part 80.
99. gbbct81.seq - Bacterial sequence entries, part 81.
100. gbbct82.seq - Bacterial sequence entries, part 82.
101. gbbct83.seq - Bacterial sequence entries, part 83.
102. gbbct84.seq - Bacterial sequence entries, part 84.
103. gbbct85.seq - Bacterial sequence entries, part 85.
104. gbbct86.seq - Bacterial sequence entries, part 86.
105. gbbct87.seq - Bacterial sequence entries, part 87.
106. gbbct88.seq - Bacterial sequence entries, part 88.
107. gbbct89.seq - Bacterial sequence entries, part 89.
108. gbbct9.seq - Bacterial sequence entries, part 9.
109. gbbct90.seq - Bacterial sequence entries, part 90.
110. gbbct91.seq - Bacterial sequence entries, part 91.
111. gbbct92.seq - Bacterial sequence entries, part 92.
112. gbbct93.seq - Bacterial sequence entries, part 93.
113. gbbct94.seq - Bacterial sequence entries, part 94.
114. gbbct95.seq - Bacterial sequence entries, part 95.
115. gbbct96.seq - Bacterial sequence entries, part 96.
116. gbbct97.seq - Bacterial sequence entries, part 97.
117. gbbct98.seq - Bacterial sequence entries, part 98.
118. gbbct99.seq - Bacterial sequence entries, part 99.
119. gbchg.txt - Accession numbers of entries updated since the previous release.
120. gbcon1.seq - Constructed sequence entries, part 1.
121. gbcon10.seq - Constructed sequence entries, part 10.
122. gbcon100.seq - Constructed sequence entries, part 100.
123. gbcon101.seq - Constructed sequence entries, part 101.
124. gbcon102.seq - Constructed sequence entries, part 102.
125. gbcon103.seq - Constructed sequence entries, part 103.
126. gbcon104.seq - Constructed sequence entries, part 104.
127. gbcon105.seq - Constructed sequence entries, part 105.
128. gbcon106.seq - Constructed sequence entries, part 106.
129. gbcon107.seq - Constructed sequence entries, part 107.
130. gbcon108.seq - Constructed sequence entries, part 108.
131. gbcon109.seq - Constructed sequence entries, part 109.
132. gbcon11.seq - Constructed sequence entries, part 11.
133. gbcon110.seq - Constructed sequence entries, part 110.
134. gbcon111.seq - Constructed sequence entries, part 111.
135. gbcon112.seq - Constructed sequence entries, part 112.
136. gbcon113.seq - Constructed sequence entries, part 113.
137. gbcon114.seq - Constructed sequence entries, part 114.
138. gbcon115.seq - Constructed sequence entries, part 115.
139. gbcon116.seq - Constructed sequence entries, part 116.
140. gbcon117.seq - Constructed sequence entries, part 117.
141. gbcon118.seq - Constructed sequence entries, part 118.
142. gbcon119.seq - Constructed sequence entries, part 119.
143. gbcon12.seq - Constructed sequence entries, part 12.
144. gbcon120.seq - Constructed sequence entries, part 120.
145. gbcon121.seq - Constructed sequence entries, part 121.
146. gbcon122.seq - Constructed sequence entries, part 122.
147. gbcon123.seq - Constructed sequence entries, part 123.
148. gbcon124.seq - Constructed sequence entries, part 124.
149. gbcon125.seq - Constructed sequence entries, part 125.
150. gbcon126.seq - Constructed sequence entries, part 126.
151. gbcon127.seq - Constructed sequence entries, part 127.
152. gbcon128.seq - Constructed sequence entries, part 128.
153. gbcon129.seq - Constructed sequence entries, part 129.
154. gbcon13.seq - Constructed sequence entries, part 13.
155. gbcon130.seq - Constructed sequence entries, part 130.
156. gbcon131.seq - Constructed sequence entries, part 131.
157. gbcon132.seq - Constructed sequence entries, part 132.
158. gbcon133.seq - Constructed sequence entries, part 133.
159. gbcon134.seq - Constructed sequence entries, part 134.
160. gbcon135.seq - Constructed sequence entries, part 135.
161. gbcon136.seq - Constructed sequence entries, part 136.
162. gbcon137.seq - Constructed sequence entries, part 137.
163. gbcon138.seq - Constructed sequence entries, part 138.
164. gbcon139.seq - Constructed sequence entries, part 139.
165. gbcon14.seq - Constructed sequence entries, part 14.
166. gbcon140.seq - Constructed sequence entries, part 140.
167. gbcon141.seq - Constructed sequence entries, part 141.
168. gbcon142.seq - Constructed sequence entries, part 142.
169. gbcon143.seq - Constructed sequence entries, part 143.
170. gbcon144.seq - Constructed sequence entries, part 144.
171. gbcon145.seq - Constructed sequence entries, part 145.
172. gbcon146.seq - Constructed sequence entries, part 146.
173. gbcon147.seq - Constructed sequence entries, part 147.
174. gbcon148.seq - Constructed sequence entries, part 148.
175. gbcon149.seq - Constructed sequence entries, part 149.
176. gbcon15.seq - Constructed sequence entries, part 15.
177. gbcon150.seq - Constructed sequence entries, part 150.
178. gbcon151.seq - Constructed sequence entries, part 151.
179. gbcon152.seq - Constructed sequence entries, part 152.
180. gbcon153.seq - Constructed sequence entries, part 153.
181. gbcon154.seq - Constructed sequence entries, part 154.
182. gbcon155.seq - Constructed sequence entries, part 155.
183. gbcon156.seq - Constructed sequence entries, part 156.
184. gbcon157.seq - Constructed sequence entries, part 157.
185. gbcon158.seq - Constructed sequence entries, part 158.
186. gbcon159.seq - Constructed sequence entries, part 159.
187. gbcon16.seq - Constructed sequence entries, part 16.
188. gbcon160.seq - Constructed sequence entries, part 160.
189. gbcon161.seq - Constructed sequence entries, part 161.
190. gbcon162.seq - Constructed sequence entries, part 162.
191. gbcon163.seq - Constructed sequence entries, part 163.
192. gbcon164.seq - Constructed sequence entries, part 164.
193. gbcon165.seq - Constructed sequence entries, part 165.
194. gbcon166.seq - Constructed sequence entries, part 166.
195. gbcon167.seq - Constructed sequence entries, part 167.
196. gbcon168.seq - Constructed sequence entries, part 168.
197. gbcon169.seq - Constructed sequence entries, part 169.
198. gbcon17.seq - Constructed sequence entries, part 17.
199. gbcon170.seq - Constructed sequence entries, part 170.
200. gbcon171.seq - Constructed sequence entries, part 171.
201. gbcon172.seq - Constructed sequence entries, part 172.
202. gbcon173.seq - Constructed sequence entries, part 173.
203. gbcon174.seq - Constructed sequence entries, part 174.
204. gbcon175.seq - Constructed sequence entries, part 175.
205. gbcon176.seq - Constructed sequence entries, part 176.
206. gbcon177.seq - Constructed sequence entries, part 177.
207. gbcon178.seq - Constructed sequence entries, part 178.
208. gbcon179.seq - Constructed sequence entries, part 179.
209. gbcon18.seq - Constructed sequence entries, part 18.
210. gbcon180.seq - Constructed sequence entries, part 180.
211. gbcon181.seq - Constructed sequence entries, part 181.
212. gbcon182.seq - Constructed sequence entries, part 182.
213. gbcon183.seq - Constructed sequence entries, part 183.
214. gbcon184.seq - Constructed sequence entries, part 184.
215. gbcon185.seq - Constructed sequence entries, part 185.
216. gbcon186.seq - Constructed sequence entries, part 186.
217. gbcon187.seq - Constructed sequence entries, part 187.
218. gbcon188.seq - Constructed sequence entries, part 188.
219. gbcon189.seq - Constructed sequence entries, part 189.
220. gbcon19.seq - Constructed sequence entries, part 19.
221. gbcon190.seq - Constructed sequence entries, part 190.
222. gbcon191.seq - Constructed sequence entries, part 191.
223. gbcon192.seq - Constructed sequence entries, part 192.
224. gbcon193.seq - Constructed sequence entries, part 193.
225. gbcon194.seq - Constructed sequence entries, part 194.
226. gbcon195.seq - Constructed sequence entries, part 195.
227. gbcon196.seq - Constructed sequence entries, part 196.
228. gbcon197.seq - Constructed sequence entries, part 197.
229. gbcon198.seq - Constructed sequence entries, part 198.
230. gbcon199.seq - Constructed sequence entries, part 199.
231. gbcon2.seq - Constructed sequence entries, part 2.
232. gbcon20.seq - Constructed sequence entries, part 20.
233. gbcon200.seq - Constructed sequence entries, part 200.
234. gbcon201.seq - Constructed sequence entries, part 201.
235. gbcon202.seq - Constructed sequence entries, part 202.
236. gbcon203.seq - Constructed sequence entries, part 203.
237. gbcon204.seq - Constructed sequence entries, part 204.
238. gbcon205.seq - Constructed sequence entries, part 205.
239. gbcon206.seq - Constructed sequence entries, part 206.
240. gbcon207.seq - Constructed sequence entries, part 207.
241. gbcon208.seq - Constructed sequence entries, part 208.
242. gbcon209.seq - Constructed sequence entries, part 209.
243. gbcon21.seq - Constructed sequence entries, part 21.
244. gbcon210.seq - Constructed sequence entries, part 210.
245. gbcon211.seq - Constructed sequence entries, part 211.
246. gbcon212.seq - Constructed sequence entries, part 212.
247. gbcon213.seq - Constructed sequence entries, part 213.
248. gbcon214.seq - Constructed sequence entries, part 214.
249. gbcon215.seq - Constructed sequence entries, part 215.
250. gbcon216.seq - Constructed sequence entries, part 216.
251. gbcon217.seq - Constructed sequence entries, part 217.
252. gbcon218.seq - Constructed sequence entries, part 218.
253. gbcon219.seq - Constructed sequence entries, part 219.
254. gbcon22.seq - Constructed sequence entries, part 22.
255. gbcon220.seq - Constructed sequence entries, part 220.
256. gbcon221.seq - Constructed sequence entries, part 221.
257. gbcon222.seq - Constructed sequence entries, part 222.
258. gbcon223.seq - Constructed sequence entries, part 223.
259. gbcon224.seq - Constructed sequence entries, part 224.
260. gbcon225.seq - Constructed sequence entries, part 225.
261. gbcon226.seq - Constructed sequence entries, part 226.
262. gbcon227.seq - Constructed sequence entries, part 227.
263. gbcon228.seq - Constructed sequence entries, part 228.
264. gbcon229.seq - Constructed sequence entries, part 229.
265. gbcon23.seq - Constructed sequence entries, part 23.
266. gbcon230.seq - Constructed sequence entries, part 230.
267. gbcon231.seq - Constructed sequence entries, part 231.
268. gbcon232.seq - Constructed sequence entries, part 232.
269. gbcon233.seq - Constructed sequence entries, part 233.
270. gbcon234.seq - Constructed sequence entries, part 234.
271. gbcon235.seq - Constructed sequence entries, part 235.
272. gbcon236.seq - Constructed sequence entries, part 236.
273. gbcon237.seq - Constructed sequence entries, part 237.
274. gbcon238.seq - Constructed sequence entries, part 238.
275. gbcon239.seq - Constructed sequence entries, part 239.
276. gbcon24.seq - Constructed sequence entries, part 24.
277. gbcon240.seq - Constructed sequence entries, part 240.
278. gbcon241.seq - Constructed sequence entries, part 241.
279. gbcon242.seq - Constructed sequence entries, part 242.
280. gbcon25.seq - Constructed sequence entries, part 25.
281. gbcon26.seq - Constructed sequence entries, part 26.
282. gbcon27.seq - Constructed sequence entries, part 27.
283. gbcon28.seq - Constructed sequence entries, part 28.
284. gbcon29.seq - Constructed sequence entries, part 29.
285. gbcon3.seq - Constructed sequence entries, part 3.
286. gbcon30.seq - Constructed sequence entries, part 30.
287. gbcon31.seq - Constructed sequence entries, part 31.
288. gbcon32.seq - Constructed sequence entries, part 32.
289. gbcon33.seq - Constructed sequence entries, part 33.
290. gbcon34.seq - Constructed sequence entries, part 34.
291. gbcon35.seq - Constructed sequence entries, part 35.
292. gbcon36.seq - Constructed sequence entries, part 36.
293. gbcon37.seq - Constructed sequence entries, part 37.
294. gbcon38.seq - Constructed sequence entries, part 38.
295. gbcon39.seq - Constructed sequence entries, part 39.
296. gbcon4.seq - Constructed sequence entries, part 4.
297. gbcon40.seq - Constructed sequence entries, part 40.
298. gbcon41.seq - Constructed sequence entries, part 41.
299. gbcon42.seq - Constructed sequence entries, part 42.
300. gbcon43.seq - Constructed sequence entries, part 43.
301. gbcon44.seq - Constructed sequence entries, part 44.
302. gbcon45.seq - Constructed sequence entries, part 45.
303. gbcon46.seq - Constructed sequence entries, part 46.
304. gbcon47.seq - Constructed sequence entries, part 47.
305. gbcon48.seq - Constructed sequence entries, part 48.
306. gbcon49.seq - Constructed sequence entries, part 49.
307. gbcon5.seq - Constructed sequence entries, part 5.
308. gbcon50.seq - Constructed sequence entries, part 50.
309. gbcon51.seq - Constructed sequence entries, part 51.
310. gbcon52.seq - Constructed sequence entries, part 52.
311. gbcon53.seq - Constructed sequence entries, part 53.
312. gbcon54.seq - Constructed sequence entries, part 54.
313. gbcon55.seq - Constructed sequence entries, part 55.
314. gbcon56.seq - Constructed sequence entries, part 56.
315. gbcon57.seq - Constructed sequence entries, part 57.
316. gbcon58.seq - Constructed sequence entries, part 58.
317. gbcon59.seq - Constructed sequence entries, part 59.
318. gbcon6.seq - Constructed sequence entries, part 6.
319. gbcon60.seq - Constructed sequence entries, part 60.
320. gbcon61.seq - Constructed sequence entries, part 61.
321. gbcon62.seq - Constructed sequence entries, part 62.
322. gbcon63.seq - Constructed sequence entries, part 63.
323. gbcon64.seq - Constructed sequence entries, part 64.
324. gbcon65.seq - Constructed sequence entries, part 65.
325. gbcon66.seq - Constructed sequence entries, part 66.
326. gbcon67.seq - Constructed sequence entries, part 67.
327. gbcon68.seq - Constructed sequence entries, part 68.
328. gbcon69.seq - Constructed sequence entries, part 69.
329. gbcon7.seq - Constructed sequence entries, part 7.
330. gbcon70.seq - Constructed sequence entries, part 70.
331. gbcon71.seq - Constructed sequence entries, part 71.
332. gbcon72.seq - Constructed sequence entries, part 72.
333. gbcon73.seq - Constructed sequence entries, part 73.
334. gbcon74.seq - Constructed sequence entries, part 74.
335. gbcon75.seq - Constructed sequence entries, part 75.
336. gbcon76.seq - Constructed sequence entries, part 76.
337. gbcon77.seq - Constructed sequence entries, part 77.
338. gbcon78.seq - Constructed sequence entries, part 78.
339. gbcon79.seq - Constructed sequence entries, part 79.
340. gbcon8.seq - Constructed sequence entries, part 8.
341. gbcon80.seq - Constructed sequence entries, part 80.
342. gbcon81.seq - Constructed sequence entries, part 81.
343. gbcon82.seq - Constructed sequence entries, part 82.
344. gbcon83.seq - Constructed sequence entries, part 83.
345. gbcon84.seq - Constructed sequence entries, part 84.
346. gbcon85.seq - Constructed sequence entries, part 85.
347. gbcon86.seq - Constructed sequence entries, part 86.
348. gbcon87.seq - Constructed sequence entries, part 87.
349. gbcon88.seq - Constructed sequence entries, part 88.
350. gbcon89.seq - Constructed sequence entries, part 89.
351. gbcon9.seq - Constructed sequence entries, part 9.
352. gbcon90.seq - Constructed sequence entries, part 90.
353. gbcon91.seq - Constructed sequence entries, part 91.
354. gbcon92.seq - Constructed sequence entries, part 92.
355. gbcon93.seq - Constructed sequence entries, part 93.
356. gbcon94.seq - Constructed sequence entries, part 94.
357. gbcon95.seq - Constructed sequence entries, part 95.
358. gbcon96.seq - Constructed sequence entries, part 96.
359. gbcon97.seq - Constructed sequence entries, part 97.
360. gbcon98.seq - Constructed sequence entries, part 98.
361. gbcon99.seq - Constructed sequence entries, part 99.
362. gbdel.txt - Accession numbers of entries deleted since the previous release.
363. gbenv1.seq - Environmental sampling sequence entries, part 1.
364. gbenv10.seq - Environmental sampling sequence entries, part 10.
365. gbenv11.seq - Environmental sampling sequence entries, part 11.
366. gbenv12.seq - Environmental sampling sequence entries, part 12.
367. gbenv13.seq - Environmental sampling sequence entries, part 13.
368. gbenv14.seq - Environmental sampling sequence entries, part 14.
369. gbenv15.seq - Environmental sampling sequence entries, part 15.
370. gbenv16.seq - Environmental sampling sequence entries, part 16.
371. gbenv17.seq - Environmental sampling sequence entries, part 17.
372. gbenv18.seq - Environmental sampling sequence entries, part 18.
373. gbenv19.seq - Environmental sampling sequence entries, part 19.
374. gbenv2.seq - Environmental sampling sequence entries, part 2.
375. gbenv20.seq - Environmental sampling sequence entries, part 20.
376. gbenv21.seq - Environmental sampling sequence entries, part 21.
377. gbenv22.seq - Environmental sampling sequence entries, part 22.
378. gbenv23.seq - Environmental sampling sequence entries, part 23.
379. gbenv24.seq - Environmental sampling sequence entries, part 24.
380. gbenv25.seq - Environmental sampling sequence entries, part 25.
381. gbenv26.seq - Environmental sampling sequence entries, part 26.
382. gbenv27.seq - Environmental sampling sequence entries, part 27.
383. gbenv28.seq - Environmental sampling sequence entries, part 28.
384. gbenv29.seq - Environmental sampling sequence entries, part 29.
385. gbenv3.seq - Environmental sampling sequence entries, part 3.
386. gbenv30.seq - Environmental sampling sequence entries, part 30.
387. gbenv31.seq - Environmental sampling sequence entries, part 31.
388. gbenv32.seq - Environmental sampling sequence entries, part 32.
389. gbenv33.seq - Environmental sampling sequence entries, part 33.
390. gbenv34.seq - Environmental sampling sequence entries, part 34.
391. gbenv35.seq - Environmental sampling sequence entries, part 35.
392. gbenv36.seq - Environmental sampling sequence entries, part 36.
393. gbenv37.seq - Environmental sampling sequence entries, part 37.
394. gbenv38.seq - Environmental sampling sequence entries, part 38.
395. gbenv39.seq - Environmental sampling sequence entries, part 39.
396. gbenv4.seq - Environmental sampling sequence entries, part 4.
397. gbenv40.seq - Environmental sampling sequence entries, part 40.
398. gbenv41.seq - Environmental sampling sequence entries, part 41.
399. gbenv42.seq - Environmental sampling sequence entries, part 42.
400. gbenv43.seq - Environmental sampling sequence entries, part 43.
401. gbenv44.seq - Environmental sampling sequence entries, part 44.
402. gbenv45.seq - Environmental sampling sequence entries, part 45.
403. gbenv46.seq - Environmental sampling sequence entries, part 46.
404. gbenv47.seq - Environmental sampling sequence entries, part 47.
405. gbenv48.seq - Environmental sampling sequence entries, part 48.
406. gbenv49.seq - Environmental sampling sequence entries, part 49.
407. gbenv5.seq - Environmental sampling sequence entries, part 5.
408. gbenv50.seq - Environmental sampling sequence entries, part 50.
409. gbenv51.seq - Environmental sampling sequence entries, part 51.
410. gbenv52.seq - Environmental sampling sequence entries, part 52.
411. gbenv53.seq - Environmental sampling sequence entries, part 53.
412. gbenv54.seq - Environmental sampling sequence entries, part 54.
413. gbenv55.seq - Environmental sampling sequence entries, part 55.
414. gbenv56.seq - Environmental sampling sequence entries, part 56.
415. gbenv57.seq - Environmental sampling sequence entries, part 57.
416. gbenv58.seq - Environmental sampling sequence entries, part 58.
417. gbenv59.seq - Environmental sampling sequence entries, part 59.
418. gbenv6.seq - Environmental sampling sequence entries, part 6.
419. gbenv60.seq - Environmental sampling sequence entries, part 60.
420. gbenv61.seq - Environmental sampling sequence entries, part 61.
421. gbenv62.seq - Environmental sampling sequence entries, part 62.
422. gbenv63.seq - Environmental sampling sequence entries, part 63.
423. gbenv64.seq - Environmental sampling sequence entries, part 64.
424. gbenv65.seq - Environmental sampling sequence entries, part 65.
425. gbenv66.seq - Environmental sampling sequence entries, part 66.
426. gbenv67.seq - Environmental sampling sequence entries, part 67.
427. gbenv7.seq - Environmental sampling sequence entries, part 7.
428. gbenv8.seq - Environmental sampling sequence entries, part 8.
429. gbenv9.seq - Environmental sampling sequence entries, part 9.
430. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
431. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
432. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
433. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
434. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
435. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
436. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
437. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
438. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
439. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
440. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
441. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
442. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
443. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
444. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
445. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
446. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
447. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
448. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
449. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
450. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
451. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
452. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
453. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
454. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
455. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
456. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
457. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
458. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
459. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
460. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
461. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
462. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
463. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
464. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
465. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
466. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
467. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
468. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
469. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
470. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
471. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
472. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
473. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
474. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
475. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
476. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
477. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
478. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
479. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
480. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
481. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
482. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
483. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
484. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
485. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
486. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
487. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
488. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
489. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
490. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
491. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
492. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
493. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
494. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
495. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
496. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
497. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
498. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
499. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
500. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
501. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
502. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
503. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
504. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
505. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
506. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
507. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
508. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
509. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
510. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
511. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
512. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
513. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
514. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
515. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
516. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
517. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
518. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
519. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
520. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
521. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
522. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
523. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
524. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
525. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
526. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
527. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
528. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
529. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
530. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
531. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
532. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
533. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
534. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
535. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
536. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
537. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
538. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
539. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
540. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
541. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
542. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
543. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
544. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
545. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
546. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
547. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
548. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
549. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
550. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
551. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
552. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
553. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
554. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
555. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
556. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
557. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
558. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
559. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
560. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
561. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
562. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
563. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
564. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
565. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
566. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
567. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
568. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
569. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
570. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
571. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
572. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
573. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
574. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
575. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
576. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
577. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
578. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
579. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
580. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
581. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
582. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
583. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
584. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
585. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
586. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
587. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
588. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
589. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
590. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
591. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
592. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
593. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
594. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
595. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
596. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
597. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
598. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
599. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
600. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
601. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
602. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
603. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
604. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
605. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
606. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
607. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
608. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
609. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
610. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
611. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
612. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
613. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
614. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
615. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
616. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
617. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
618. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
619. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
620. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
621. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
622. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
623. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
624. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
625. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
626. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
627. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
628. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
629. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
630. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
631. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
632. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
633. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
634. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
635. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
636. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
637. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
638. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
639. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
640. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
641. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
642. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
643. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
644. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
645. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
646. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
647. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
648. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
649. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
650. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
651. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
652. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
653. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
654. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
655. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
656. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
657. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
658. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
659. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
660. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
661. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
662. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
663. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
664. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
665. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
666. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
667. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
668. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
669. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
670. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
671. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
672. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
673. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
674. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
675. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
676. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
677. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
678. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
679. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
680. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
681. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
682. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
683. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
684. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
685. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
686. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
687. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
688. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
689. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
690. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
691. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
692. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
693. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
694. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
695. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
696. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
697. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
698. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
699. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
700. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
701. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
702. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
703. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
704. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
705. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
706. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
707. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
708. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
709. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
710. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
711. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
712. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
713. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
714. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
715. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
716. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
717. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
718. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
719. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
720. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
721. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
722. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
723. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
724. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
725. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
726. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
727. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
728. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
729. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
730. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
731. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
732. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
733. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
734. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
735. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
736. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
737. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
738. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
739. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
740. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
741. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
742. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
743. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
744. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
745. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
746. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
747. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
748. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
749. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
750. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
751. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
752. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
753. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
754. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
755. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
756. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
757. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
758. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
759. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
760. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
761. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
762. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
763. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
764. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
765. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
766. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
767. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
768. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
769. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
770. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
771. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
772. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
773. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
774. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
775. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
776. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
777. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
778. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
779. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
780. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
781. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
782. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
783. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
784. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
785. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
786. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
787. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
788. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
789. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
790. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
791. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
792. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
793. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
794. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
795. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
796. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
797. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
798. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
799. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
800. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
801. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
802. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
803. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
804. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
805. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
806. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
807. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
808. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
809. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
810. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
811. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
812. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
813. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
814. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
815. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
816. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
817. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
818. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
819. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
820. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
821. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
822. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
823. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
824. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
825. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
826. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
827. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
828. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
829. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
830. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
831. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
832. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
833. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
834. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
835. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
836. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
837. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
838. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
839. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
840. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
841. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
842. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
843. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
844. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
845. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
846. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
847. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
848. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
849. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
850. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
851. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
852. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
853. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
854. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
855. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
856. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
857. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
858. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
859. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
860. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
861. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
862. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
863. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
864. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
865. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
866. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
867. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
868. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
869. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
870. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
871. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
872. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
873. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
874. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
875. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
876. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
877. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
878. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
879. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
880. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
881. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
882. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
883. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
884. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
885. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
886. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
887. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
888. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
889. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
890. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
891. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
892. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
893. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
894. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
895. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
896. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
897. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
898. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
899. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
900. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
901. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
902. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
903. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
904. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
905. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
906. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
907. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
908. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
909. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
910. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
911. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
912. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
913. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
914. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
915. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
916. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
917. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
918. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
919. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
920. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
921. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
922. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
923. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
924. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
925. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
926. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
927. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
928. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
929. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
930. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
931. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
932. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
933. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
934. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
935. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
936. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
937. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
938. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
939. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
940. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
941. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
942. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
943. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
944. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
945. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
946. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
947. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
948. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
949. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
950. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
951. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
952. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
953. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
954. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
955. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
956. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
957. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
958. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
959. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
960. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
961. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
962. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
963. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
964. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
965. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
966. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
967. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
968. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
969. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
970. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
971. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
972. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
973. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
974. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
975. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
976. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
977. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
978. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
979. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
980. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
981. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
982. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
983. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
984. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
985. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
986. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
987. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
988. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
989. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
990. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
991. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
992. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
993. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
994. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
995. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
996. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
997. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
998. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
999. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1000. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1001. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1002. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1003. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1004. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1005. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1006. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1007. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1008. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1009. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1010. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1011. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1012. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1013. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1014. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1015. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1016. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1017. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1018. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1019. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1020. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1021. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1022. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1023. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1024. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1025. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1026. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1027. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1028. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1029. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1030. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1031. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1032. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1033. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1034. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1035. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1036. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1037. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1038. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1039. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1040. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1041. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1042. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1043. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1044. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1045. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1046. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1047. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1048. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1049. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1050. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1051. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1052. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1053. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1054. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1055. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1056. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1057. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1058. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1059. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1060. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1061. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1062. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1063. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1064. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1065. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1066. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1067. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1068. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1069. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1070. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1071. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1072. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1073. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1074. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1075. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1076. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1077. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1078. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1079. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1080. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1081. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1082. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1083. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1084. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1085. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1086. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1087. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1088. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1089. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1090. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1091. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1092. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1093. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1094. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1095. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1096. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1097. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1098. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1099. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1100. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1101. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1102. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1103. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1104. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1105. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1106. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1107. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1108. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1109. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1110. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1111. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1112. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1113. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1114. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1115. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1116. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1117. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1118. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1119. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1120. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1121. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1122. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1123. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1124. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1125. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1126. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1127. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1128. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1129. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1130. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1131. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1132. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1133. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1134. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1135. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1136. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1137. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1138. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1139. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1140. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1141. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1142. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1143. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1144. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1145. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1146. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1147. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1148. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1149. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1150. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1151. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1152. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1153. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1154. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1155. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1156. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1157. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1158. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1159. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1160. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1161. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1162. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1163. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1164. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1165. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1166. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1167. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1168. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1169. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1170. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1171. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1172. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1173. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1174. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1175. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1176. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1177. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1178. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1179. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1180. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1181. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1182. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1183. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1184. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1185. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1186. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1187. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1188. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1189. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1190. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1191. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1192. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1193. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1194. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1195. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1196. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1197. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1198. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1199. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1200. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1201. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1202. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1203. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1204. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1205. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1206. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1207. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1208. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1209. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1210. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1211. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1212. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1213. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1214. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1215. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1216. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1217. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1218. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1219. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1220. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1221. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1222. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1223. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1224. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1225. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1226. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1227. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1228. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1229. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1230. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1231. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1232. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1233. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1234. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1235. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1236. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1237. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1238. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1239. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1240. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1241. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1242. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1243. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1244. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1245. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1246. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1247. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1248. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1249. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1250. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1251. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1252. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1253. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1254. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1255. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1256. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1257. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1258. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1259. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1260. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1261. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1262. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1263. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1264. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1265. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1266. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1267. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1268. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1269. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1270. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1271. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1272. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1273. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1274. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1275. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1276. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1277. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1278. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1279. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1280. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1281. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1282. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1283. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1284. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1285. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1286. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1287. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1288. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1289. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1290. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1291. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1292. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1293. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1294. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1295. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1296. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1297. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1298. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1299. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1300. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1301. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1302. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1303. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1304. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1305. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1306. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1307. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1308. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1309. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1310. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1311. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1312. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1313. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1314. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1315. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1316. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1317. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1318. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1319. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1320. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1321. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1322. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1323. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1324. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1325. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1326. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1327. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1328. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1329. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1330. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1331. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1332. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1333. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1334. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1335. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1336. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1337. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1338. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1339. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1340. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1341. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1342. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1343. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1344. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1345. gbinv1.seq - Invertebrate sequence entries, part 1.
1346. gbinv10.seq - Invertebrate sequence entries, part 10.
1347. gbinv11.seq - Invertebrate sequence entries, part 11.
1348. gbinv12.seq - Invertebrate sequence entries, part 12.
1349. gbinv13.seq - Invertebrate sequence entries, part 13.
1350. gbinv14.seq - Invertebrate sequence entries, part 14.
1351. gbinv15.seq - Invertebrate sequence entries, part 15.
1352. gbinv16.seq - Invertebrate sequence entries, part 16.
1353. gbinv17.seq - Invertebrate sequence entries, part 17.
1354. gbinv18.seq - Invertebrate sequence entries, part 18.
1355. gbinv19.seq - Invertebrate sequence entries, part 19.
1356. gbinv2.seq - Invertebrate sequence entries, part 2.
1357. gbinv20.seq - Invertebrate sequence entries, part 20.
1358. gbinv21.seq - Invertebrate sequence entries, part 21.
1359. gbinv22.seq - Invertebrate sequence entries, part 22.
1360. gbinv23.seq - Invertebrate sequence entries, part 23.
1361. gbinv24.seq - Invertebrate sequence entries, part 24.
1362. gbinv25.seq - Invertebrate sequence entries, part 25.
1363. gbinv26.seq - Invertebrate sequence entries, part 26.
1364. gbinv27.seq - Invertebrate sequence entries, part 27.
1365. gbinv28.seq - Invertebrate sequence entries, part 28.
1366. gbinv29.seq - Invertebrate sequence entries, part 29.
1367. gbinv3.seq - Invertebrate sequence entries, part 3.
1368. gbinv30.seq - Invertebrate sequence entries, part 30.
1369. gbinv31.seq - Invertebrate sequence entries, part 31.
1370. gbinv32.seq - Invertebrate sequence entries, part 32.
1371. gbinv33.seq - Invertebrate sequence entries, part 33.
1372. gbinv34.seq - Invertebrate sequence entries, part 34.
1373. gbinv35.seq - Invertebrate sequence entries, part 35.
1374. gbinv36.seq - Invertebrate sequence entries, part 36.
1375. gbinv37.seq - Invertebrate sequence entries, part 37.
1376. gbinv38.seq - Invertebrate sequence entries, part 38.
1377. gbinv4.seq - Invertebrate sequence entries, part 4.
1378. gbinv5.seq - Invertebrate sequence entries, part 5.
1379. gbinv6.seq - Invertebrate sequence entries, part 6.
1380. gbinv7.seq - Invertebrate sequence entries, part 7.
1381. gbinv8.seq - Invertebrate sequence entries, part 8.
1382. gbinv9.seq - Invertebrate sequence entries, part 9.
1383. gbmam1.seq - Other mammalian sequence entries, part 1.
1384. gbmam2.seq - Other mammalian sequence entries, part 2.
1385. gbmam3.seq - Other mammalian sequence entries, part 3.
1386. gbmam4.seq - Other mammalian sequence entries, part 4.
1387. gbmam5.seq - Other mammalian sequence entries, part 5.
1388. gbmam6.seq - Other mammalian sequence entries, part 6.
1389. gbmam7.seq - Other mammalian sequence entries, part 7.
1390. gbmam8.seq - Other mammalian sequence entries, part 8.
1391. gbnew.txt - Accession numbers of entries new since the previous release.
1392. gbpat1.seq - Patent sequence entries, part 1.
1393. gbpat10.seq - Patent sequence entries, part 10.
1394. gbpat100.seq - Patent sequence entries, part 100.
1395. gbpat101.seq - Patent sequence entries, part 101.
1396. gbpat102.seq - Patent sequence entries, part 102.
1397. gbpat103.seq - Patent sequence entries, part 103.
1398. gbpat104.seq - Patent sequence entries, part 104.
1399. gbpat105.seq - Patent sequence entries, part 105.
1400. gbpat106.seq - Patent sequence entries, part 106.
1401. gbpat107.seq - Patent sequence entries, part 107.
1402. gbpat108.seq - Patent sequence entries, part 108.
1403. gbpat109.seq - Patent sequence entries, part 109.
1404. gbpat11.seq - Patent sequence entries, part 11.
1405. gbpat110.seq - Patent sequence entries, part 110.
1406. gbpat111.seq - Patent sequence entries, part 111.
1407. gbpat112.seq - Patent sequence entries, part 112.
1408. gbpat113.seq - Patent sequence entries, part 113.
1409. gbpat114.seq - Patent sequence entries, part 114.
1410. gbpat115.seq - Patent sequence entries, part 115.
1411. gbpat116.seq - Patent sequence entries, part 116.
1412. gbpat117.seq - Patent sequence entries, part 117.
1413. gbpat118.seq - Patent sequence entries, part 118.
1414. gbpat119.seq - Patent sequence entries, part 119.
1415. gbpat12.seq - Patent sequence entries, part 12.
1416. gbpat120.seq - Patent sequence entries, part 120.
1417. gbpat121.seq - Patent sequence entries, part 121.
1418. gbpat122.seq - Patent sequence entries, part 122.
1419. gbpat123.seq - Patent sequence entries, part 123.
1420. gbpat124.seq - Patent sequence entries, part 124.
1421. gbpat125.seq - Patent sequence entries, part 125.
1422. gbpat126.seq - Patent sequence entries, part 126.
1423. gbpat127.seq - Patent sequence entries, part 127.
1424. gbpat128.seq - Patent sequence entries, part 128.
1425. gbpat129.seq - Patent sequence entries, part 129.
1426. gbpat13.seq - Patent sequence entries, part 13.
1427. gbpat130.seq - Patent sequence entries, part 130.
1428. gbpat131.seq - Patent sequence entries, part 131.
1429. gbpat132.seq - Patent sequence entries, part 132.
1430. gbpat133.seq - Patent sequence entries, part 133.
1431. gbpat134.seq - Patent sequence entries, part 134.
1432. gbpat135.seq - Patent sequence entries, part 135.
1433. gbpat136.seq - Patent sequence entries, part 136.
1434. gbpat137.seq - Patent sequence entries, part 137.
1435. gbpat138.seq - Patent sequence entries, part 138.
1436. gbpat139.seq - Patent sequence entries, part 139.
1437. gbpat14.seq - Patent sequence entries, part 14.
1438. gbpat140.seq - Patent sequence entries, part 140.
1439. gbpat141.seq - Patent sequence entries, part 141.
1440. gbpat142.seq - Patent sequence entries, part 142.
1441. gbpat143.seq - Patent sequence entries, part 143.
1442. gbpat144.seq - Patent sequence entries, part 144.
1443. gbpat145.seq - Patent sequence entries, part 145.
1444. gbpat146.seq - Patent sequence entries, part 146.
1445. gbpat147.seq - Patent sequence entries, part 147.
1446. gbpat148.seq - Patent sequence entries, part 148.
1447. gbpat149.seq - Patent sequence entries, part 149.
1448. gbpat15.seq - Patent sequence entries, part 15.
1449. gbpat150.seq - Patent sequence entries, part 150.
1450. gbpat151.seq - Patent sequence entries, part 151.
1451. gbpat152.seq - Patent sequence entries, part 152.
1452. gbpat153.seq - Patent sequence entries, part 153.
1453. gbpat154.seq - Patent sequence entries, part 154.
1454. gbpat155.seq - Patent sequence entries, part 155.
1455. gbpat156.seq - Patent sequence entries, part 156.
1456. gbpat157.seq - Patent sequence entries, part 157.
1457. gbpat158.seq - Patent sequence entries, part 158.
1458. gbpat159.seq - Patent sequence entries, part 159.
1459. gbpat16.seq - Patent sequence entries, part 16.
1460. gbpat160.seq - Patent sequence entries, part 160.
1461. gbpat161.seq - Patent sequence entries, part 161.
1462. gbpat162.seq - Patent sequence entries, part 162.
1463. gbpat163.seq - Patent sequence entries, part 163.
1464. gbpat164.seq - Patent sequence entries, part 164.
1465. gbpat165.seq - Patent sequence entries, part 165.
1466. gbpat166.seq - Patent sequence entries, part 166.
1467. gbpat167.seq - Patent sequence entries, part 167.
1468. gbpat168.seq - Patent sequence entries, part 168.
1469. gbpat169.seq - Patent sequence entries, part 169.
1470. gbpat17.seq - Patent sequence entries, part 17.
1471. gbpat170.seq - Patent sequence entries, part 170.
1472. gbpat171.seq - Patent sequence entries, part 171.
1473. gbpat172.seq - Patent sequence entries, part 172.
1474. gbpat173.seq - Patent sequence entries, part 173.
1475. gbpat174.seq - Patent sequence entries, part 174.
1476. gbpat175.seq - Patent sequence entries, part 175.
1477. gbpat176.seq - Patent sequence entries, part 176.
1478. gbpat177.seq - Patent sequence entries, part 177.
1479. gbpat178.seq - Patent sequence entries, part 178.
1480. gbpat179.seq - Patent sequence entries, part 179.
1481. gbpat18.seq - Patent sequence entries, part 18.
1482. gbpat180.seq - Patent sequence entries, part 180.
1483. gbpat181.seq - Patent sequence entries, part 181.
1484. gbpat182.seq - Patent sequence entries, part 182.
1485. gbpat183.seq - Patent sequence entries, part 183.
1486. gbpat184.seq - Patent sequence entries, part 184.
1487. gbpat185.seq - Patent sequence entries, part 185.
1488. gbpat186.seq - Patent sequence entries, part 186.
1489. gbpat187.seq - Patent sequence entries, part 187.
1490. gbpat188.seq - Patent sequence entries, part 188.
1491. gbpat189.seq - Patent sequence entries, part 189.
1492. gbpat19.seq - Patent sequence entries, part 19.
1493. gbpat190.seq - Patent sequence entries, part 190.
1494. gbpat191.seq - Patent sequence entries, part 191.
1495. gbpat192.seq - Patent sequence entries, part 192.
1496. gbpat193.seq - Patent sequence entries, part 193.
1497. gbpat194.seq - Patent sequence entries, part 194.
1498. gbpat195.seq - Patent sequence entries, part 195.
1499. gbpat196.seq - Patent sequence entries, part 196.
1500. gbpat197.seq - Patent sequence entries, part 197.
1501. gbpat198.seq - Patent sequence entries, part 198.
1502. gbpat199.seq - Patent sequence entries, part 199.
1503. gbpat2.seq - Patent sequence entries, part 2.
1504. gbpat20.seq - Patent sequence entries, part 20.
1505. gbpat200.seq - Patent sequence entries, part 200.
1506. gbpat201.seq - Patent sequence entries, part 201.
1507. gbpat202.seq - Patent sequence entries, part 202.
1508. gbpat203.seq - Patent sequence entries, part 203.
1509. gbpat204.seq - Patent sequence entries, part 204.
1510. gbpat21.seq - Patent sequence entries, part 21.
1511. gbpat22.seq - Patent sequence entries, part 22.
1512. gbpat23.seq - Patent sequence entries, part 23.
1513. gbpat24.seq - Patent sequence entries, part 24.
1514. gbpat25.seq - Patent sequence entries, part 25.
1515. gbpat26.seq - Patent sequence entries, part 26.
1516. gbpat27.seq - Patent sequence entries, part 27.
1517. gbpat28.seq - Patent sequence entries, part 28.
1518. gbpat29.seq - Patent sequence entries, part 29.
1519. gbpat3.seq - Patent sequence entries, part 3.
1520. gbpat30.seq - Patent sequence entries, part 30.
1521. gbpat31.seq - Patent sequence entries, part 31.
1522. gbpat32.seq - Patent sequence entries, part 32.
1523. gbpat33.seq - Patent sequence entries, part 33.
1524. gbpat34.seq - Patent sequence entries, part 34.
1525. gbpat35.seq - Patent sequence entries, part 35.
1526. gbpat36.seq - Patent sequence entries, part 36.
1527. gbpat37.seq - Patent sequence entries, part 37.
1528. gbpat38.seq - Patent sequence entries, part 38.
1529. gbpat39.seq - Patent sequence entries, part 39.
1530. gbpat4.seq - Patent sequence entries, part 4.
1531. gbpat40.seq - Patent sequence entries, part 40.
1532. gbpat41.seq - Patent sequence entries, part 41.
1533. gbpat42.seq - Patent sequence entries, part 42.
1534. gbpat43.seq - Patent sequence entries, part 43.
1535. gbpat44.seq - Patent sequence entries, part 44.
1536. gbpat45.seq - Patent sequence entries, part 45.
1537. gbpat46.seq - Patent sequence entries, part 46.
1538. gbpat47.seq - Patent sequence entries, part 47.
1539. gbpat48.seq - Patent sequence entries, part 48.
1540. gbpat49.seq - Patent sequence entries, part 49.
1541. gbpat5.seq - Patent sequence entries, part 5.
1542. gbpat50.seq - Patent sequence entries, part 50.
1543. gbpat51.seq - Patent sequence entries, part 51.
1544. gbpat52.seq - Patent sequence entries, part 52.
1545. gbpat53.seq - Patent sequence entries, part 53.
1546. gbpat54.seq - Patent sequence entries, part 54.
1547. gbpat55.seq - Patent sequence entries, part 55.
1548. gbpat56.seq - Patent sequence entries, part 56.
1549. gbpat57.seq - Patent sequence entries, part 57.
1550. gbpat58.seq - Patent sequence entries, part 58.
1551. gbpat59.seq - Patent sequence entries, part 59.
1552. gbpat6.seq - Patent sequence entries, part 6.
1553. gbpat60.seq - Patent sequence entries, part 60.
1554. gbpat61.seq - Patent sequence entries, part 61.
1555. gbpat62.seq - Patent sequence entries, part 62.
1556. gbpat63.seq - Patent sequence entries, part 63.
1557. gbpat64.seq - Patent sequence entries, part 64.
1558. gbpat65.seq - Patent sequence entries, part 65.
1559. gbpat66.seq - Patent sequence entries, part 66.
1560. gbpat67.seq - Patent sequence entries, part 67.
1561. gbpat68.seq - Patent sequence entries, part 68.
1562. gbpat69.seq - Patent sequence entries, part 69.
1563. gbpat7.seq - Patent sequence entries, part 7.
1564. gbpat70.seq - Patent sequence entries, part 70.
1565. gbpat71.seq - Patent sequence entries, part 71.
1566. gbpat72.seq - Patent sequence entries, part 72.
1567. gbpat73.seq - Patent sequence entries, part 73.
1568. gbpat74.seq - Patent sequence entries, part 74.
1569. gbpat75.seq - Patent sequence entries, part 75.
1570. gbpat76.seq - Patent sequence entries, part 76.
1571. gbpat77.seq - Patent sequence entries, part 77.
1572. gbpat78.seq - Patent sequence entries, part 78.
1573. gbpat79.seq - Patent sequence entries, part 79.
1574. gbpat8.seq - Patent sequence entries, part 8.
1575. gbpat80.seq - Patent sequence entries, part 80.
1576. gbpat81.seq - Patent sequence entries, part 81.
1577. gbpat82.seq - Patent sequence entries, part 82.
1578. gbpat83.seq - Patent sequence entries, part 83.
1579. gbpat84.seq - Patent sequence entries, part 84.
1580. gbpat85.seq - Patent sequence entries, part 85.
1581. gbpat86.seq - Patent sequence entries, part 86.
1582. gbpat87.seq - Patent sequence entries, part 87.
1583. gbpat88.seq - Patent sequence entries, part 88.
1584. gbpat89.seq - Patent sequence entries, part 89.
1585. gbpat9.seq - Patent sequence entries, part 9.
1586. gbpat90.seq - Patent sequence entries, part 90.
1587. gbpat91.seq - Patent sequence entries, part 91.
1588. gbpat92.seq - Patent sequence entries, part 92.
1589. gbpat93.seq - Patent sequence entries, part 93.
1590. gbpat94.seq - Patent sequence entries, part 94.
1591. gbpat95.seq - Patent sequence entries, part 95.
1592. gbpat96.seq - Patent sequence entries, part 96.
1593. gbpat97.seq - Patent sequence entries, part 97.
1594. gbpat98.seq - Patent sequence entries, part 98.
1595. gbpat99.seq - Patent sequence entries, part 99.
1596. gbphg1.seq - Phage sequence entries, part 1.
1597. gbphg2.seq - Phage sequence entries, part 2.
1598. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1599. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1600. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1601. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1602. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1603. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1604. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1605. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1606. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1607. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1608. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1609. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1610. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1611. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1612. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1613. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1614. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1615. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1616. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1617. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1618. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1619. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1620. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1621. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1622. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1623. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1624. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1625. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1626. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1627. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1628. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1629. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1630. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1631. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1632. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1633. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1634. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1635. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1636. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1637. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1638. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1639. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1640. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1641. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1642. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1643. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1644. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1645. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1646. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1647. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1648. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1649. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1650. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1651. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1652. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1653. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1654. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
1655. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
1656. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
1657. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
1658. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
1659. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
1660. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
1661. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
1662. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1663. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1664. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1665. gbpri1.seq - Primate sequence entries, part 1.
1666. gbpri10.seq - Primate sequence entries, part 10.
1667. gbpri11.seq - Primate sequence entries, part 11.
1668. gbpri12.seq - Primate sequence entries, part 12.
1669. gbpri13.seq - Primate sequence entries, part 13.
1670. gbpri14.seq - Primate sequence entries, part 14.
1671. gbpri15.seq - Primate sequence entries, part 15.
1672. gbpri16.seq - Primate sequence entries, part 16.
1673. gbpri17.seq - Primate sequence entries, part 17.
1674. gbpri18.seq - Primate sequence entries, part 18.
1675. gbpri19.seq - Primate sequence entries, part 19.
1676. gbpri2.seq - Primate sequence entries, part 2.
1677. gbpri20.seq - Primate sequence entries, part 20.
1678. gbpri21.seq - Primate sequence entries, part 21.
1679. gbpri22.seq - Primate sequence entries, part 22.
1680. gbpri23.seq - Primate sequence entries, part 23.
1681. gbpri24.seq - Primate sequence entries, part 24.
1682. gbpri25.seq - Primate sequence entries, part 25.
1683. gbpri26.seq - Primate sequence entries, part 26.
1684. gbpri27.seq - Primate sequence entries, part 27.
1685. gbpri28.seq - Primate sequence entries, part 28.
1686. gbpri29.seq - Primate sequence entries, part 29.
1687. gbpri3.seq - Primate sequence entries, part 3.
1688. gbpri30.seq - Primate sequence entries, part 30.
1689. gbpri31.seq - Primate sequence entries, part 31.
1690. gbpri32.seq - Primate sequence entries, part 32.
1691. gbpri33.seq - Primate sequence entries, part 33.
1692. gbpri34.seq - Primate sequence entries, part 34.
1693. gbpri35.seq - Primate sequence entries, part 35.
1694. gbpri36.seq - Primate sequence entries, part 36.
1695. gbpri37.seq - Primate sequence entries, part 37.
1696. gbpri38.seq - Primate sequence entries, part 38.
1697. gbpri39.seq - Primate sequence entries, part 39.
1698. gbpri4.seq - Primate sequence entries, part 4.
1699. gbpri40.seq - Primate sequence entries, part 40.
1700. gbpri41.seq - Primate sequence entries, part 41.
1701. gbpri42.seq - Primate sequence entries, part 42.
1702. gbpri43.seq - Primate sequence entries, part 43.
1703. gbpri44.seq - Primate sequence entries, part 44.
1704. gbpri45.seq - Primate sequence entries, part 45.
1705. gbpri46.seq - Primate sequence entries, part 46.
1706. gbpri47.seq - Primate sequence entries, part 47.
1707. gbpri5.seq - Primate sequence entries, part 5.
1708. gbpri6.seq - Primate sequence entries, part 6.
1709. gbpri7.seq - Primate sequence entries, part 7.
1710. gbpri8.seq - Primate sequence entries, part 8.
1711. gbpri9.seq - Primate sequence entries, part 9.
1712. gbrel.txt - Release notes (this document).
1713. gbrod1.seq - Rodent sequence entries, part 1.
1714. gbrod10.seq - Rodent sequence entries, part 10.
1715. gbrod11.seq - Rodent sequence entries, part 11.
1716. gbrod12.seq - Rodent sequence entries, part 12.
1717. gbrod13.seq - Rodent sequence entries, part 13.
1718. gbrod14.seq - Rodent sequence entries, part 14.
1719. gbrod15.seq - Rodent sequence entries, part 15.
1720. gbrod16.seq - Rodent sequence entries, part 16.
1721. gbrod17.seq - Rodent sequence entries, part 17.
1722. gbrod18.seq - Rodent sequence entries, part 18.
1723. gbrod19.seq - Rodent sequence entries, part 19.
1724. gbrod2.seq - Rodent sequence entries, part 2.
1725. gbrod20.seq - Rodent sequence entries, part 20.
1726. gbrod21.seq - Rodent sequence entries, part 21.
1727. gbrod22.seq - Rodent sequence entries, part 22.
1728. gbrod23.seq - Rodent sequence entries, part 23.
1729. gbrod24.seq - Rodent sequence entries, part 24.
1730. gbrod25.seq - Rodent sequence entries, part 25.
1731. gbrod26.seq - Rodent sequence entries, part 26.
1732. gbrod27.seq - Rodent sequence entries, part 27.
1733. gbrod28.seq - Rodent sequence entries, part 28.
1734. gbrod29.seq - Rodent sequence entries, part 29.
1735. gbrod3.seq - Rodent sequence entries, part 3.
1736. gbrod30.seq - Rodent sequence entries, part 30.
1737. gbrod31.seq - Rodent sequence entries, part 31.
1738. gbrod4.seq - Rodent sequence entries, part 4.
1739. gbrod5.seq - Rodent sequence entries, part 5.
1740. gbrod6.seq - Rodent sequence entries, part 6.
1741. gbrod7.seq - Rodent sequence entries, part 7.
1742. gbrod8.seq - Rodent sequence entries, part 8.
1743. gbrod9.seq - Rodent sequence entries, part 9.
1744. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1745. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1746. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1747. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1748. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1749. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1750. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1751. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1752. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1753. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1754. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1755. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1756. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1757. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1758. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1759. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1760. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1761. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1762. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1763. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1764. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1765. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1766. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1767. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1768. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1769. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1770. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1771. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1772. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1773. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
1774. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
1775. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
1776. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
1777. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
1778. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
1779. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
1780. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
1781. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
1782. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
1783. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1784. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
1785. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
1786. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
1787. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
1788. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
1789. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
1790. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
1791. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
1792. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
1793. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
1794. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1795. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
1796. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
1797. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
1798. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
1799. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
1800. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
1801. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
1802. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
1803. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
1804. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
1805. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1806. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
1807. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
1808. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
1809. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
1810. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
1811. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
1812. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
1813. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
1814. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
1815. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
1816. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1817. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
1818. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
1819. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
1820. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
1821. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
1822. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
1823. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
1824. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
1825. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
1826. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
1827. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1828. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
1829. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1830. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1831. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1832. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1833. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1834. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1835. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1836. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1837. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1838. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1839. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1840. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1841. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1842. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1843. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1844. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1845. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1846. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1847. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1848. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1849. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1850. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1851. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1852. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1853. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1854. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1855. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1856. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1857. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1858. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1859. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1860. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1861. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1862. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1863. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1864. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1865. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1866. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1867. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1868. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1869. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1870. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1871. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1872. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1873. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1874. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1875. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1876. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1877. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1878. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1879. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1880. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1881. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1882. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1883. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1884. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1885. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1886. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1887. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1888. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1889. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1890. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1891. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1892. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1893. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1894. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1895. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1896. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1897. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1898. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1899. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1900. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1901. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1902. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1903. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1904. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1905. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1906. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1907. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
1908. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
1909. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
1910. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1911. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
1912. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
1913. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
1914. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
1915. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
1916. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
1917. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
1918. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
1919. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
1920. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
1921. gbuna1.seq - Unannotated sequence entries, part 1.
1922. gbvrl1.seq - Viral sequence entries, part 1.
1923. gbvrl10.seq - Viral sequence entries, part 10.
1924. gbvrl11.seq - Viral sequence entries, part 11.
1925. gbvrl12.seq - Viral sequence entries, part 12.
1926. gbvrl13.seq - Viral sequence entries, part 13.
1927. gbvrl14.seq - Viral sequence entries, part 14.
1928. gbvrl15.seq - Viral sequence entries, part 15.
1929. gbvrl16.seq - Viral sequence entries, part 16.
1930. gbvrl17.seq - Viral sequence entries, part 17.
1931. gbvrl18.seq - Viral sequence entries, part 18.
1932. gbvrl19.seq - Viral sequence entries, part 19.
1933. gbvrl2.seq - Viral sequence entries, part 2.
1934. gbvrl20.seq - Viral sequence entries, part 20.
1935. gbvrl21.seq - Viral sequence entries, part 21.
1936. gbvrl22.seq - Viral sequence entries, part 22.
1937. gbvrl23.seq - Viral sequence entries, part 23.
1938. gbvrl24.seq - Viral sequence entries, part 24.
1939. gbvrl25.seq - Viral sequence entries, part 25.
1940. gbvrl26.seq - Viral sequence entries, part 26.
1941. gbvrl27.seq - Viral sequence entries, part 27.
1942. gbvrl28.seq - Viral sequence entries, part 28.
1943. gbvrl29.seq - Viral sequence entries, part 29.
1944. gbvrl3.seq - Viral sequence entries, part 3.
1945. gbvrl4.seq - Viral sequence entries, part 4.
1946. gbvrl5.seq - Viral sequence entries, part 5.
1947. gbvrl6.seq - Viral sequence entries, part 6.
1948. gbvrl7.seq - Viral sequence entries, part 7.
1949. gbvrl8.seq - Viral sequence entries, part 8.
1950. gbvrl9.seq - Viral sequence entries, part 9.
1951. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1952. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1953. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1954. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1955. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1956. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1957. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1958. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1959. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1960. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1961. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1962. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1963. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1964. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1965. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1966. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1967. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1968. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1969. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1970. gbvrt27.seq - Other vertebrate sequence entries, part 27.
1971. gbvrt28.seq - Other vertebrate sequence entries, part 28.
1972. gbvrt29.seq - Other vertebrate sequence entries, part 29.
1973. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1974. gbvrt30.seq - Other vertebrate sequence entries, part 30.
1975. gbvrt31.seq - Other vertebrate sequence entries, part 31.
1976. gbvrt32.seq - Other vertebrate sequence entries, part 32.
1977. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1978. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1979. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1980. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1981. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1982. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 200.0 flatfiles require roughly 625 GB (sequence
files only) or 625 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249999296     gbbct1.seq
 245785869     gbbct10.seq
 246912314     gbbct100.seq
 240357373     gbbct101.seq
 244805093     gbbct102.seq
 240129275     gbbct103.seq
 247200243     gbbct104.seq
 244388386     gbbct105.seq
 245871336     gbbct106.seq
 160258406     gbbct107.seq
 246480813     gbbct108.seq
 243433518     gbbct109.seq
 248280164     gbbct11.seq
 246419848     gbbct110.seq
 248316434     gbbct111.seq
 249999997     gbbct112.seq
 249972404     gbbct113.seq
 249997977     gbbct114.seq
 249996827     gbbct115.seq
 249998471     gbbct116.seq
 249994570     gbbct117.seq
  84668490     gbbct118.seq
 239032343     gbbct12.seq
 247488099     gbbct13.seq
 246828677     gbbct14.seq
 249997474     gbbct15.seq
  55068420     gbbct16.seq
 243329035     gbbct17.seq
 249805318     gbbct18.seq
 248192194     gbbct19.seq
 242092093     gbbct2.seq
 249687413     gbbct20.seq
 244053543     gbbct21.seq
 245379631     gbbct22.seq
 242877221     gbbct23.seq
 239678560     gbbct24.seq
 217808868     gbbct25.seq
 242805318     gbbct26.seq
 245838310     gbbct27.seq
 248681194     gbbct28.seq
 247877626     gbbct29.seq
 246340568     gbbct3.seq
 249390867     gbbct30.seq
 244189778     gbbct31.seq
 247339387     gbbct32.seq
 249984621     gbbct33.seq
 249765459     gbbct34.seq
 240932601     gbbct35.seq
 244676414     gbbct36.seq
 249622433     gbbct37.seq
 165336460     gbbct38.seq
 248678824     gbbct39.seq
 249551463     gbbct4.seq
 246941377     gbbct40.seq
 248190382     gbbct41.seq
 246578845     gbbct42.seq
 241884741     gbbct43.seq
 246673254     gbbct44.seq
 249220672     gbbct45.seq
 248558827     gbbct46.seq
 246965529     gbbct47.seq
 241585164     gbbct48.seq
 244262717     gbbct49.seq
 249994680     gbbct5.seq
 244110319     gbbct50.seq
  49416928     gbbct51.seq
 244557986     gbbct52.seq
 245264067     gbbct53.seq
 244222766     gbbct54.seq
 247755834     gbbct55.seq
 246180538     gbbct56.seq
 248412111     gbbct57.seq
 249739401     gbbct58.seq
 244794135     gbbct59.seq
  17668885     gbbct6.seq
 247645952     gbbct60.seq
 248624088     gbbct61.seq
 228840490     gbbct62.seq
 247439690     gbbct63.seq
 248690659     gbbct64.seq
  47192048     gbbct65.seq
 245634225     gbbct66.seq
 243552427     gbbct67.seq
 248854237     gbbct68.seq
 244262450     gbbct69.seq
 249459380     gbbct7.seq
 246408225     gbbct70.seq
 249783432     gbbct71.seq
 249506872     gbbct72.seq
 247389932     gbbct73.seq
 248785377     gbbct74.seq
 246828430     gbbct75.seq
 248330931     gbbct76.seq
 227860665     gbbct77.seq
 192059787     gbbct78.seq
 249577872     gbbct79.seq
 249746334     gbbct8.seq
 249700158     gbbct80.seq
 241594276     gbbct81.seq
 248594179     gbbct82.seq
 244214017     gbbct83.seq
 246662376     gbbct84.seq
 248799777     gbbct85.seq
 249383627     gbbct86.seq
 236647478     gbbct87.seq
 243804068     gbbct88.seq
 249920781     gbbct89.seq
 227652412     gbbct9.seq
 245477306     gbbct90.seq
 140425891     gbbct91.seq
   6893023     gbbct92.seq
  14225239     gbbct93.seq
  23056109     gbbct94.seq
  45138045     gbbct95.seq
  87821731     gbbct96.seq
 170392714     gbbct97.seq
 249999212     gbbct98.seq
 249898266     gbbct99.seq
  77621769     gbchg.txt
 249999125     gbcon1.seq
 249995757     gbcon10.seq
 249996033     gbcon100.seq
 249999285     gbcon101.seq
 135141019     gbcon102.seq
 249999018     gbcon103.seq
 249995506     gbcon104.seq
 249999938     gbcon105.seq
 249996196     gbcon106.seq
 249994668     gbcon107.seq
 158184767     gbcon108.seq
 249997662     gbcon109.seq
 248969630     gbcon11.seq
 249996981     gbcon110.seq
 249998026     gbcon111.seq
 237160749     gbcon112.seq
 212966179     gbcon113.seq
 249999151     gbcon114.seq
 249991357     gbcon115.seq
 249995392     gbcon116.seq
 249987519     gbcon117.seq
  79180141     gbcon118.seq
 249996287     gbcon119.seq
 249306122     gbcon12.seq
 249999448     gbcon120.seq
 239708273     gbcon121.seq
 245419438     gbcon122.seq
 175797037     gbcon123.seq
 249997030     gbcon124.seq
 249907845     gbcon125.seq
 249999708     gbcon126.seq
 249995860     gbcon127.seq
 249998630     gbcon128.seq
 201788941     gbcon129.seq
 247958879     gbcon13.seq
 249998604     gbcon130.seq
 249664036     gbcon131.seq
 248606553     gbcon132.seq
 249867670     gbcon133.seq
 249997704     gbcon134.seq
 249927035     gbcon135.seq
 249998973     gbcon136.seq
 140247385     gbcon137.seq
 249995202     gbcon138.seq
 249997957     gbcon139.seq
 249876113     gbcon14.seq
 249997331     gbcon140.seq
 249996775     gbcon141.seq
 249999504     gbcon142.seq
 249800329     gbcon143.seq
 249981431     gbcon144.seq
 249999071     gbcon145.seq
 223181710     gbcon146.seq
 249998901     gbcon147.seq
 249999331     gbcon148.seq
 249995121     gbcon149.seq
 245313344     gbcon15.seq
 249999417     gbcon150.seq
 139044118     gbcon151.seq
 249999430     gbcon152.seq
 249684868     gbcon153.seq
 250000009     gbcon154.seq
 249998353     gbcon155.seq
 249019106     gbcon156.seq
 249967843     gbcon157.seq
 249992714     gbcon158.seq
 103273802     gbcon159.seq
 219261321     gbcon16.seq
 249999135     gbcon160.seq
 249996807     gbcon161.seq
 249997937     gbcon162.seq
 249996491     gbcon163.seq
 249985208     gbcon164.seq
 249454867     gbcon165.seq
  30840412     gbcon166.seq
 249997467     gbcon167.seq
 249773116     gbcon168.seq
 250000240     gbcon169.seq
 249991835     gbcon17.seq
 249995669     gbcon170.seq
 249998809     gbcon171.seq
 249999438     gbcon172.seq
 249947145     gbcon173.seq
 249999549     gbcon174.seq
 249900850     gbcon175.seq
 162095762     gbcon176.seq
 248961058     gbcon177.seq
 249752920     gbcon178.seq
 249993738     gbcon179.seq
 249997629     gbcon18.seq
 249998234     gbcon180.seq
 249998545     gbcon181.seq
 249998557     gbcon182.seq
 183995859     gbcon183.seq
 249999617     gbcon184.seq
 249999521     gbcon185.seq
 249997880     gbcon186.seq
 249999219     gbcon187.seq
 241842902     gbcon188.seq
 249962598     gbcon189.seq
 249998297     gbcon19.seq
 249989767     gbcon190.seq
 249997881     gbcon191.seq
 248733289     gbcon192.seq
 249999308     gbcon193.seq
 249989167     gbcon194.seq
 249813564     gbcon195.seq
 249999740     gbcon196.seq
  95851619     gbcon197.seq
 249998885     gbcon198.seq
 249999422     gbcon199.seq
 249741088     gbcon2.seq
 249875276     gbcon20.seq
 249999751     gbcon200.seq
 249998203     gbcon201.seq
 178583557     gbcon202.seq
 250000110     gbcon203.seq
 249999468     gbcon204.seq
 249999605     gbcon205.seq
 249999663     gbcon206.seq
 138364205     gbcon207.seq
 249998205     gbcon208.seq
 249997897     gbcon209.seq
 249998514     gbcon21.seq
 249947172     gbcon210.seq
 249884920     gbcon211.seq
 249999045     gbcon212.seq
 148372449     gbcon213.seq
 249979655     gbcon214.seq
 249998788     gbcon215.seq
 249998017     gbcon216.seq
 249998350     gbcon217.seq
 249837497     gbcon218.seq
 249979871     gbcon219.seq
 192469823     gbcon22.seq
  76614724     gbcon220.seq
 249998257     gbcon221.seq
 249994642     gbcon222.seq
 249999210     gbcon223.seq
 249998885     gbcon224.seq
 218944413     gbcon225.seq
 249998544     gbcon226.seq
 249990146     gbcon227.seq
 250000040     gbcon228.seq
 249999811     gbcon229.seq
 249996485     gbcon23.seq
 181329959     gbcon230.seq
 249953393     gbcon231.seq
 249998251     gbcon232.seq
 249995903     gbcon233.seq
 249997908     gbcon234.seq
 249998244     gbcon235.seq
 249998280     gbcon236.seq
 249856326     gbcon237.seq
 249498888     gbcon238.seq
 249999925     gbcon239.seq
 249150042     gbcon24.seq
 249996057     gbcon240.seq
  62967705     gbcon241.seq
  18909137     gbcon242.seq
 134018248     gbcon25.seq
 249998736     gbcon26.seq
 119794062     gbcon27.seq
 249993709     gbcon28.seq
 249890362     gbcon29.seq
 248799977     gbcon3.seq
 249999593     gbcon30.seq
 249990483     gbcon31.seq
 173320925     gbcon32.seq
 249998917     gbcon33.seq
 249996531     gbcon34.seq
 249997326     gbcon35.seq
 249998915     gbcon36.seq
 249999640     gbcon37.seq
 212341562     gbcon38.seq
 249997270     gbcon39.seq
 249999336     gbcon4.seq
 249999221     gbcon40.seq
 249994732     gbcon41.seq
 249996897     gbcon42.seq
 249997078     gbcon43.seq
 249997414     gbcon44.seq
  63412389     gbcon45.seq
 249995423     gbcon46.seq
 249997315     gbcon47.seq
 249997250     gbcon48.seq
 249997590     gbcon49.seq
 249997392     gbcon5.seq
 249996159     gbcon50.seq
  44928861     gbcon51.seq
 249994872     gbcon52.seq
 249995799     gbcon53.seq
 249997684     gbcon54.seq
 249996690     gbcon55.seq
 249997782     gbcon56.seq
  38241897     gbcon57.seq
 249998302     gbcon58.seq
 249999150     gbcon59.seq
 250000045     gbcon6.seq
 249998346     gbcon60.seq
 249994564     gbcon61.seq
 249999492     gbcon62.seq
 154672375     gbcon63.seq
 249999016     gbcon64.seq
 249996777     gbcon65.seq
 249999159     gbcon66.seq
 249995190     gbcon67.seq
 185611272     gbcon68.seq
 249996810     gbcon69.seq
  84912200     gbcon7.seq
 249998700     gbcon70.seq
 249997155     gbcon71.seq
 249997874     gbcon72.seq
 247616447     gbcon73.seq
 249998269     gbcon74.seq
 249995941     gbcon75.seq
 249998068     gbcon76.seq
 249999277     gbcon77.seq
 249999797     gbcon78.seq
  98773033     gbcon79.seq
 249993190     gbcon8.seq
 249997150     gbcon80.seq
 249997442     gbcon81.seq
 249995516     gbcon82.seq
 249996111     gbcon83.seq
 249995971     gbcon84.seq
  64633499     gbcon85.seq
 249998451     gbcon86.seq
 249995859     gbcon87.seq
 249994386     gbcon88.seq
 249994858     gbcon89.seq
 249997980     gbcon9.seq
 249998199     gbcon90.seq
  23638323     gbcon91.seq
 249997115     gbcon92.seq
 249995538     gbcon93.seq
 249998987     gbcon94.seq
 249999150     gbcon95.seq
 199759401     gbcon96.seq
 249994089     gbcon97.seq
 249998565     gbcon98.seq
 249998526     gbcon99.seq
   1019795     gbdel.txt
 249998951     gbenv1.seq
 249999863     gbenv10.seq
 249998982     gbenv11.seq
  60754422     gbenv12.seq
 249999985     gbenv13.seq
 249999567     gbenv14.seq
 250000239     gbenv15.seq
 249999145     gbenv16.seq
 249998770     gbenv17.seq
 249999217     gbenv18.seq
 249998500     gbenv19.seq
 249997032     gbenv2.seq
 237446442     gbenv20.seq
 249997197     gbenv21.seq
 249999771     gbenv22.seq
 249998509     gbenv23.seq
 250000012     gbenv24.seq
 165218490     gbenv25.seq
 249997386     gbenv26.seq
 249936385     gbenv27.seq
 249999061     gbenv28.seq
 249999792     gbenv29.seq
 249998644     gbenv3.seq
 249998451     gbenv30.seq
 249999199     gbenv31.seq
  33590772     gbenv32.seq
 249999624     gbenv33.seq
 249999663     gbenv34.seq
 249999264     gbenv35.seq
 249997438     gbenv36.seq
 187533106     gbenv37.seq
 249999069     gbenv38.seq
 249999148     gbenv39.seq
 249997413     gbenv4.seq
 249997138     gbenv40.seq
 249998482     gbenv41.seq
 249997007     gbenv42.seq
 249997105     gbenv43.seq
  51848409     gbenv44.seq
 249999776     gbenv45.seq
 249999001     gbenv46.seq
 249999752     gbenv47.seq
 249997397     gbenv48.seq
 194687067     gbenv49.seq
 249998738     gbenv5.seq
 249999884     gbenv50.seq
 249996921     gbenv51.seq
 249995842     gbenv52.seq
 249999824     gbenv53.seq
 249999119     gbenv54.seq
  87804093     gbenv55.seq
 249997274     gbenv56.seq
 249997801     gbenv57.seq
 249997093     gbenv58.seq
 250000068     gbenv59.seq
 249999119     gbenv6.seq
 250000189     gbenv60.seq
  17260259     gbenv61.seq
 249998161     gbenv62.seq
 249998477     gbenv63.seq
 249998999     gbenv64.seq
 249998303     gbenv65.seq
 249998037     gbenv66.seq
 197619595     gbenv67.seq
 110936538     gbenv7.seq
 249998673     gbenv8.seq
 249998150     gbenv9.seq
 524289193     gbest1.seq
 524289070     gbest10.seq
 524291865     gbest100.seq
 524288967     gbest101.seq
 524290919     gbest102.seq
 524289030     gbest103.seq
 353284105     gbest104.seq
 524290777     gbest105.seq
 524289380     gbest106.seq
 524292826     gbest107.seq
 382541528     gbest108.seq
 386172137     gbest109.seq
 524290174     gbest11.seq
 379999036     gbest110.seq
 380748277     gbest111.seq
 377679704     gbest112.seq
 381801473     gbest113.seq
 385907364     gbest114.seq
 385235691     gbest115.seq
 384083204     gbest116.seq
 380307268     gbest117.seq
 403319839     gbest118.seq
 479703817     gbest119.seq
 524290765     gbest12.seq
 524289541     gbest120.seq
 524291092     gbest121.seq
 524288720     gbest122.seq
 524292410     gbest123.seq
 470284203     gbest124.seq
 524290864     gbest125.seq
 524291692     gbest126.seq
 524291621     gbest127.seq
 524290649     gbest128.seq
 524289377     gbest129.seq
 144847742     gbest13.seq
 524293126     gbest130.seq
 524290909     gbest131.seq
 524289059     gbest132.seq
 524289004     gbest133.seq
 524290701     gbest134.seq
 524289082     gbest135.seq
 524290849     gbest136.seq
 282357370     gbest137.seq
 524288760     gbest138.seq
 524289210     gbest139.seq
 524290373     gbest14.seq
 524289868     gbest140.seq
 524290812     gbest141.seq
 524292725     gbest142.seq
 524289615     gbest143.seq
 524290658     gbest144.seq
 524292939     gbest145.seq
 524288942     gbest146.seq
 524291326     gbest147.seq
 524291036     gbest148.seq
 524291376     gbest149.seq
 524289723     gbest15.seq
 524290004     gbest150.seq
 457548436     gbest151.seq
 524289000     gbest152.seq
 524291733     gbest153.seq
 524290566     gbest154.seq
 524290704     gbest155.seq
 524289337     gbest156.seq
 524290954     gbest157.seq
 524290797     gbest158.seq
 524288892     gbest159.seq
 524290463     gbest16.seq
 524291589     gbest160.seq
 524290660     gbest161.seq
 524293448     gbest162.seq
 524289475     gbest163.seq
 226923110     gbest164.seq
 524288981     gbest165.seq
 524290153     gbest166.seq
 524290403     gbest167.seq
 524289331     gbest168.seq
 524290442     gbest169.seq
 524291729     gbest17.seq
 524291093     gbest170.seq
 524291620     gbest171.seq
 524291646     gbest172.seq
 524291000     gbest173.seq
 524290874     gbest174.seq
 524291088     gbest175.seq
 524291000     gbest176.seq
 524289976     gbest177.seq
  93513121     gbest178.seq
 524291028     gbest179.seq
 524290477     gbest18.seq
 524290635     gbest180.seq
 524290216     gbest181.seq
 524290144     gbest182.seq
 524289834     gbest183.seq
 524292397     gbest184.seq
 524292162     gbest185.seq
 524289304     gbest186.seq
 524291335     gbest187.seq
 524290091     gbest188.seq
 524288760     gbest189.seq
 524289675     gbest19.seq
 524290685     gbest190.seq
 457661312     gbest191.seq
 524290742     gbest192.seq
 524290548     gbest193.seq
 524291375     gbest194.seq
 524289983     gbest195.seq
 524290719     gbest196.seq
 524291493     gbest197.seq
 524291559     gbest198.seq
 524289857     gbest199.seq
 524289009     gbest2.seq
 524290902     gbest20.seq
 524291247     gbest200.seq
 524289559     gbest201.seq
 524289690     gbest202.seq
 524291629     gbest203.seq
 524290694     gbest204.seq
  54965509     gbest205.seq
 524290419     gbest206.seq
 524289077     gbest207.seq
 524290228     gbest208.seq
 524291154     gbest209.seq
 524288957     gbest21.seq
 524291294     gbest210.seq
 524290210     gbest211.seq
 524289279     gbest212.seq
 524290132     gbest213.seq
 524291066     gbest214.seq
 524290535     gbest215.seq
 395698145     gbest216.seq
 524292673     gbest217.seq
 524289340     gbest218.seq
 524290319     gbest219.seq
 495384086     gbest22.seq
 524290677     gbest220.seq
 524292896     gbest221.seq
 524294572     gbest222.seq
 524290867     gbest223.seq
 524291400     gbest224.seq
 524288805     gbest225.seq
 524290705     gbest226.seq
 524289290     gbest227.seq
 524291100     gbest228.seq
 524290490     gbest229.seq
 490912253     gbest23.seq
 340085374     gbest230.seq
 524291049     gbest231.seq
 524291981     gbest232.seq
 524290208     gbest233.seq
 524290376     gbest234.seq
 524291199     gbest235.seq
 524290847     gbest236.seq
 524289180     gbest237.seq
 524291292     gbest238.seq
 524289298     gbest239.seq
 502279037     gbest24.seq
 524291490     gbest240.seq
 524289379     gbest241.seq
 524289915     gbest242.seq
 524291248     gbest243.seq
 524291302     gbest244.seq
  16293258     gbest245.seq
 524290962     gbest246.seq
 524289438     gbest247.seq
 524292398     gbest248.seq
 524289117     gbest249.seq
 332823872     gbest25.seq
 524289880     gbest250.seq
 524289469     gbest251.seq
 524288754     gbest252.seq
 524290975     gbest253.seq
 524288833     gbest254.seq
 524288937     gbest255.seq
 524290327     gbest256.seq
 251490304     gbest257.seq
 524290121     gbest258.seq
 524290783     gbest259.seq
 524291307     gbest26.seq
 524289338     gbest260.seq
 524288781     gbest261.seq
 524289899     gbest262.seq
 524290963     gbest263.seq
 524289312     gbest264.seq
 524289230     gbest265.seq
 524291931     gbest266.seq
 524291276     gbest267.seq
 279763063     gbest268.seq
 524290968     gbest269.seq
 524288734     gbest27.seq
 524289405     gbest270.seq
 524289904     gbest271.seq
 524289500     gbest272.seq
 524289201     gbest273.seq
 524289342     gbest274.seq
 524289354     gbest275.seq
 524290447     gbest276.seq
 524291301     gbest277.seq
 524290564     gbest278.seq
 524289393     gbest279.seq
 524289041     gbest28.seq
 294022703     gbest280.seq
 524290521     gbest281.seq
 524288774     gbest282.seq
 524291868     gbest283.seq
 524288721     gbest284.seq
 524288848     gbest285.seq
 524289575     gbest286.seq
 524290117     gbest287.seq
 524288800     gbest288.seq
 524289720     gbest289.seq
 524290935     gbest29.seq
 524289510     gbest290.seq
 524289540     gbest291.seq
 214348704     gbest292.seq
 524290890     gbest293.seq
 524290848     gbest294.seq
 524289332     gbest295.seq
 524290757     gbest296.seq
 524289466     gbest297.seq
 524288885     gbest298.seq
 524290710     gbest299.seq
 488098562     gbest3.seq
 524289462     gbest30.seq
 524290573     gbest300.seq
 465293819     gbest301.seq
 473148410     gbest302.seq
 474793383     gbest303.seq
 355124946     gbest304.seq
 524290249     gbest305.seq
 524291232     gbest306.seq
 524289297     gbest307.seq
 524289058     gbest308.seq
 524292405     gbest309.seq
 524289348     gbest31.seq
 524292740     gbest310.seq
 524289598     gbest311.seq
 524289019     gbest312.seq
 524289861     gbest313.seq
 524291240     gbest314.seq
 524290957     gbest315.seq
 524290326     gbest316.seq
 492043820     gbest317.seq
 524290501     gbest318.seq
 524290824     gbest319.seq
 524291326     gbest32.seq
 524289631     gbest320.seq
 524290381     gbest321.seq
 524290724     gbest322.seq
 524289710     gbest323.seq
 524291033     gbest324.seq
 524288728     gbest325.seq
 524289674     gbest326.seq
 513353598     gbest327.seq
 517419695     gbest328.seq
 524289035     gbest329.seq
 524288976     gbest33.seq
 524289610     gbest330.seq
 254749957     gbest331.seq
 524289492     gbest332.seq
 524292132     gbest333.seq
 524289470     gbest334.seq
 524293520     gbest335.seq
 494831165     gbest336.seq
 524289100     gbest337.seq
 524290379     gbest338.seq
 524289939     gbest339.seq
 508405105     gbest34.seq
 524289372     gbest340.seq
 524288984     gbest341.seq
 524288726     gbest342.seq
 524291470     gbest343.seq
 524288763     gbest344.seq
 337183829     gbest345.seq
 524292177     gbest346.seq
 524290645     gbest347.seq
 524289850     gbest348.seq
 524290927     gbest349.seq
 486368039     gbest35.seq
 510947241     gbest350.seq
 524289881     gbest351.seq
 524295493     gbest352.seq
 524293569     gbest353.seq
 524292237     gbest354.seq
 524292503     gbest355.seq
 524291153     gbest356.seq
 524290606     gbest357.seq
 524289311     gbest358.seq
 524290896     gbest359.seq
 488133045     gbest36.seq
  39382490     gbest360.seq
 524289602     gbest361.seq
 524289171     gbest362.seq
 524288761     gbest363.seq
 524291859     gbest364.seq
 524290402     gbest365.seq
 524289853     gbest366.seq
 524290413     gbest367.seq
 524289015     gbest368.seq
 524292096     gbest369.seq
 486997398     gbest37.seq
 524290569     gbest370.seq
 371655341     gbest371.seq
 524291100     gbest372.seq
 524292424     gbest373.seq
 524289434     gbest374.seq
 524289393     gbest375.seq
 524288921     gbest376.seq
 524290453     gbest377.seq
 524290189     gbest378.seq
 524289903     gbest379.seq
 481651880     gbest38.seq
 524290129     gbest380.seq
 524289999     gbest381.seq
 524290755     gbest382.seq
 313093792     gbest383.seq
 524288998     gbest384.seq
 524289862     gbest385.seq
 524289696     gbest386.seq
 524289238     gbest387.seq
 524290094     gbest388.seq
 524288901     gbest389.seq
 485790926     gbest39.seq
 524290113     gbest390.seq
 524290483     gbest391.seq
 524291003     gbest392.seq
 524290590     gbest393.seq
 302750161     gbest394.seq
 524290349     gbest395.seq
 524291434     gbest396.seq
 524290590     gbest397.seq
 524292020     gbest398.seq
 524289333     gbest399.seq
 524290414     gbest4.seq
 133716077     gbest40.seq
 524291273     gbest400.seq
 524291733     gbest401.seq
 524291457     gbest402.seq
 524292635     gbest403.seq
 524289817     gbest404.seq
 524290333     gbest405.seq
 524289101     gbest406.seq
 524289001     gbest407.seq
  72684350     gbest408.seq
 524290012     gbest409.seq
 524292776     gbest41.seq
 524289310     gbest410.seq
 524290180     gbest411.seq
 524290633     gbest412.seq
 524289853     gbest413.seq
 524291548     gbest414.seq
 524288998     gbest415.seq
 524290258     gbest416.seq
 524290948     gbest417.seq
 524289917     gbest418.seq
 524288842     gbest419.seq
 523912358     gbest42.seq
 524290161     gbest420.seq
 441138305     gbest421.seq
 524290340     gbest422.seq
 524290450     gbest423.seq
 524289282     gbest424.seq
 524291230     gbest425.seq
 524293922     gbest426.seq
 524288732     gbest427.seq
 524295043     gbest428.seq
 524290676     gbest429.seq
 524291055     gbest43.seq
 524289990     gbest430.seq
 524289267     gbest431.seq
 524289483     gbest432.seq
 524290852     gbest433.seq
 524289308     gbest434.seq
 524289398     gbest435.seq
  37917980     gbest436.seq
 524290156     gbest437.seq
 524290345     gbest438.seq
 524290610     gbest439.seq
 524289559     gbest44.seq
 524291946     gbest440.seq
 524288804     gbest441.seq
 524289876     gbest442.seq
 524293084     gbest443.seq
 524291441     gbest444.seq
 524290568     gbest445.seq
 524289443     gbest446.seq
 524289664     gbest447.seq
 524289910     gbest448.seq
 139669095     gbest449.seq
 524288740     gbest45.seq
 524290041     gbest450.seq
 524290156     gbest451.seq
 524290638     gbest452.seq
 524289417     gbest453.seq
 524289049     gbest454.seq
 524290227     gbest455.seq
 524289857     gbest456.seq
 524291300     gbest457.seq
 524291046     gbest458.seq
 524290154     gbest459.seq
 524290059     gbest46.seq
 423636328     gbest460.seq
 524289732     gbest461.seq
 524288856     gbest462.seq
 524289000     gbest463.seq
 524290648     gbest464.seq
 524289216     gbest465.seq
 524289357     gbest466.seq
 524289643     gbest467.seq
 524291263     gbest468.seq
 524290004     gbest469.seq
 524289506     gbest47.seq
 524290410     gbest470.seq
 524289116     gbest471.seq
 524289910     gbest472.seq
  23079306     gbest473.seq
 524289938     gbest474.seq
 479160849     gbest475.seq
 524290281     gbest48.seq
 524292417     gbest49.seq
 524289238     gbest5.seq
 524291635     gbest50.seq
 524291906     gbest51.seq
 524292125     gbest52.seq
 524289604     gbest53.seq
 231198840     gbest54.seq
 524290618     gbest55.seq
 524290003     gbest56.seq
 524290356     gbest57.seq
 524291608     gbest58.seq
 524288763     gbest59.seq
 524290797     gbest6.seq
 524291898     gbest60.seq
 524290639     gbest61.seq
 524288733     gbest62.seq
 524290447     gbest63.seq
 524289860     gbest64.seq
 524291903     gbest65.seq
 524289498     gbest66.seq
 442375688     gbest67.seq
 524293079     gbest68.seq
 524290663     gbest69.seq
 524289647     gbest7.seq
 524290995     gbest70.seq
 524290988     gbest71.seq
 524289532     gbest72.seq
 524291440     gbest73.seq
 524288980     gbest74.seq
 524292463     gbest75.seq
 524289051     gbest76.seq
 524291124     gbest77.seq
 524288814     gbest78.seq
 524288787     gbest79.seq
 524290375     gbest8.seq
 156101050     gbest80.seq
 524290521     gbest81.seq
 524289499     gbest82.seq
 524290279     gbest83.seq
 524289561     gbest84.seq
 524289685     gbest85.seq
 524289698     gbest86.seq
 524291479     gbest87.seq
 524289781     gbest88.seq
 524290462     gbest89.seq
 524289528     gbest9.seq
 524289569     gbest90.seq
 524289318     gbest91.seq
 444220708     gbest92.seq
 524289446     gbest93.seq
 524289235     gbest94.seq
 524291162     gbest95.seq
 524290307     gbest96.seq
 524292083     gbest97.seq
 524291436     gbest98.seq
 524290519     gbest99.seq
 524289315     gbgss1.seq
 524291154     gbgss10.seq
 524290498     gbgss100.seq
 524289119     gbgss101.seq
 524290535     gbgss102.seq
 524291239     gbgss103.seq
 410143167     gbgss104.seq
 524291337     gbgss105.seq
 524288765     gbgss106.seq
 524290759     gbgss107.seq
 524289849     gbgss108.seq
 524290490     gbgss109.seq
 524289342     gbgss11.seq
 524289822     gbgss110.seq
 524289593     gbgss111.seq
 524289447     gbgss112.seq
 524289654     gbgss113.seq
 524288894     gbgss114.seq
 524290224     gbgss115.seq
  56569326     gbgss116.seq
 524291550     gbgss117.seq
 524291931     gbgss118.seq
 524289825     gbgss119.seq
 524292891     gbgss12.seq
 524289525     gbgss120.seq
 524288961     gbgss121.seq
 524291261     gbgss122.seq
 524289628     gbgss123.seq
 524290787     gbgss124.seq
 524290199     gbgss125.seq
 524290634     gbgss126.seq
 524290980     gbgss127.seq
 524290838     gbgss128.seq
 189717258     gbgss129.seq
 524289112     gbgss13.seq
 524289138     gbgss130.seq
 524288819     gbgss131.seq
 524289552     gbgss132.seq
 524291735     gbgss133.seq
 524289477     gbgss134.seq
 524290788     gbgss135.seq
 524289202     gbgss136.seq
 524292004     gbgss137.seq
 524290342     gbgss138.seq
 498434500     gbgss139.seq
 524291771     gbgss14.seq
 498431130     gbgss140.seq
 173778245     gbgss141.seq
 524289050     gbgss142.seq
 524289608     gbgss143.seq
 524289995     gbgss144.seq
 524289438     gbgss145.seq
 524289091     gbgss146.seq
 524290404     gbgss147.seq
 524290257     gbgss148.seq
 524290050     gbgss149.seq
 524290148     gbgss15.seq
 524290618     gbgss150.seq
 524290065     gbgss151.seq
 309751425     gbgss152.seq
 524290283     gbgss153.seq
 524290760     gbgss154.seq
 524288855     gbgss155.seq
 524290480     gbgss156.seq
 524290694     gbgss157.seq
 524289107     gbgss158.seq
 524290148     gbgss159.seq
 524291399     gbgss16.seq
 524291106     gbgss160.seq
 524290184     gbgss161.seq
 524290360     gbgss162.seq
 476564359     gbgss163.seq
 249997482     gbgss164.seq
 249997578     gbgss165.seq
 249998323     gbgss166.seq
 249998822     gbgss167.seq
  31027725     gbgss168.seq
 249997137     gbgss169.seq
 524288886     gbgss17.seq
 250000033     gbgss170.seq
 249998542     gbgss171.seq
 249998333     gbgss172.seq
 224919493     gbgss173.seq
 249998415     gbgss174.seq
 249998695     gbgss175.seq
 249998511     gbgss176.seq
 249998820     gbgss177.seq
 193605649     gbgss178.seq
 249998797     gbgss179.seq
 524289019     gbgss18.seq
 249999676     gbgss180.seq
 249999350     gbgss181.seq
 249998311     gbgss182.seq
 249999133     gbgss183.seq
  77264647     gbgss184.seq
 249999835     gbgss185.seq
   2112081     gbgss186.seq
  80345119     gbgss187.seq
 249999264     gbgss188.seq
 249998538     gbgss189.seq
 297762970     gbgss19.seq
  87602941     gbgss190.seq
 249999685     gbgss191.seq
 249998355     gbgss192.seq
 249998971     gbgss193.seq
 203257936     gbgss194.seq
 249999232     gbgss195.seq
 249998813     gbgss196.seq
 249999964     gbgss197.seq
 246326993     gbgss198.seq
 249997836     gbgss199.seq
 524288869     gbgss2.seq
 524289513     gbgss20.seq
 249999647     gbgss200.seq
 249998223     gbgss201.seq
 244710946     gbgss202.seq
 249999336     gbgss203.seq
 250000173     gbgss204.seq
 249997063     gbgss205.seq
 249999769     gbgss206.seq
 126496662     gbgss207.seq
 249998013     gbgss208.seq
 249999792     gbgss209.seq
 524290941     gbgss21.seq
 250000106     gbgss210.seq
 250000092     gbgss211.seq
  96070744     gbgss212.seq
 249999742     gbgss213.seq
 249999443     gbgss214.seq
 249998678     gbgss215.seq
 249998232     gbgss216.seq
 249999410     gbgss217.seq
 143584932     gbgss218.seq
 249999236     gbgss219.seq
 524288790     gbgss22.seq
 249997993     gbgss220.seq
 249998006     gbgss221.seq
 249999353     gbgss222.seq
  95926739     gbgss223.seq
 249999461     gbgss224.seq
 249999350     gbgss225.seq
 249998406     gbgss226.seq
 249998619     gbgss227.seq
 249999398     gbgss228.seq
 249998781     gbgss229.seq
 524289135     gbgss23.seq
  99553479     gbgss230.seq
 249999424     gbgss231.seq
 249999963     gbgss232.seq
 249997369     gbgss233.seq
  43648880     gbgss234.seq
  52925443     gbgss235.seq
 249999935     gbgss236.seq
 249999198     gbgss237.seq
 249999740     gbgss238.seq
 249997692     gbgss239.seq
 524288750     gbgss24.seq
 249999122     gbgss240.seq
  64012996     gbgss241.seq
 249997670     gbgss242.seq
 249997588     gbgss243.seq
 249999018     gbgss244.seq
 250000000     gbgss245.seq
  28042636     gbgss246.seq
 249997661     gbgss247.seq
 250000032     gbgss248.seq
 249999742     gbgss249.seq
 524290248     gbgss25.seq
 249997181     gbgss250.seq
 249998354     gbgss251.seq
 249998915     gbgss252.seq
 196108583     gbgss253.seq
 249998299     gbgss254.seq
 249998824     gbgss255.seq
 249998817     gbgss256.seq
 225684315     gbgss257.seq
 250000034     gbgss258.seq
 249999411     gbgss259.seq
 524289104     gbgss26.seq
 249998949     gbgss260.seq
 249998290     gbgss261.seq
 249997495     gbgss262.seq
  66032843     gbgss263.seq
 249999961     gbgss264.seq
 249999246     gbgss265.seq
 249997183     gbgss266.seq
 249998878     gbgss267.seq
 249998009     gbgss268.seq
 249998219     gbgss269.seq
 524290487     gbgss27.seq
 249998776     gbgss270.seq
 213344774     gbgss271.seq
 249999562     gbgss272.seq
 249998752     gbgss273.seq
 249999600     gbgss274.seq
 249999029     gbgss275.seq
 221982324     gbgss276.seq
 249999329     gbgss277.seq
 249998347     gbgss278.seq
 249998273     gbgss279.seq
 524292149     gbgss28.seq
 249999290     gbgss280.seq
 249998381     gbgss281.seq
 249999859     gbgss282.seq
 249998253     gbgss283.seq
 135775426     gbgss284.seq
 524289890     gbgss29.seq
 524291421     gbgss3.seq
 524289664     gbgss30.seq
  26997333     gbgss31.seq
 524290550     gbgss32.seq
 524289799     gbgss33.seq
 524290542     gbgss34.seq
 524289125     gbgss35.seq
 524288800     gbgss36.seq
 524290886     gbgss37.seq
 524289168     gbgss38.seq
 490804450     gbgss39.seq
 524290271     gbgss4.seq
 524290996     gbgss40.seq
 524289799     gbgss41.seq
 524288765     gbgss42.seq
  20500067     gbgss43.seq
 524290183     gbgss44.seq
 524289612     gbgss45.seq
 524289301     gbgss46.seq
 524289437     gbgss47.seq
 216512324     gbgss48.seq
 524290958     gbgss49.seq
 159850274     gbgss5.seq
 524290909     gbgss50.seq
 524289412     gbgss51.seq
 524290739     gbgss52.seq
 524289834     gbgss53.seq
 524289164     gbgss54.seq
 524291333     gbgss55.seq
 524290062     gbgss56.seq
 524289247     gbgss57.seq
 524289683     gbgss58.seq
 524290935     gbgss59.seq
 524291261     gbgss6.seq
  15397834     gbgss60.seq
 524288929     gbgss61.seq
 524291351     gbgss62.seq
 524290228     gbgss63.seq
 455302064     gbgss64.seq
 524290785     gbgss65.seq
 524291354     gbgss66.seq
 524288830     gbgss67.seq
 524291033     gbgss68.seq
 524291591     gbgss69.seq
 524291565     gbgss7.seq
 524291610     gbgss70.seq
 524292756     gbgss71.seq
 524289912     gbgss72.seq
 524289201     gbgss73.seq
 524291074     gbgss74.seq
 524289836     gbgss75.seq
 524291258     gbgss76.seq
  31769518     gbgss77.seq
 524290222     gbgss78.seq
 524291707     gbgss79.seq
 524291443     gbgss8.seq
 524289729     gbgss80.seq
 524288863     gbgss81.seq
 524290057     gbgss82.seq
 524293253     gbgss83.seq
 524290068     gbgss84.seq
 524289753     gbgss85.seq
 524289707     gbgss86.seq
 524291951     gbgss87.seq
 524292283     gbgss88.seq
 378623321     gbgss89.seq
 524290232     gbgss9.seq
 524291901     gbgss90.seq
 524290362     gbgss91.seq
 524292086     gbgss92.seq
 524288786     gbgss93.seq
 524289801     gbgss94.seq
 524292129     gbgss95.seq
 524289978     gbgss96.seq
 524290646     gbgss97.seq
 524288940     gbgss98.seq
 524288752     gbgss99.seq
 249986576     gbhtc1.seq
 249993764     gbhtc10.seq
 249999382     gbhtc11.seq
 106880201     gbhtc12.seq
 249997337     gbhtc13.seq
 249994823     gbhtc14.seq
 108614108     gbhtc15.seq
 249998271     gbhtc2.seq
 249993125     gbhtc3.seq
 249988171     gbhtc4.seq
 249990143     gbhtc5.seq
 249997249     gbhtc6.seq
 249999642     gbhtc7.seq
  83909310     gbhtc8.seq
 249999327     gbhtc9.seq
 249909505     gbhtg1.seq
 249953472     gbhtg10.seq
 249912301     gbhtg100.seq
 249866447     gbhtg101.seq
 249548804     gbhtg102.seq
 249948054     gbhtg103.seq
   3703991     gbhtg104.seq
 249884211     gbhtg105.seq
 249900259     gbhtg106.seq
 249867899     gbhtg107.seq
 249995189     gbhtg108.seq
 249886016     gbhtg109.seq
    799345     gbhtg11.seq
 249923344     gbhtg110.seq
 168251668     gbhtg111.seq
 249862269     gbhtg112.seq
 249854435     gbhtg113.seq
 249790554     gbhtg114.seq
 249920554     gbhtg115.seq
 249895428     gbhtg116.seq
 249862848     gbhtg117.seq
 249858084     gbhtg118.seq
 153884177     gbhtg119.seq
 249888187     gbhtg12.seq
 249962822     gbhtg120.seq
 249846591     gbhtg121.seq
 249887638     gbhtg122.seq
 249981361     gbhtg123.seq
 249869011     gbhtg124.seq
 104652177     gbhtg125.seq
 249860737     gbhtg126.seq
 249838185     gbhtg127.seq
 249821150     gbhtg128.seq
 249911176     gbhtg129.seq
 249968064     gbhtg13.seq
 249980071     gbhtg130.seq
 134314079     gbhtg131.seq
 249758420     gbhtg132.seq
 249967218     gbhtg133.seq
 249811313     gbhtg134.seq
 249704215     gbhtg135.seq
 249927315     gbhtg136.seq
 249893362     gbhtg137.seq
 249886807     gbhtg138.seq
 249916836     gbhtg139.seq
 249584228     gbhtg14.seq
 249970562     gbhtg140.seq
 145088094     gbhtg141.seq
 249771919     gbhtg15.seq
 249739055     gbhtg16.seq
 249165958     gbhtg17.seq
 249979906     gbhtg18.seq
 249677324     gbhtg19.seq
 249996486     gbhtg2.seq
 249986017     gbhtg20.seq
 237141712     gbhtg21.seq
 249756771     gbhtg22.seq
 249864520     gbhtg23.seq
 249983387     gbhtg24.seq
 249918012     gbhtg25.seq
 249757014     gbhtg26.seq
 249887993     gbhtg27.seq
 249957984     gbhtg28.seq
 249838499     gbhtg29.seq
 249996436     gbhtg3.seq
 249989483     gbhtg30.seq
 225321816     gbhtg31.seq
 249823600     gbhtg32.seq
 249917667     gbhtg33.seq
 249925852     gbhtg34.seq
 249914652     gbhtg35.seq
 249854015     gbhtg36.seq
 249811756     gbhtg37.seq
 249764947     gbhtg38.seq
 249624028     gbhtg39.seq
 249972999     gbhtg4.seq
 249836495     gbhtg40.seq
 224361298     gbhtg41.seq
 249887671     gbhtg42.seq
 249786976     gbhtg43.seq
 249974543     gbhtg44.seq
 249775813     gbhtg45.seq
 249970955     gbhtg46.seq
 249705994     gbhtg47.seq
 249864015     gbhtg48.seq
 249890348     gbhtg49.seq
 249908886     gbhtg5.seq
 249899940     gbhtg50.seq
 234810590     gbhtg51.seq
 249734880     gbhtg52.seq
 249975082     gbhtg53.seq
 249785116     gbhtg54.seq
 249720701     gbhtg55.seq
 249959684     gbhtg56.seq
  18795824     gbhtg57.seq
 249859967     gbhtg58.seq
 249826514     gbhtg59.seq
 249993239     gbhtg6.seq
 249998070     gbhtg60.seq
 249924538     gbhtg61.seq
 225131064     gbhtg62.seq
 249972686     gbhtg63.seq
 249907389     gbhtg64.seq
 249800872     gbhtg65.seq
 249764849     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249979624     gbhtg69.seq
 249808932     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249765361     gbhtg72.seq
 223423710     gbhtg73.seq
 249942316     gbhtg74.seq
 249842912     gbhtg75.seq
 249912111     gbhtg76.seq
 249849341     gbhtg77.seq
 235439678     gbhtg78.seq
 249876256     gbhtg79.seq
 249827069     gbhtg8.seq
 249973643     gbhtg80.seq
 249883625     gbhtg81.seq
 249894302     gbhtg82.seq
 202307563     gbhtg83.seq
 249860907     gbhtg84.seq
 249957364     gbhtg85.seq
 249853361     gbhtg86.seq
 249877976     gbhtg87.seq
 206015973     gbhtg88.seq
 249886758     gbhtg89.seq
 249952731     gbhtg9.seq
 249869327     gbhtg90.seq
 249776257     gbhtg91.seq
 249874994     gbhtg92.seq
 194411500     gbhtg93.seq
 249975900     gbhtg94.seq
 250000054     gbhtg95.seq
 249903804     gbhtg96.seq
 249804916     gbhtg97.seq
 161658952     gbhtg98.seq
 249871688     gbhtg99.seq
 249998152     gbinv1.seq
 249999446     gbinv10.seq
 249997821     gbinv11.seq
 195932475     gbinv12.seq
 249997948     gbinv13.seq
 249997472     gbinv14.seq
 249998142     gbinv15.seq
 163695503     gbinv16.seq
 249997465     gbinv17.seq
 249285777     gbinv18.seq
 249999596     gbinv19.seq
 249855924     gbinv2.seq
 249997947     gbinv20.seq
 249997650     gbinv21.seq
  27516834     gbinv22.seq
 228831546     gbinv23.seq
 175506967     gbinv24.seq
 249998441     gbinv25.seq
 249998111     gbinv26.seq
 184982485     gbinv27.seq
 249997626     gbinv28.seq
 249997843     gbinv29.seq
 249989317     gbinv3.seq
 250000162     gbinv30.seq
 249999431     gbinv31.seq
 109512985     gbinv32.seq
 249984656     gbinv33.seq
 249998794     gbinv34.seq
 249999808     gbinv35.seq
 249998861     gbinv36.seq
 249966812     gbinv37.seq
  24280066     gbinv38.seq
 206595649     gbinv4.seq
 249995191     gbinv5.seq
 249997259     gbinv6.seq
 249857401     gbinv7.seq
 168014980     gbinv8.seq
 249999548     gbinv9.seq
 249777092     gbmam1.seq
 249999160     gbmam2.seq
 249998884     gbmam3.seq
 249999306     gbmam4.seq
 249556130     gbmam5.seq
 249998010     gbmam6.seq
 249999935     gbmam7.seq
 238646790     gbmam8.seq
  41504147     gbnew.txt
 249993144     gbpat1.seq
 249999172     gbpat10.seq
 249999065     gbpat100.seq
 249999793     gbpat101.seq
 149112469     gbpat102.seq
 249999880     gbpat103.seq
 249999565     gbpat104.seq
 249929731     gbpat105.seq
 249824879     gbpat106.seq
 249998856     gbpat107.seq
 192960443     gbpat108.seq
 249999432     gbpat109.seq
 179930034     gbpat11.seq
 249999649     gbpat110.seq
 249998122     gbpat111.seq
  80207067     gbpat112.seq
 249999882     gbpat113.seq
 249999902     gbpat114.seq
 249984827     gbpat115.seq
 250000067     gbpat116.seq
 249951788     gbpat117.seq
  66835452     gbpat118.seq
 249999441     gbpat119.seq
 249999276     gbpat12.seq
 249999845     gbpat120.seq
 249999888     gbpat121.seq
 249999095     gbpat122.seq
 160256390     gbpat123.seq
 249999974     gbpat124.seq
 249999633     gbpat125.seq
 234784218     gbpat126.seq
 249991591     gbpat127.seq
 249970935     gbpat128.seq
 249999681     gbpat129.seq
 249996781     gbpat13.seq
 249997397     gbpat130.seq
 249997452     gbpat131.seq
  66832984     gbpat132.seq
 249992315     gbpat133.seq
 249999867     gbpat134.seq
 250000197     gbpat135.seq
 249999821     gbpat136.seq
 249998337     gbpat137.seq
  18437114     gbpat138.seq
 249999655     gbpat139.seq
 249999544     gbpat14.seq
 249998828     gbpat140.seq
 249999803     gbpat141.seq
 249999630     gbpat142.seq
  46945969     gbpat143.seq
 249999271     gbpat144.seq
 249999873     gbpat145.seq
 249999008     gbpat146.seq
 234349056     gbpat147.seq
 249999644     gbpat148.seq
 249999868     gbpat149.seq
 249999181     gbpat15.seq
 249999649     gbpat150.seq
  86184716     gbpat151.seq
 249999922     gbpat152.seq
 249999841     gbpat153.seq
 250000191     gbpat154.seq
  63653556     gbpat155.seq
 249996236     gbpat156.seq
 249999350     gbpat157.seq
 249999971     gbpat158.seq
 249994418     gbpat159.seq
 249998873     gbpat16.seq
 249998977     gbpat160.seq
 249996021     gbpat161.seq
 223159005     gbpat162.seq
 250000249     gbpat163.seq
 249999893     gbpat164.seq
 249999893     gbpat165.seq
 220539897     gbpat166.seq
 249999753     gbpat167.seq
 249997611     gbpat168.seq
 249999823     gbpat169.seq
  65969706     gbpat17.seq
  12461035     gbpat170.seq
 250000070     gbpat171.seq
 249998660     gbpat172.seq
 249999647     gbpat173.seq
 249999058     gbpat174.seq
 249999511     gbpat175.seq
 249999932     gbpat176.seq
 249999978     gbpat177.seq
 160384480     gbpat178.seq
 249999807     gbpat179.seq
 250000027     gbpat18.seq
 249997518     gbpat180.seq
 249999334     gbpat181.seq
 249997515     gbpat182.seq
 214724818     gbpat183.seq
 249992103     gbpat184.seq
 249199193     gbpat185.seq
 250000037     gbpat186.seq
 249998567     gbpat187.seq
 249885329     gbpat188.seq
 249999609     gbpat189.seq
 249999801     gbpat19.seq
 249999763     gbpat190.seq
 249973432     gbpat191.seq
 240982255     gbpat192.seq
  79434127     gbpat193.seq
 250000255     gbpat194.seq
 249999944     gbpat195.seq
 249998943     gbpat196.seq
 249999396     gbpat197.seq
  64007850     gbpat198.seq
 249998389     gbpat199.seq
 249999989     gbpat2.seq
 249999814     gbpat20.seq
 249999272     gbpat200.seq
 249999247     gbpat201.seq
 250000259     gbpat202.seq
 249999703     gbpat203.seq
 125566387     gbpat204.seq
 249996002     gbpat21.seq
 186235459     gbpat22.seq
 250000146     gbpat23.seq
 249792773     gbpat24.seq
 249999815     gbpat25.seq
 249999511     gbpat26.seq
  71626031     gbpat27.seq
 249999073     gbpat28.seq
 249992859     gbpat29.seq
 249998811     gbpat3.seq
 249998716     gbpat30.seq
 249999327     gbpat31.seq
 249996065     gbpat32.seq
 180378931     gbpat33.seq
 249998252     gbpat34.seq
 249998510     gbpat35.seq
 249999971     gbpat36.seq
 249998949     gbpat37.seq
 249999232     gbpat38.seq
  53349900     gbpat39.seq
 249999974     gbpat4.seq
 249998793     gbpat40.seq
 249953077     gbpat41.seq
 249999930     gbpat42.seq
 249999702     gbpat43.seq
 249994239     gbpat44.seq
 249925447     gbpat45.seq
 249999213     gbpat46.seq
 249996348     gbpat47.seq
 171736893     gbpat48.seq
 249999729     gbpat49.seq
  71727149     gbpat5.seq
 249999139     gbpat50.seq
 249996276     gbpat51.seq
 249999732     gbpat52.seq
 222942647     gbpat53.seq
 249999057     gbpat54.seq
 249999815     gbpat55.seq
 250000246     gbpat56.seq
 165005166     gbpat57.seq
 249905245     gbpat58.seq
 249999451     gbpat59.seq
 249999527     gbpat6.seq
 249998650     gbpat60.seq
 249999960     gbpat61.seq
 135380782     gbpat62.seq
 249998912     gbpat63.seq
 249998801     gbpat64.seq
 249997619     gbpat65.seq
 249998578     gbpat66.seq
 249999274     gbpat67.seq
 249999337     gbpat68.seq
 144894652     gbpat69.seq
 249999618     gbpat7.seq
 249999757     gbpat70.seq
 249999899     gbpat71.seq
 249998837     gbpat72.seq
 244414184     gbpat73.seq
 248969093     gbpat74.seq
 244459306     gbpat75.seq
 247876384     gbpat76.seq
 249999624     gbpat77.seq
 160624439     gbpat78.seq
 250000121     gbpat79.seq
 249997868     gbpat8.seq
 249999657     gbpat80.seq
 249999470     gbpat81.seq
 249999644     gbpat82.seq
 250000006     gbpat83.seq
 249998950     gbpat84.seq
  93401801     gbpat85.seq
 249159339     gbpat86.seq
 249999669     gbpat87.seq
 249999430     gbpat88.seq
 249999380     gbpat89.seq
 250000136     gbpat9.seq
 249999163     gbpat90.seq
 249999627     gbpat91.seq
 145305049     gbpat92.seq
 250000061     gbpat93.seq
 249998964     gbpat94.seq
 249999939     gbpat95.seq
 250000257     gbpat96.seq
 196970502     gbpat97.seq
 249999051     gbpat98.seq
 249998995     gbpat99.seq
 249931159     gbphg1.seq
  70064792     gbphg2.seq
 249999776     gbpln1.seq
  21699822     gbpln10.seq
 249997374     gbpln11.seq
 249999881     gbpln12.seq
 249999089     gbpln13.seq
 249911220     gbpln14.seq
 215757577     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
 249740749     gbpln19.seq
 249949156     gbpln2.seq
 249776480     gbpln20.seq
 249153400     gbpln21.seq
 249675596     gbpln22.seq
  72209094     gbpln23.seq
 249999356     gbpln24.seq
 100115974     gbpln25.seq
 249997485     gbpln26.seq
 249996692     gbpln27.seq
 249092086     gbpln28.seq
 222506700     gbpln29.seq
 249919974     gbpln3.seq
 181013464     gbpln30.seq
 247158447     gbpln31.seq
 249998640     gbpln32.seq
 247145968     gbpln33.seq
 250000133     gbpln34.seq
 249997182     gbpln35.seq
 184262124     gbpln36.seq
 249998946     gbpln37.seq
 249998643     gbpln38.seq
 249999252     gbpln39.seq
 249894046     gbpln4.seq
 249997622     gbpln40.seq
 145623133     gbpln41.seq
 249997819     gbpln42.seq
 249998580     gbpln43.seq
 249999889     gbpln44.seq
 249999522     gbpln45.seq
 249970163     gbpln46.seq
 239164129     gbpln47.seq
 249997681     gbpln48.seq
 248282368     gbpln49.seq
 249883720     gbpln5.seq
 249998832     gbpln50.seq
 249999249     gbpln51.seq
 249999091     gbpln52.seq
 222478592     gbpln53.seq
 250000022     gbpln54.seq
 249999780     gbpln55.seq
 249997528     gbpln56.seq
 249997683     gbpln57.seq
 249994752     gbpln58.seq
   2169551     gbpln59.seq
 249995127     gbpln6.seq
 249997532     gbpln60.seq
 249998597     gbpln61.seq
 249998916     gbpln62.seq
 249998209     gbpln63.seq
 249995897     gbpln64.seq
 249998280     gbpln65.seq
 249998246     gbpln66.seq
  67329434     gbpln67.seq
 249952132     gbpln7.seq
 250000129     gbpln8.seq
 249999749     gbpln9.seq
 149065971     gbpri1.seq
 249853652     gbpri10.seq
 137124155     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249865833     gbpri16.seq
 249867629     gbpri17.seq
 249758014     gbpri18.seq
 249922775     gbpri19.seq
 249820418     gbpri2.seq
 249959135     gbpri20.seq
 249968787     gbpri21.seq
 249996715     gbpri22.seq
  78167662     gbpri23.seq
 177509853     gbpri24.seq
 249999885     gbpri25.seq
 211357951     gbpri26.seq
 249925296     gbpri27.seq
 249919042     gbpri28.seq
 249998469     gbpri29.seq
 249844054     gbpri3.seq
 249893395     gbpri30.seq
 249950984     gbpri31.seq
 249970932     gbpri32.seq
 249999192     gbpri33.seq
 249996566     gbpri34.seq
  27100713     gbpri35.seq
 249993971     gbpri36.seq
 249995513     gbpri37.seq
 249732881     gbpri38.seq
 249998300     gbpri39.seq
 249837691     gbpri4.seq
 249998977     gbpri40.seq
 190597184     gbpri41.seq
 249999938     gbpri42.seq
 249982669     gbpri43.seq
 249977485     gbpri44.seq
 249999493     gbpri45.seq
 250000152     gbpri46.seq
  71630510     gbpri47.seq
 249991244     gbpri5.seq
 249848578     gbpri6.seq
 249979373     gbpri7.seq
 249847832     gbpri8.seq
 249917715     gbpri9.seq
    342297     gbrel.txt
 249897615     gbrod1.seq
 249913433     gbrod10.seq
  70195161     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249939922     gbrod18.seq
 249999712     gbrod19.seq
 249994279     gbrod2.seq
   5744990     gbrod20.seq
 249863998     gbrod21.seq
 249753433     gbrod22.seq
 191021026     gbrod23.seq
 249998557     gbrod24.seq
 249995595     gbrod25.seq
 249786180     gbrod26.seq
 249851679     gbrod27.seq
 249999191     gbrod28.seq
 249999651     gbrod29.seq
 249937340     gbrod3.seq
 249998199     gbrod30.seq
  58372828     gbrod31.seq
 249913341     gbrod4.seq
 249947653     gbrod5.seq
 249871866     gbrod6.seq
 249803759     gbrod7.seq
 249850467     gbrod8.seq
 249987192     gbrod9.seq
 249998611     gbsts1.seq
 249997655     gbsts10.seq
 210923828     gbsts11.seq
 249996524     gbsts12.seq
 249998980     gbsts13.seq
 249998353     gbsts14.seq
 249998542     gbsts15.seq
  24568364     gbsts16.seq
 250000234     gbsts17.seq
 250000192     gbsts18.seq
 249999850     gbsts19.seq
 249999002     gbsts2.seq
 150145389     gbsts20.seq
 249999132     gbsts3.seq
 249996463     gbsts4.seq
  39640276     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998399     gbsts9.seq
 249993959     gbsyn1.seq
 249998008     gbsyn2.seq
 249955819     gbsyn3.seq
 249963412     gbsyn4.seq
 249953723     gbsyn5.seq
 249969489     gbsyn6.seq
 196231585     gbsyn7.seq
 249999306     gbtsa1.seq
  60675734     gbtsa10.seq
 249998116     gbtsa100.seq
 249996546     gbtsa101.seq
 249998529     gbtsa102.seq
 249998891     gbtsa103.seq
 227698825     gbtsa104.seq
 249998448     gbtsa105.seq
 250000256     gbtsa106.seq
 249999226     gbtsa107.seq
 249999824     gbtsa108.seq
 249998732     gbtsa109.seq
 249999071     gbtsa11.seq
   1347714     gbtsa110.seq
 249998403     gbtsa111.seq
 249999879     gbtsa112.seq
 249998407     gbtsa113.seq
 220793968     gbtsa114.seq
 249989678     gbtsa115.seq
 249996801     gbtsa116.seq
 249998091     gbtsa117.seq
 249999633     gbtsa118.seq
 249999198     gbtsa119.seq
 250000023     gbtsa12.seq
 249999901     gbtsa120.seq
 143845765     gbtsa121.seq
 249999536     gbtsa122.seq
 249998915     gbtsa123.seq
 250000174     gbtsa124.seq
 249999584     gbtsa125.seq
 249997105     gbtsa126.seq
 196200322     gbtsa127.seq
 249999600     gbtsa128.seq
 249996475     gbtsa129.seq
 249997385     gbtsa13.seq
 249999082     gbtsa130.seq
 249997225     gbtsa131.seq
 133007668     gbtsa132.seq
 249995766     gbtsa133.seq
 249998592     gbtsa134.seq
 249999280     gbtsa135.seq
 249998165     gbtsa136.seq
  38380736     gbtsa137.seq
 249997812     gbtsa138.seq
 249995988     gbtsa139.seq
 249998555     gbtsa14.seq
 249997093     gbtsa140.seq
 249997781     gbtsa141.seq
 250000172     gbtsa142.seq
 249999793     gbtsa143.seq
 250000004     gbtsa144.seq
  97131017     gbtsa145.seq
 249997377     gbtsa146.seq
 249999330     gbtsa147.seq
 249998405     gbtsa148.seq
 250000046     gbtsa149.seq
 140774713     gbtsa15.seq
 129993581     gbtsa150.seq
 249998439     gbtsa16.seq
 249999377     gbtsa17.seq
 249999801     gbtsa18.seq
 249999676     gbtsa19.seq
 250000222     gbtsa2.seq
 119733200     gbtsa20.seq
 249998989     gbtsa21.seq
 249996697     gbtsa22.seq
 250000256     gbtsa23.seq
 249994931     gbtsa24.seq
 176122803     gbtsa25.seq
 249999789     gbtsa26.seq
 250000085     gbtsa27.seq
 249999102     gbtsa28.seq
 249999097     gbtsa29.seq
 249998128     gbtsa3.seq
 249999491     gbtsa30.seq
 249997811     gbtsa31.seq
  42369748     gbtsa32.seq
 249998838     gbtsa33.seq
 250000120     gbtsa34.seq
 249997735     gbtsa35.seq
 249997498     gbtsa36.seq
 249998198     gbtsa37.seq
 249998877     gbtsa38.seq
 249998290     gbtsa39.seq
 249999603     gbtsa4.seq
  34398944     gbtsa40.seq
 249999415     gbtsa41.seq
 249998692     gbtsa42.seq
 249999756     gbtsa43.seq
 249999818     gbtsa44.seq
  77518171     gbtsa45.seq
 249999788     gbtsa46.seq
 249999999     gbtsa47.seq
 250000110     gbtsa48.seq
 249999008     gbtsa49.seq
 151829756     gbtsa5.seq
 143919188     gbtsa50.seq
 250000009     gbtsa51.seq
 250000171     gbtsa52.seq
 249999270     gbtsa53.seq
 249999004     gbtsa54.seq
 250000194     gbtsa55.seq
 249999829     gbtsa56.seq
 249998979     gbtsa57.seq
 245785734     gbtsa58.seq
 249999221     gbtsa59.seq
 249997875     gbtsa6.seq
 249998419     gbtsa60.seq
 250000220     gbtsa61.seq
 250000087     gbtsa62.seq
 249999517     gbtsa63.seq
 249999556     gbtsa64.seq
 232931848     gbtsa65.seq
 249999409     gbtsa66.seq
 249999138     gbtsa67.seq
 249998170     gbtsa68.seq
 249998697     gbtsa69.seq
 249998005     gbtsa7.seq
 249995875     gbtsa70.seq
 249998691     gbtsa71.seq
 182955533     gbtsa72.seq
 249999311     gbtsa73.seq
 249997345     gbtsa74.seq
 249996296     gbtsa75.seq
 249998542     gbtsa76.seq
 249997998     gbtsa77.seq
 103287176     gbtsa78.seq
 249998752     gbtsa79.seq
 249998029     gbtsa8.seq
 249998189     gbtsa80.seq
 249997886     gbtsa81.seq
 249992593     gbtsa82.seq
 249997814     gbtsa83.seq
  41122662     gbtsa84.seq
 249999310     gbtsa85.seq
 249999938     gbtsa86.seq
 249999285     gbtsa87.seq
 249999199     gbtsa88.seq
 201625362     gbtsa89.seq
 249997338     gbtsa9.seq
 249994299     gbtsa90.seq
 249999674     gbtsa91.seq
 249997982     gbtsa92.seq
 249999245     gbtsa93.seq
 249997038     gbtsa94.seq
 249999884     gbtsa95.seq
 249999225     gbtsa96.seq
 106366042     gbtsa97.seq
 249999742     gbtsa98.seq
 249999339     gbtsa99.seq
    557490     gbuna1.seq
 249999203     gbvrl1.seq
 250000021     gbvrl10.seq
 249999200     gbvrl11.seq
 249998807     gbvrl12.seq
 208625907     gbvrl13.seq
 249994511     gbvrl14.seq
 249996228     gbvrl15.seq
 249998454     gbvrl16.seq
 249998356     gbvrl17.seq
 209114209     gbvrl18.seq
 250000152     gbvrl19.seq
 249998487     gbvrl2.seq
 249998943     gbvrl20.seq
 249998759     gbvrl21.seq
 249999838     gbvrl22.seq
 130252032     gbvrl23.seq
 249995267     gbvrl24.seq
 249997114     gbvrl25.seq
 249876888     gbvrl26.seq
 249999899     gbvrl27.seq
 249999401     gbvrl28.seq
 160966284     gbvrl29.seq
 249999468     gbvrl3.seq
 249998000     gbvrl4.seq
 249997073     gbvrl5.seq
  38212361     gbvrl6.seq
 249997871     gbvrl7.seq
 249998274     gbvrl8.seq
 250000201     gbvrl9.seq
 249794379     gbvrt1.seq
 249971322     gbvrt10.seq
 249921207     gbvrt11.seq
 153646555     gbvrt12.seq
 249890922     gbvrt13.seq
 249998005     gbvrt14.seq
 249951075     gbvrt15.seq
 249998141     gbvrt16.seq
 249999324     gbvrt17.seq
 249997255     gbvrt18.seq
  76761179     gbvrt19.seq
 249876679     gbvrt2.seq
 249988068     gbvrt20.seq
 249997851     gbvrt21.seq
 249999634     gbvrt22.seq
 249996615     gbvrt23.seq
 249996790     gbvrt24.seq
  91608894     gbvrt25.seq
 249998984     gbvrt26.seq
 249991889     gbvrt27.seq
 249999040     gbvrt28.seq
 249998991     gbvrt29.seq
 249999355     gbvrt3.seq
 249998441     gbvrt30.seq
 249998815     gbvrt31.seq
  45862127     gbvrt32.seq
 249801712     gbvrt4.seq
 158193658     gbvrt5.seq
 249992797     gbvrt6.seq
 249995524     gbvrt7.seq
 249953402     gbvrt8.seq
 249951446     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63896      86141507
BCT10        6838       96099579
BCT100       10178      95018948
BCT101       5443       100113517
BCT102       3168       107675130
BCT103       135        100499957
BCT104       68         115951486
BCT105       3934       104885076
BCT106       5499       104027061
BCT107       40075      50702132
BCT108       71140      76248985
BCT109       3946       110012468
BCT11        66         116730258
BCT110       4238       110579959
BCT111       6791       109796736
BCT112       31670      96039029
BCT113       74782      79311722
BCT114       74297      78174195
BCT115       73194      80871143
BCT116       72870      79186654
BCT117       57366      86709297
BCT118       16061      29839948
BCT12        74         112572581
BCT13        110        114781209
BCT14        63         115480641
BCT15        1832       120339171
BCT16        14331      18577313
BCT17        53935      85395991
BCT18        93         110189094
BCT19        143        97370339
BCT2         21291      101346954
BCT20        58         112869568
BCT21        52         109549606
BCT22        46         112848421
BCT23        57         112994744
BCT24        66         108817610
BCT25        36         96325907
BCT26        40         106881287
BCT27        59         107430269
BCT28        74         111675186
BCT29        55         110045255
BCT3         49         110833695
BCT30        63         106845575
BCT31        55         109391288
BCT32        53         108650404
BCT33        46         110496749
BCT34        95         109522868
BCT35        58         106383536
BCT36        67         109486091
BCT37        125        110095719
BCT38        37         71643089
BCT39        200        111474100
BCT4         57         111226742
BCT40        54         111189314
BCT41        35         108859141
BCT42        59         107860764
BCT43        56         105257887
BCT44        45         109560296
BCT45        74         109517239
BCT46        64         110904710
BCT47        45         108836596
BCT48        59         106741684
BCT49        69         107012469
BCT5         33669      100189198
BCT50        77         109262802
BCT51        22         22714378
BCT52        67         109336234
BCT53        60         104664634
BCT54        54         104983933
BCT55        56         108908758
BCT56        58         107145869
BCT57        57         111394309
BCT58        69         108480601
BCT59        61         106681610
BCT6         4660       5932899
BCT60        70         111010690
BCT61        40         115669000
BCT62        72         100743444
BCT63        52         110907695
BCT64        63         113086294
BCT65        21         20890763
BCT66        43         108446257
BCT67        49         114265418
BCT68        67         111168592
BCT69        48         110283091
BCT7         39034      85133405
BCT70        52         112873741
BCT71        105        115695198
BCT72        70         110115053
BCT73        82         108955714
BCT74        63         116455996
BCT75        54         115710032
BCT76        64         116970930
BCT77        44         100976424
BCT78        39         90515200
BCT79        59         118671696
BCT8         5504       96546226
BCT80        258        116516273
BCT81        49         107020389
BCT82        300        113762382
BCT83        63         106848579
BCT84        34         110729576
BCT85        63         109230514
BCT86        62         113273298
BCT87        49         107356210
BCT88        45         106523076
BCT89        76         111295697
BCT9         13772      81354333
BCT90        220        98447010
BCT91        350        52715337
BCT92        1589       2511877
BCT93        3180       5275409
BCT94        6346       7804593
BCT95        12648      15077034
BCT96        25619      27729818
BCT97        50524      54036309
BCT98        76002      77712655
BCT99        71317      76864817
ENV1         92523      71816201
ENV10        93139      72877193
ENV11        82348      86653447
ENV12        21752      18600170
ENV13        84735      80838450
ENV14        118359     43039383
ENV15        89205      77153125
ENV16        96486      67745951
ENV17        96082      63280553
ENV18        109775     66817709
ENV19        121991     64638172
ENV2         97166      68721862
ENV20        61134      82537988
ENV21        70040      85924755
ENV22        90596      74881364
ENV23        127000     36593750
ENV24        122969     29005551
ENV25        82094      18866859
ENV26        123104     49763298
ENV27        97813      67171666
ENV28        115093     56544138
ENV29        136122     52767325
ENV3         79517      77717847
ENV30        108095     61030393
ENV31        95894      65472327
ENV32        8406       11424693
ENV33        62536      84995133
ENV34        88894      73357412
ENV35        102578     44146186
ENV36        96893      56164626
ENV37        70793      54817894
ENV38        111205     47239281
ENV39        101004     61206235
ENV4         83065      81961993
ENV40        106862     61717013
ENV41        63551      90721793
ENV42        72567      78876185
ENV43        62026      84268659
ENV44        12859      17499766
ENV45        70538      78327816
ENV46        108108     49651114
ENV47        112458     56270457
ENV48        104673     61442502
ENV49        79153      40935836
ENV5         88628      79331956
ENV50        100701     44107672
ENV51        42818      53344159
ENV52        41972      54588941
ENV53        57588      57099421
ENV54        96732      61653609
ENV55        34458      19223695
ENV56        92147      66863874
ENV57        81203      71665537
ENV58        82464      71920143
ENV59        86767      68924957
ENV6         90079      83318013
ENV60        84585      73005344
ENV61        8200       2561129
ENV62        109937     46139997
ENV63        90297      60758308
ENV64        88787      64512415
ENV65        80134      75380995
ENV66        86602      65927879
ENV67        68791      47986875
ENV7         51490      21754739
ENV8         131425     31030486
ENV9         86254      70388166
EST1         159501     61802328
EST10        168151     72528623
EST100       233140     141629453
EST101       238374     125239733
EST102       191105     104694587
EST103       184687     102147838
EST104       101298     70761444
EST105       160794     120062351
EST106       173060     105866886
EST107       134704     84656744
EST108       63921      23798979
EST109       63344      22263574
EST11        169671     73852725
EST110       63852      23134447
EST111       63868      26852895
EST112       64353      23019552
EST113       64592      24542529
EST114       63590      26991793
EST115       63769      26209471
EST116       64046      27322597
EST117       63898      25168059
EST118       61269      33510932
EST119       120791     61888330
EST12        168415     70671356
EST120       162673     86531393
EST121       188257     92947318
EST122       149939     96348059
EST123       158472     93328923
EST124       130782     85043324
EST125       190244     91118817
EST126       156141     83127648
EST127       157759     84783979
EST128       157777     85114757
EST129       151082     84840982
EST13        68137      33181757
EST130       174156     93451323
EST131       183186     117068868
EST132       202738     102464329
EST133       160282     87310966
EST134       162583     82735904
EST135       143041     84206722
EST136       145039     91020178
EST137       95846      49946991
EST138       173489     97986018
EST139       246063     113490332
EST14        218171     109510676
EST140       154771     83774823
EST141       167760     92492233
EST142       150348     87792647
EST143       135081     83223186
EST144       155023     96207730
EST145       155217     85475684
EST146       124312     63588915
EST147       121381     65193725
EST148       128038     57657903
EST149       127275     51165841
EST15        169111     105841921
EST150       128586     51254734
EST151       112650     41965392
EST152       164281     82856779
EST153       176887     74101830
EST154       162458     110699560
EST155       201789     123674464
EST156       214725     121962804
EST157       176034     97116509
EST158       155639     108241840
EST159       140117     95262079
EST16        180715     112882824
EST160       156490     96224563
EST161       156661     82288128
EST162       138493     78062778
EST163       170574     94763556
EST164       65785      41353346
EST165       150453     92060893
EST166       192429     110544268
EST167       146102     84086050
EST168       142833     72423524
EST169       150574     87777174
EST17        195263     114601855
EST170       190757     104675341
EST171       156733     96086731
EST172       168076     82972199
EST173       127528     86860543
EST174       171662     100736367
EST175       173510     100383572
EST176       121052     67805076
EST177       157530     90685111
EST178       30704      17913382
EST179       170459     102977691
EST18        192461     120977395
EST180       181417     119610099
EST181       143824     116740385
EST182       194548     99407777
EST183       153343     103640293
EST184       154934     101369898
EST185       141208     81793295
EST186       176983     71968147
EST187       151125     84401808
EST188       157543     100416469
EST189       157183     96341109
EST19        158068     113142894
EST190       141129     84317602
EST191       158202     95428667
EST192       145887     93399247
EST193       129727     90619985
EST194       144146     88185205
EST195       136476     88940547
EST196       130157     93071223
EST197       163957     87141825
EST198       174668     96033221
EST199       174067     96942165
EST2         162336     61672462
EST20        189295     99787481
EST200       172153     96182531
EST201       169391     95465318
EST202       172291     95610521
EST203       174062     95362851
EST204       174612     96173272
EST205       18399      9893303
EST206       189488     105506957
EST207       206178     105235595
EST208       172339     102461892
EST209       180655     102119195
EST21        218035     107334060
EST210       201446     122825507
EST211       195210     112616443
EST212       192875     124434972
EST213       164434     105742464
EST214       218429     144207604
EST215       238466     112729037
EST216       133317     97971939
EST217       162716     109666655
EST218       147825     95104436
EST219       179453     99299664
EST22        192399     63374735
EST220       189463     118943566
EST221       111088     87677259
EST222       134259     119711446
EST223       161334     94531637
EST224       148830     96509682
EST225       198026     107197513
EST226       163705     103828223
EST227       134238     92298781
EST228       140940     104430206
EST229       121094     87221437
EST23        139484     39675457
EST230       87029      58956435
EST231       145027     89978462
EST232       132521     94211753
EST233       142487     101448591
EST234       120357     86655505
EST235       125771     84487492
EST236       154076     106974035
EST237       159806     115883337
EST238       120062     122225666
EST239       147495     88513695
EST24        102661     27801202
EST240       184461     119372197
EST241       151896     92317676
EST242       170558     107744207
EST243       168732     122177047
EST244       144986     108054885
EST245       4369       3121480
EST246       152160     100320199
EST247       207685     98121479
EST248       196526     110951487
EST249       148363     90589242
EST25        124046     51507329
EST250       221582     25289547
EST251       221785     90938061
EST252       164851     119799705
EST253       176543     103392635
EST254       161997     107836287
EST255       175575     115741137
EST256       157456     114569133
EST257       95448      52073862
EST258       186056     98173774
EST259       177774     103080353
EST26        214422     97580578
EST260       166766     121488496
EST261       212246     102784758
EST262       271738     119059429
EST263       213249     121949860
EST264       182975     42172042
EST265       244946     111826884
EST266       169943     98161014
EST267       168026     105337327
EST268       86280      53843987
EST269       164667     113840002
EST27        219623     110377286
EST270       201172     103771167
EST271       152903     105109604
EST272       198323     116891062
EST273       196766     52139345
EST274       210429     40947210
EST275       182415     102646469
EST276       167436     115754006
EST277       188654     115923528
EST278       182167     109477705
EST279       157796     102217166
EST28        190705     88553660
EST280       101884     37504240
EST281       147894     85782621
EST282       117685     78613849
EST283       157475     106521882
EST284       246018     38517625
EST285       264819     24267020
EST286       169857     90245365
EST287       167686     110191290
EST288       158291     102739321
EST289       148527     92135039
EST29        158003     68923942
EST290       261113     39121425
EST291       177597     95869574
EST292       61481      46556579
EST293       192912     109908794
EST294       145105     79433473
EST295       179196     121860390
EST296       188130     110523914
EST297       152035     112624837
EST298       190894     106053993
EST299       178170     99427538
EST3         151288     53609752
EST30        171941     69773116
EST300       173759     112188458
EST301       185111     61828475
EST302       183470     67242218
EST303       184181     71102321
EST304       138350     51415890
EST305       192867     89198816
EST306       180624     125982495
EST307       160390     94338608
EST308       154919     91166859
EST309       128328     98229527
EST31        150741     63794481
EST310       149084     99280384
EST311       163994     100138619
EST312       164941     92292810
EST313       171445     103715268
EST314       149879     97625334
EST315       150539     101898098
EST316       164699     107996532
EST317       147862     102241182
EST318       178799     149932931
EST319       172878     115075759
EST32        168213     76206611
EST320       141085     75036610
EST321       144934     98808526
EST322       147466     101832332
EST323       134683     90562772
EST324       149006     99216417
EST325       148713     101005444
EST326       178574     112707541
EST327       149406     81702916
EST328       148957     85487533
EST329       150668     104928098
EST33        176414     68487926
EST330       154239     97467733
EST331       80592      48045634
EST332       143803     91447997
EST333       141960     89330040
EST334       204688     111259133
EST335       137199     74997940
EST336       91323      54490230
EST337       129996     85589770
EST338       137545     87326295
EST339       125542     80262174
EST34        117774     40287155
EST340       159565     85318214
EST341       217059     85095711
EST342       171014     87549292
EST343       172299     104127017
EST344       165016     98377991
EST345       82244      54878372
EST346       132982     88578090
EST347       136219     88760530
EST348       186529     121957935
EST349       160151     96990548
EST35        96376      29584051
EST350       154142     78328008
EST351       187546     127245774
EST352       118025     81914831
EST353       73376      44174089
EST354       137035     75407875
EST355       130580     78257274
EST356       147827     58334767
EST357       159015     32370973
EST358       158856     32726333
EST359       182717     104860247
EST36        96775      30251835
EST360       14107      10231770
EST361       227793     118247844
EST362       252420     115276036
EST363       201358     104585579
EST364       147142     94965693
EST365       136422     87323076
EST366       146417     87053353
EST367       184126     113828691
EST368       226405     79454304
EST369       188758     100085222
EST37        95687      29034354
EST370       214358     119712529
EST371       150095     77360492
EST372       201427     125413124
EST373       161484     79327931
EST374       180334     102980517
EST375       154439     99933005
EST376       192521     135492729
EST377       176682     137614575
EST378       170799     113899073
EST379       164259     98571713
EST38        97562      29490035
EST380       182405     112267566
EST381       184311     101226051
EST382       204436     116556057
EST383       106902     53765342
EST384       196351     123272222
EST385       193135     127281910
EST386       196737     131409760
EST387       215558     134825549
EST388       219443     132609903
EST389       199501     160935344
EST39        97762      30978683
EST390       215324     151606380
EST391       186742     111553796
EST392       186026     101052190
EST393       171944     56953647
EST394       97811      7463282
EST395       157917     13616403
EST396       158076     28718171
EST397       159200     31910700
EST398       158956     32488527
EST399       148621     83928755
EST4         171413     67335709
EST40        28002      7170780
EST400       181058     106860984
EST401       165392     113842082
EST402       167178     97710954
EST403       154842     107059853
EST404       140349     97816886
EST405       146950     97739886
EST406       167375     112323481
EST407       146690     103628004
EST408       19167      11039253
EST409       181538     107756232
EST41        101273     53058617
EST410       168927     29928480
EST411       165379     63297304
EST412       155299     109870355
EST413       167169     104822040
EST414       155957     97912863
EST415       161877     92975589
EST416       188729     125577131
EST417       143248     94487800
EST418       132621     90835110
EST419       154937     95892932
EST42        119812     50974373
EST420       161958     94901228
EST421       142273     77066442
EST422       164867     97244736
EST423       160795     95304395
EST424       177812     107009247
EST425       140258     87907317
EST426       106415     74927025
EST427       81420      62731418
EST428       100893     67222128
EST429       157528     87124374
EST43        166789     92246230
EST430       125294     75778309
EST431       140604     91488111
EST432       141313     83369583
EST433       160495     95872317
EST434       156820     86223319
EST435       198334     117843445
EST436       12940      7358156
EST437       127248     84457721
EST438       187193     98138240
EST439       186213     90398296
EST44        170537     72086238
EST440       151030     88319007
EST441       164469     89793969
EST442       218086     127923463
EST443       170838     105348024
EST444       177128     108257924
EST445       137454     99403520
EST446       142943     93482875
EST447       156750     74948031
EST448       193315     90035947
EST449       52138      20750415
EST45        167725     85282605
EST450       207544     86302393
EST451       202858     83396133
EST452       187311     101598905
EST453       181909     108530579
EST454       190491     110293005
EST455       190984     117230224
EST456       195791     110233124
EST457       187891     87283599
EST458       199035     102874265
EST459       202447     120263480
EST46        169245     87159127
EST460       133443     81661452
EST461       199034     123592753
EST462       164303     98617668
EST463       143101     108021777
EST464       157132     87344011
EST465       191399     98478441
EST466       143373     77220462
EST467       155448     84798669
EST468       186910     98184043
EST469       167943     108963681
EST47        163886     88137856
EST470       181485     107148415
EST471       173404     120778327
EST472       179687     98587653
EST473       6526       2596165
EST474       169342     59219523
EST475       148887     58043809
EST48        162661     83078307
EST49        160057     91302341
EST5         169507     66374636
EST50        162165     88649697
EST51        157996     99065449
EST52        159947     70335529
EST53        147810     82762376
EST54        70097      46570832
EST55        167624     70082241
EST56        165108     74994001
EST57        165334     91315166
EST58        159258     97029520
EST59        156964     102524120
EST6         172145     67172196
EST60        165209     99289894
EST61        160392     108482328
EST62        172175     80126726
EST63        174119     93732085
EST64        155253     84261310
EST65        148807     81488437
EST66        159024     98458492
EST67        130732     74729096
EST68        149873     91944081
EST69        195935     108776457
EST7         170371     73026483
EST70        184442     96457432
EST71        221851     121777815
EST72        187248     112403488
EST73        202836     119977938
EST74        165150     90686038
EST75        132050     60542140
EST76        137098     67483266
EST77        159604     100787274
EST78        157431     95603572
EST79        143031     78952671
EST8         180055     73207061
EST80        43436      20198273
EST81        164526     100675156
EST82        212748     115290941
EST83        224972     124267190
EST84        200891     94598142
EST85        211959     93163368
EST86        160958     92883335
EST87        144272     87861981
EST88        164602     80723045
EST89        159287     80248088
EST9         168993     69408113
EST90        153922     102388551
EST91        151623     89508682
EST92        130185     83772282
EST93        155973     112950458
EST94        141137     103346817
EST95        141966     101536238
EST96        141278     97674718
EST97        147762     81837015
EST98        178905     111007371
EST99        224375     135968674
GSS1         200944     87996853
GSS10        132706     60746025
GSS100       145418     114454328
GSS101       141769     116165744
GSS102       143571     116947969
GSS103       168583     129425236
GSS104       146715     80615182
GSS105       192104     121259599
GSS106       168292     112460507
GSS107       197306     115535585
GSS108       204322     134302805
GSS109       209639     138122984
GSS11        137159     73865586
GSS110       207406     140746748
GSS111       206079     142323486
GSS112       205079     143640112
GSS113       205044     143785076
GSS114       201992     146545910
GSS115       182374     140056102
GSS116       18847      11094131
GSS117       133124     84236509
GSS118       170220     80194361
GSS119       184016     79512645
GSS12        148407     75892877
GSS120       170149     148290331
GSS121       177774     120628072
GSS122       180429     146458474
GSS123       188065     121136946
GSS124       187783     139218082
GSS125       192334     127552725
GSS126       191893     93803649
GSS127       167403     155667772
GSS128       163887     114595122
GSS129       58354      34797634
GSS13        145697     69145600
GSS130       171426     155849591
GSS131       172764     154799747
GSS132       172781     155525330
GSS133       174214     154499047
GSS134       172411     154985845
GSS135       180665     139049178
GSS136       179506     146449356
GSS137       164811     118776818
GSS138       192434     95036235
GSS139       258273     39812202
GSS14        171227     85491308
GSS140       258270     39813353
GSS141       90078      13836870
GSS142       255991     58805166
GSS143       260309     57524826
GSS144       191756     85638830
GSS145       196899     67888434
GSS146       186502     148768657
GSS147       182871     151534238
GSS148       168660     155800016
GSS149       171522     158237414
GSS15        161658     98235974
GSS150       238387     70290627
GSS151       226840     83136160
GSS152       128496     51169895
GSS153       209120     56427143
GSS154       157868     95833811
GSS155       181476     114894418
GSS156       135946     86631194
GSS157       166550     133413451
GSS158       184608     161570380
GSS159       194063     159481984
GSS16        173479     87329145
GSS160       192975     125865469
GSS161       221305     140705973
GSS162       222726     133313113
GSS163       146866     89615098
GSS164       87039      63873952
GSS165       83570      62791877
GSS166       103200     48366436
GSS167       68837      58578150
GSS168       8347       7529586
GSS169       68591      57924394
GSS17        184273     114517105
GSS170       69224      56650935
GSS171       69460      56187403
GSS172       71202      55998401
GSS173       68561      51865315
GSS174       75915      58209304
GSS175       86719      74437329
GSS176       81366      44383585
GSS177       92077      44930861
GSS178       64855      48400122
GSS179       77364      61293357
GSS18        192268     113913849
GSS180       69657      58696354
GSS181       67712      62704325
GSS182       61915      53366768
GSS183       95617      42956622
GSS184       21198      4944398
GSS185       112930     70870954
GSS186       830        565879
GSS187       23226      28867035
GSS188       109084     70678875
GSS189       84403      34582519
GSS19        107956     48373762
GSS190       35904      22282147
GSS191       103304     62490220
GSS192       102329     63761256
GSS193       104196     67611234
GSS194       82171      41322048
GSS195       83102      54651503
GSS196       95552      61239914
GSS197       107362     78589696
GSS198       106457     76738025
GSS199       106101     79982459
GSS2         182784     92562255
GSS20        181830     101800188
GSS200       104001     80014803
GSS201       75801      50678132
GSS202       105097     63619915
GSS203       109868     66415305
GSS204       105995     59196161
GSS205       68060      37226354
GSS206       69100      38526913
GSS207       38147      18321461
GSS208       85481      46023427
GSS209       96935      55799967
GSS21        166507     114368644
GSS210       94959      49608668
GSS211       95885      55630945
GSS212       42740      24003277
GSS213       114055     43442995
GSS214       116422     39251295
GSS215       108546     52732208
GSS216       108722     67128836
GSS217       101583     78242275
GSS218       56617      33766188
GSS219       95891      36542252
GSS22        170134     97973766
GSS220       95417      37268709
GSS221       96671      35161518
GSS222       94285      39167432
GSS223       37736      17626556
GSS224       103939     66277823
GSS225       94551      61190929
GSS226       95128      60357048
GSS227       94773      60868501
GSS228       75675      70017159
GSS229       80711      68556186
GSS23        187501     127418526
GSS230       32632      33659854
GSS231       83736      28233267
GSS232       84219      27346468
GSS233       84926      25909272
GSS234       14851      4422302
GSS235       16547      7508221
GSS236       92119      59302433
GSS237       114109     76935087
GSS238       99108      55040177
GSS239       94961      52031539
GSS24        195138     130441462
GSS240       88586      48341862
GSS241       22682      12379616
GSS242       90648      56882510
GSS243       89662      61882079
GSS244       88553      63641206
GSS245       89283      62505584
GSS246       9890       7129098
GSS247       87995      63795538
GSS248       90151      62444409
GSS249       94363      59803046
GSS25        177571     104698072
GSS250       74114      62647557
GSS251       84188      78959709
GSS252       83078      80517226
GSS253       71053      53206671
GSS254       114900     62956729
GSS255       109229     55656739
GSS256       107532     52126493
GSS257       99054      44380734
GSS258       109801     49060015
GSS259       97917      46046727
GSS26        187103     109227419
GSS260       73058      72226496
GSS261       77174      72621583
GSS262       92147      71194681
GSS263       24563      18498472
GSS264       92250      71055526
GSS265       85869      83025280
GSS266       83675      87061685
GSS267       82362      86366324
GSS268       87240      67099066
GSS269       90053      72027971
GSS27        169149     151334366
GSS270       90954      71349360
GSS271       79420      51198289
GSS272       94787      57200301
GSS273       93517      59081345
GSS274       93900      58510429
GSS275       94714      57307691
GSS276       83843      51265303
GSS277       104594     69753809
GSS278       105287     75065932
GSS279       110489     69020768
GSS28        190447     145244427
GSS280       108020     71887545
GSS281       110248     69302693
GSS282       101200     62818923
GSS283       107024     57079665
GSS284       57639      30702074
GSS29        152608     107742802
GSS3         175722     88078887
GSS30        192348     131459574
GSS31        10195      6761658
GSS32        196657     127651461
GSS33        217776     116759610
GSS34        219644     114213054
GSS35        220777     112664012
GSS36        214634     123371409
GSS37        199350     157080374
GSS38        195922     147425185
GSS39        191240     68582122
GSS4         167454     85331195
GSS40        185332     97995146
GSS41        190667     126771234
GSS42        171525     159218627
GSS43        6467       4247770
GSS44        184473     100545750
GSS45        173355     121951456
GSS46        183627     123756934
GSS47        189222     121180959
GSS48        73011      64170877
GSS49        172209     102210173
GSS5         50998      30384869
GSS50        168276     103464302
GSS51        168453     103104964
GSS52        182981     120642594
GSS53        184863     116613625
GSS54        181132     122185220
GSS55        186099     112894008
GSS56        190333     135456146
GSS57        178623     104614088
GSS58        193558     119263192
GSS59        179787     132297524
GSS6         162012     84658807
GSS60        4992       4545539
GSS61        173071     139090931
GSS62        162251     111941110
GSS63        162287     111956963
GSS64        157370     106678215
GSS65        156934     129155741
GSS66        170454     142808420
GSS67        179299     116666009
GSS68        202697     126932031
GSS69        193518     110532177
GSS7         165852     79608135
GSS70        244855     126492107
GSS71        160862     106827257
GSS72        159343     119671214
GSS73        162711     124582166
GSS74        162681     124636344
GSS75        175306     109121626
GSS76        190760     140453054
GSS77        12922      7501227
GSS78        197146     125277919
GSS79        169990     111056671
GSS8         165860     89017460
GSS80        199568     130799058
GSS81        211415     88249246
GSS82        189900     97634334
GSS83        132264     92350338
GSS84        147019     118098431
GSS85        139712     117101393
GSS86        142934     114072763
GSS87        144153     119950643
GSS88        141914     115766178
GSS89        107385     89500161
GSS9         138220     67303555
GSS90        149551     122348924
GSS91        147785     117769510
GSS92        144109     113167940
GSS93        142977     115533311
GSS94        144347     119779618
GSS95        148228     121687870
GSS96        147780     117927671
GSS97        146199     121154816
GSS98        146262     121033252
GSS99        146706     120144264
HTC1         25070      27067745
HTC10        70433      71571527
HTC11        72156      70048891
HTC12        25563      31246478
HTC13        66993      60073171
HTC14        68526      69480885
HTC15        41844      26675868
HTC2         16086      36248594
HTC3         16029      36625145
HTC4         16251      35561378
HTC5         15980      40342205
HTC6         16068      37475860
HTC7         53862      31518631
HTC8         31094      19381346
HTC9         60738      77639264
HTG1         1318       188778000
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191618641
HTG109       1639       191077915
HTG11        4          606452
HTG110       1332       192017007
HTG111       890        129166022
HTG112       1439       190873532
HTG113       1518       189527436
HTG114       1397       176270675
HTG115       1216       154265619
HTG116       1335       175214595
HTG117       1340       189785232
HTG118       1064       185805333
HTG119       712        115738037
HTG12        1452       184004673
HTG120       1510       183444531
HTG121       1188       191129361
HTG122       989        187509223
HTG123       1088       193785584
HTG124       1102       193097080
HTG125       436        81073803
HTG126       1031       189469892
HTG127       1055       192678789
HTG128       1163       191852916
HTG129       1080       192395749
HTG13        875        191786413
HTG130       1084       193090210
HTG131       588        103686357
HTG132       1122       192519796
HTG133       1080       192499490
HTG134       1078       192326016
HTG135       1166       191803992
HTG136       1787       191798771
HTG137       1080       192378846
HTG138       1074       192191265
HTG139       1109       192308931
HTG14        753        191921309
HTG140       1227       190147644
HTG141       876        103384761
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192170442
HTG76        1147       192487651
HTG77        1188       192461752
HTG78        1071       181302309
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93681      48159067
INV10        52666      89338629
INV11        82574      65290251
INV12        65452      51715882
INV13        84572      65937634
INV14        80780      66743446
INV15        78663      66834105
INV16        49171      46384786
INV17        27508      112352860
INV18        9566       141492052
INV19        40810      113841258
INV2         45651      113889643
INV20        77487      56883228
INV21        73406      62881125
INV22        7368       4804449
INV23        22759      127083617
INV24        6          133712559
INV25        56662      101256984
INV26        74165      49649683
INV27        57601      42291941
INV28        78271      55893874
INV29        75607      57883678
INV3         1530       185823137
INV30        78379      61224650
INV31        70974      47753543
INV32        35173      23416141
INV33        78810      56382259
INV34        76207      54559348
INV35        73102      62641720
INV36        76050      54144426
INV37        57835      82732595
INV38        1215       10892034
INV4         497        121463037
INV5         47052      96528494
INV6         76821      72521259
INV7         39713      105394444
INV8         37636      56629039
INV9         80281      71515793
MAM1         20247      155893420
MAM2         14981      163660038
MAM3         62320      79870606
MAM4         3868       188049878
MAM5         79771      74559093
MAM6         45480      132448642
MAM7         76150      61941092
MAM8         63264      72153811
PAT1         222549     70107814
PAT10        124427     102492774
PAT100       178198     3385762
PAT101       178185     3385515
PAT102       132610     2848492
PAT103       342935     8573375
PAT104       188806     88519660
PAT105       111348     132068608
PAT106       3850       194703659
PAT107       131292     110979300
PAT108       158599     54826034
PAT109       224686     34110691
PAT11        98865      64213984
PAT110       250080     15844307
PAT111       180711     63630717
PAT112       51661      26095410
PAT113       114166     110461664
PAT114       137647     83255778
PAT115       164233     99292613
PAT116       158779     103376955
PAT117       137518     115016173
PAT118       42311      27994848
PAT119       193712     81686401
PAT12        142046     62828374
PAT120       150217     108404022
PAT121       356051     11379688
PAT122       257211     57607099
PAT123       138161     48226925
PAT124       322021     22795469
PAT125       155639     102753887
PAT126       132727     110696284
PAT127       128341     121313309
PAT128       21664      184390005
PAT129       144888     112900567
PAT13        105889     59868347
PAT130       171997     96403773
PAT131       44618      171217879
PAT132       9167       47581637
PAT133       33645      178334734
PAT134       153558     109675196
PAT135       178705     90913377
PAT136       136049     115324159
PAT137       120392     123342367
PAT138       8527       8992390
PAT139       155429     101473147
PAT14        103623     50163370
PAT140       184764     88815933
PAT141       182409     85292093
PAT142       174403     93928365
PAT143       28829      20461016
PAT144       147929     108545966
PAT145       160945     101973668
PAT146       185311     90980420
PAT147       231649     49265020
PAT148       203540     47701039
PAT149       277765     9659534
PAT15        121154     53309103
PAT150       220400     46464910
PAT151       106913     2885992
PAT152       270386     21672571
PAT153       186718     61207463
PAT154       109747     106071687
PAT155       47603      9567906
PAT156       87250      88093004
PAT157       78318      95533510
PAT158       144734     77890133
PAT159       167843     71122533
PAT16        113124     61266241
PAT160       121245     93110522
PAT161       103291     85106563
PAT162       165791     46401733
PAT163       270022     5130418
PAT164       269978     5129582
PAT165       269978     5129582
PAT166       237888     4519872
PAT167       269396     5118524
PAT168       235458     25558526
PAT169       203679     47168358
PAT17        39203      16255752
PAT170       12110      425208
PAT171       165317     74871979
PAT172       91683      126651743
PAT173       172506     71664990
PAT174       213484     66944541
PAT175       189404     87843254
PAT176       170974     98567174
PAT177       201276     72901517
PAT178       74071      41489588
PAT179       93072      87231074
PAT18        146771     52594264
PAT180       91814      79965559
PAT181       83780      91675984
PAT182       108701     54187266
PAT183       101031     56670672
PAT184       150189     24631215
PAT185       93817      82459162
PAT186       26010      162900357
PAT187       113946     65760783
PAT188       83571      79408867
PAT189       3998       191513255
PAT19        153705     78039102
PAT190       117922     39497049
PAT191       136766     34571654
PAT192       78640      91651691
PAT193       66389      27510072
PAT194       86789      129976514
PAT195       158951     78754770
PAT196       212086     48062459
PAT197       170025     66208872
PAT198       58054      7834396
PAT199       161926     78522168
PAT2         194512     84659689
PAT20        104712     118084998
PAT200       120082     100563865
PAT201       196599     59404796
PAT202       224061     44476706
PAT203       125770     97354643
PAT204       77888      38153442
PAT21        133770     95332049
PAT22        84661      79580685
PAT23        123522     103391694
PAT24        119455     105503453
PAT25        145189     86776886
PAT26        175028     64348019
PAT27        71806      1795150
PAT28        102160     77384779
PAT29        93917      87631050
PAT3         171980     95897348
PAT30        119957     61672424
PAT31        96617      78960596
PAT32        128349     55021084
PAT33        92310      51152901
PAT34        118109     69082288
PAT35        105234     63069866
PAT36        162029     21539306
PAT37        134849     41764458
PAT38        102051     67004146
PAT39        23544      17472520
PAT4         153750     106057444
PAT40        95721      83165220
PAT41        100234     70851403
PAT42        136071     39459525
PAT43        143784     35448202
PAT44        123823     64568442
PAT45        104400     81184138
PAT46        93299      74375876
PAT47        113234     66602624
PAT48        65388      54850684
PAT49        135191     107998311
PAT5         57146      23927792
PAT50        167081     97032801
PAT51        116396     127553842
PAT52        196336     76726384
PAT53        80312      127991532
PAT54        27631      180872621
PAT55        185408     93066629
PAT56        274259     6856475
PAT57        129447     31627433
PAT58        161320     77719729
PAT59        92722      89283907
PAT6         170642     91909261
PAT60        106358     74852061
PAT61        122365     64031899
PAT62        67670      30346828
PAT63        70749      109767380
PAT64        87947      82758205
PAT65        92970      78936927
PAT66        93166      72442104
PAT67        93383      75086630
PAT68        115772     60531684
PAT69        102742     9941933
PAT7         154743     88216372
PAT70        175930     10547617
PAT71        171510     10872561
PAT72        171496     10866737
PAT73        99862      86225235
PAT74        99         196466297
PAT75        67         192869889
PAT76        103        195600591
PAT77        1137       196318757
PAT78        97599      5772236
PAT79        151009     9636510
PAT8         131234     96869903
PAT80        151022     9621259
PAT81        151024     9622125
PAT82        151021     9620837
PAT83        94629      88051226
PAT84        93653      93466380
PAT85        34112      33988659
PAT86        83459      93185861
PAT87        15568      180450145
PAT88        164892     19209768
PAT89        178944     3399936
PAT9         129174     101169582
PAT90        177434     3371246
PAT91        175305     3330795
PAT92        101399     1926581
PAT93        169167     12412170
PAT94        178699     3395281
PAT95        178691     3395129
PAT96        178677     3394863
PAT97        140784     2674896
PAT98        178683     3394977
PAT99        178342     3388498
PHG1         5947       104118412
PHG2         2291       28115715
PLN1         59839      93435133
PLN10        6549       6383875
PLN11        72971      75791575
PLN12        37374      49240057
PLN13        40171      65484998
PLN14        22684      123581384
PLN15        21110      100269850
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        24729      127753568
PLN2         67970      84523288
PLN20        5972       146407699
PLN21        1288       168147499
PLN22        1448       166987774
PLN23        19848      19058831
PLN24        66944      69782500
PLN25        30128      32286115
PLN26        76767      76390259
PLN27        64723      80257488
PLN28        61847      100023640
PLN29        77         96423259
PLN3         1472       167682899
PLN30        3          61743175
PLN31        54         123504479
PLN32        11491      135314975
PLN33        16219      135987078
PLN34        71433      78672088
PLN35        75110      78239994
PLN36        77598      35345896
PLN37        80231      71521083
PLN38        77639      75775609
PLN39        80024      70349946
PLN4         1607       182486448
PLN40        82016      75307194
PLN41        58793      32560998
PLN42        98830      55156578
PLN43        82304      68458267
PLN44        45219      98978751
PLN45        15535      129156389
PLN46        32946      123783780
PLN47        66342      80188768
PLN48        80918      72373600
PLN49        65305      79455170
PLN5         1952       192191862
PLN50        22615      113045849
PLN51        48451      95533146
PLN52        85271      60772450
PLN53        82708      54748074
PLN54        77361      71121161
PLN55        70292      84293955
PLN56        77170      67378519
PLN57        70338      76159162
PLN58        80021      67422011
PLN59        684        573458
PLN6         1660       194664179
PLN60        77988      63290565
PLN61        74896      70446295
PLN62        88998      48122419
PLN63        71659      68782251
PLN64        73629      63688134
PLN65        68256      74487797
PLN66        59761      88677154
PLN67        11921      25702459
PLN7         1694       193953640
PLN8         17404      153544645
PLN9         75690      79074076
PRI1         23024      59718385
PRI10        1260       179165440
PRI11        824        99248348
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         20275      146731180
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        5912       184242796
PRI23        15203      34134450
PRI24        31572      84624339
PRI25        61951      78208013
PRI26        31350      70628098
PRI27        8758       172032991
PRI28        2266       191526296
PRI29        1666       190957810
PRI3         1436       174984037
PRI30        2074       192186893
PRI31        2197       191169864
PRI32        13063      162311426
PRI33        2085       170473464
PRI34        58192      87724884
PRI35        5414       10850199
PRI36        32189      63608729
PRI37        20541      119199459
PRI38        18966      150691220
PRI39        67763      85232288
PRI4         1278       185664995
PRI40        50191      89302739
PRI41        40773      78876995
PRI42        47316      95812812
PRI43        26885      100998147
PRI44        27498      110076445
PRI45        25941      103014962
PRI46        71816      77354541
PRI47        8899       43046599
PRI5         1332       184431042
PRI6         1180       179865033
PRI7         1235       180573647
PRI8         1221       178848304
PRI9         1365       174844544
ROD1         35184      136228980
ROD10        990        181614030
ROD11        267        50734212
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190636468
ROD19        15550      158887048
ROD2         912        175763117
ROD20        1264       2318133
ROD21        20403      157183388
ROD22        1220       193661762
ROD23        937        147781632
ROD24        15484      168705171
ROD25        37962      68985705
ROD26        20911      110770842
ROD27        1538       193208910
ROD28        146357     23459124
ROD29        77819      76136143
ROD3         908        173387787
ROD30        83731      58141412
ROD31        15104      18635187
ROD4         901        173645466
ROD5         919        174552253
ROD6         964        177821232
ROD7         973        179490803
ROD8         975        181236777
ROD9         995        181831025
STS1         85183      36715950
STS10        57907      44420216
STS11        48911      37504044
STS12        57924      43637361
STS13        64247      42832943
STS14        93602      34192766
STS15        104286     26516227
STS16        10157      2751186
STS17        103700     27504029
STS18        86954      34469665
STS19        99772      33356132
STS2         84251      49866770
STS20        55510      21301124
STS3         66815      26326553
STS4         77133      36957487
STS5         8560       5020170
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55715      37766563
SYN1         37874      82192337
SYN2         50304      67196827
SYN3         16630      146378368
SYN4         4596       176606333
SYN5         4593       176456435
SYN6         4602       176549651
SYN7         9545       127150995
TSA1         120173     38161500
TSA10        19968      22050369
TSA100       84639      72201214
TSA101       77952      83666862
TSA102       94291      52023342
TSA103       99581      69535851
TSA104       58981      96869953
TSA105       109175     49378845
TSA106       67047      70017492
TSA107       80456      88837233
TSA108       72181      75576035
TSA109       57294      120580436
TSA11        134181     34620238
TSA110       597        352744
TSA111       106689     67779914
TSA112       93410      83369889
TSA113       98615      76609458
TSA114       88033      68056906
TSA115       85153      59467890
TSA116       81073      64427204
TSA117       81080      78013460
TSA118       99998      58115409
TSA119       94371      41923160
TSA12        60166      19894614
TSA120       77447      57059121
TSA121       37783      35943213
TSA122       64087      65481741
TSA123       62776      67314514
TSA124       62796      68082050
TSA125       83597      81259826
TSA126       77368      53642425
TSA127       52890      45157231
TSA128       78372      34800123
TSA129       74749      67769223
TSA13        62020      77345988
TSA130       81134      78516520
TSA131       74912      64516093
TSA132       40920      33919188
TSA133       87573      70203780
TSA134       88950      68200532
TSA135       84674      76995574
TSA136       76162      80752164
TSA137       12729      10682558
TSA138       82608      57086769
TSA139       71296      77322543
TSA14        108051     40236703
TSA140       75738      57006401
TSA141       79827      86791250
TSA142       89467      69559825
TSA143       65865      99683173
TSA144       93829      75154300
TSA145       34797      27913574
TSA146       81123      73329507
TSA147       77937      75421216
TSA148       78026      74206071
TSA149       89938      61448952
TSA15        55919      32513431
TSA150       49399      38715561
TSA16        71817      91808748
TSA17        92947      63944947
TSA18        107209     69284152
TSA19        98860      47665229
TSA2         112881     41347718
TSA20        49505      16661239
TSA21        85797      70106183
TSA22        120080     38852195
TSA23        135073     34045322
TSA24        61630      79369427
TSA25        41271      56088671
TSA26        70040      97061853
TSA27        99889      57191339
TSA28        109078     51813808
TSA29        103428     51315755
TSA3         109736     40821386
TSA30        101535     54075757
TSA31        101978     46113040
TSA32        14342      8956563
TSA33        66195      59263498
TSA34        92595      67984800
TSA35        92725      62222647
TSA36        79900      85994127
TSA37        99632      49714517
TSA38        113604     34184810
TSA39        95081      67746092
TSA4         110857     47428463
TSA40        13342      8212550
TSA41        94353      35365815
TSA42        77391      35904179
TSA43        106332     43403178
TSA44        113806     45488371
TSA45        29846      20501254
TSA46        105735     50140224
TSA47        100269     54196143
TSA48        94679      62767247
TSA49        83033      83930943
TSA5         76827      23206031
TSA50        64065      26019964
TSA51        90365      71288560
TSA52        97491      54397280
TSA53        60102      105473396
TSA54        87072      65322240
TSA55        78660      70602908
TSA56        83094      72167205
TSA57        82780      72071145
TSA58        68822      90744295
TSA59        90777      66753345
TSA6         111583     58975350
TSA60        75897      84474971
TSA61        71730      73100138
TSA62        68710      60727912
TSA63        84900      78031250
TSA64        85296      78117043
TSA65        70346      97895287
TSA66        85540      69665112
TSA67        84998      51586540
TSA68        102325     68656057
TSA69        87168      58768010
TSA7         87421      57901423
TSA70        103817     56958943
TSA71        73541      73023551
TSA72        78857      44745962
TSA73        89758      79908376
TSA74        90819      69521288
TSA75        78583      53740386
TSA76        79352      56753547
TSA77        96588      61833085
TSA78        36969      33014911
TSA79        89257      76980939
TSA8         103369     71924796
TSA80        96925      56383758
TSA81        110529     44786219
TSA82        96832      58660994
TSA83        65384      96482971
TSA84        13773      13507088
TSA85        95516      57898304
TSA86        93168      44533868
TSA87        89442      62706611
TSA88        77578      74114825
TSA89        51052      62842939
TSA9         108912     60317116
TSA90        77437      80992651
TSA91        77545      54883790
TSA92        84159      38595329
TSA93        76607      52796861
TSA94        66522      67080686
TSA95        64005      75825743
TSA96        87314      55376103
TSA97        51068      27412276
TSA98        74245      86358066
TSA99        80229      75622518
UNA1         268        139804
VRL1         65341      70846893
VRL10        61474      69465109
VRL11        61590      72710371
VRL12        65864      69410140
VRL13        45651      61291367
VRL14        62769      71022891
VRL15        57373      72703814
VRL16        63132      64477892
VRL17        56322      73608751
VRL18        48661      60991870
VRL19        54748      72419612
VRL2         69890      62910169
VRL20        58744      71269906
VRL21        55885      73810735
VRL22        56170      72838952
VRL23        25177      43127082
VRL24        52660      75333309
VRL25        37863      82026797
VRL26        48049      75115923
VRL27        50497      71822759
VRL28        47663      79869142
VRL29        44037      47211607
VRL3         71666      61042830
VRL4         70166      66424000
VRL5         67799      68108590
VRL6         7127       11946327
VRL7         48122      77456264
VRL8         46632      71889630
VRL9         43922      71435133
VRT1         55258      98779439
VRT10        1303       193449825
VRT11        8939       180860177
VRT12        3229       115029413
VRT13        13357      172226426
VRT14        5677       185327601
VRT15        3827       188788374
VRT16        45903      121688950
VRT17        78784      68672799
VRT18        77025      66276325
VRT19        24672      18208419
VRT2         1203       194257518
VRT20        71471      75807983
VRT21        44245      123969606
VRT22        76754      63112192
VRT23        78459      61936365
VRT24        81486      57548937
VRT25        30054      20875012
VRT26        102861     65960844
VRT27        81137      55873810
VRT28        85132      58500092
VRT29        76829      59114304
VRT3         64080      94904957
VRT30        91160      51206036
VRT31        75335      58282985
VRT32        13857      13242566
VRT4         9809       174045913
VRT5         38971      51326789
VRT6         72838      66499570
VRT7         31759      63624639
VRT8         30951      112136554
VRT9         1248       193561110

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 200.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

20516081 17377969964   Homo sapiens
9720974   9987301888   Mus musculus
2192933   6525362663   Rattus norvegicus
2202851   5390889349   Bos taurus
3963164   5076651270   Zea mays
3289233   4890467020   Sus scrofa
1726753   3120984289   Danio rerio
1029541   1465912366   Hordeum vulgare subsp. vulgare
257585    1435237072   Strongylocentrotus purpuratus
1376056   1264636062   Oryza sativa Japonica Group
454159    1257261151   Macaca mulatta
1588330   1249772268   Xenopus (Silurana) tropicalis
1777861   1199547661   Nicotiana tabacum
2339873   1159096025   Arabidopsis thaliana
1795431   1149819404   Triticum aestivum
1262760   1130184584   Drosophila melanogaster
808093    1070210189   Vitis vinifera
2103845   1020000725   Glycine max
217082    1009738490   Pan troglodytes
744134     983531233   Solanum lycopersicum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          February 15 2014

                NCBI-GenBank Flat File Release 200.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         October 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ02).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 200.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Jianli Dai, Francescopaolo di Cello,
	Michel Eschenbrenner, Irene Fang, Michael Fetchko, Linda Frisse,
	Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry, Suzanne Mate,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Ilya Dondoshansky, J. Bradley Holmes, WonHee Jang, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh, Jim Ostell,
	Vasuki Palanigobu, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov,
	Elena Starchenko, Hanzhen Sun, Tatiana Tatusova, Kamen Todorov,
	Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center