Release Notes For GenBank Release 202

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2014

               NCBI-GenBank Flat File Release 202.0

                    Distribution Release Notes

 173353076 loci, 161822845643 bases, from 173353076 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 202.0
1.2 Cutoff Date
1.3 Important Changes in Release 202.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 202.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 202.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 202.0, incorporates data processed by the INSDC databases
as of Thursday June 12, 2014 at approximately 1:30am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 202.0

1.3.1 Organizational changes

The total number of sequence data files increased by 43 with this release:

  - the BCT division is now composed of 136 133 files (+3)
  - the CON division is now composed of 267 246 files (+21)
  - the ENV division is now composed of  73 69 files (+4)
  - the EST division is now composed of 475 files (-1)
  - the GSS division is now composed of 287 285 files (+2)
  - the INV division is now composed of  39 files (+1)
  - the PAT division is now composed of 209 files (+5)
  - the PLN division is now composed of  70 68 files (+2)
  - the TSA division is now composed of 156 files (+6)

  Note that the loss of one EST data file is not due to removal of EST sequences.
Rather, we suspect that the combination of low EST data volumes since April,
combined with variability in gzip compression, simply happened to yield one
fewer file for this June release.

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 123
of the GSS flatfiles in Release 202.0. Consider gbgss165.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                            June 15 2014

                NCBI-GenBank Flat File Release 202.0

                           GSS Sequences (Part 1)

   87040 loci,    63874629 bases, from    87040 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "165" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be phased out (slowly!) at NCBI

  The numeric GI sequence identifier that NCBI assigns to all nucleotide
and protein sequences was first introduced for GenBank Release products
as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for nearly 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who utilize
GIs in their own information systems and analysis pipelines, so it will not be
introduced quickly. You can expect that a great deal of additional detail will
be made available via NCBI's various announcement mechanisms.

  *This* particular announcement is chiefly intended to provide some advance
warning to our users. There _will_ be classes of GenBank sequences that
are not assigned GIs in the not-too-distant future. If GIs are central to
your operations, then it might be appropriate to begin planning a switch to
the use of Accession.Version identifiers instead.

  And in fact, NCBI now has at least one WGS submission for which GIs have
not been assigned, for both the contigs and the scaffolds : ALWZ02.

Here are excerpts of the flatfile representation for the first ALWZ02 contig,
and the 'singleton' scaffold which is constructed from it:

LOCUS       ALWZ020000001            701 bp    DNA     linear   PLN 28-MAY-2013
DEFINITION  Picea glauca contig316_0, whole genome shotgun sequence.
ACCESSION   ALWZ020000001 ALWZ020000000
VERSION     ALWZ020000001.1
DBLINK      BioProject: PRJNA83435
....
ORIGIN      
        1 cgttgtgttg gggcacccaa ccttggtgag gccgtattaa aaagtctacc tccaagccaa
       61 aatttgttct tatccatcct ccaactcgtc tttttgccta gtgctcccct atgtggacgt
      121 tttcgttgtg gaggagtttt tcgtttgggc gcccatcttg cgaactcacc ttgcattgcg
      181 tttggtcgcc caacttgtga acgtgccttg gattgcgttg gggcgcccaa gttgcggacg
      241 tgcggacgtg cctttctttg ccgacatgcc ttgcgtttgc gttgcggacg tgcaatgggg
      301 cccccagctt gctgacgtgc cttgcgttgc gttggggtgc ccaacttgcc gacgtgcctt
      361 gcgttgcgtt ggggcaccca accttggtga ggccgtatta aaaagtctac ctccaagata
      421 aaatttgttc ttatccatcc tctagctctt cttttagcct agtgctccct tgtgtggaca
      481 ttttcgttgt ggatcatttt ttcgtttagg tgcccatctt gcagacaagc cttgcgttgc
      541 gtttgggcac ccatcttgcg gacgcgcctt tcattgcgtt ggggcgccca acgttggtga
      601 ggccgtatta aaaagtctac ctccaagaca aaatttgttc ttatccatcc tccatctcgt
      661 ctttttgcct agtgctccct tgtgtggacg ttttcgttgc g
//

LOCUS       ALWZ02S0000001           701 bp    DNA     linear   CON 14-JUN-2013
DEFINITION  Picea glauca scaffold316, whole genome shotgun sequence.
ACCESSION   ALWZ02S0000001 ALWZ000000000
VERSION     ALWZ02S0000001.1
DBLINK      BioProject: PRJNA83435
....
CONTIG      join(ALWZ020000001.1:1..701)
//


**Note the absence of a GI value on the VERSION line of these two records**

Sample URLs from which ALWZ02 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.1.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.1.gbff.gz

Unannotated WGS projects consisting of many millions of contigs and 
scaffolds represent the first class of records for which GIs are no
longer being assigned. But the practice will ultimately expand to
include other classes of records.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2052 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct14.seq - Bacterial sequence entries, part 14.
44. gbbct15.seq - Bacterial sequence entries, part 15.
45. gbbct16.seq - Bacterial sequence entries, part 16.
46. gbbct17.seq - Bacterial sequence entries, part 17.
47. gbbct18.seq - Bacterial sequence entries, part 18.
48. gbbct19.seq - Bacterial sequence entries, part 19.
49. gbbct2.seq - Bacterial sequence entries, part 2.
50. gbbct20.seq - Bacterial sequence entries, part 20.
51. gbbct21.seq - Bacterial sequence entries, part 21.
52. gbbct22.seq - Bacterial sequence entries, part 22.
53. gbbct23.seq - Bacterial sequence entries, part 23.
54. gbbct24.seq - Bacterial sequence entries, part 24.
55. gbbct25.seq - Bacterial sequence entries, part 25.
56. gbbct26.seq - Bacterial sequence entries, part 26.
57. gbbct27.seq - Bacterial sequence entries, part 27.
58. gbbct28.seq - Bacterial sequence entries, part 28.
59. gbbct29.seq - Bacterial sequence entries, part 29.
60. gbbct3.seq - Bacterial sequence entries, part 3.
61. gbbct30.seq - Bacterial sequence entries, part 30.
62. gbbct31.seq - Bacterial sequence entries, part 31.
63. gbbct32.seq - Bacterial sequence entries, part 32.
64. gbbct33.seq - Bacterial sequence entries, part 33.
65. gbbct34.seq - Bacterial sequence entries, part 34.
66. gbbct35.seq - Bacterial sequence entries, part 35.
67. gbbct36.seq - Bacterial sequence entries, part 36.
68. gbbct37.seq - Bacterial sequence entries, part 37.
69. gbbct38.seq - Bacterial sequence entries, part 38.
70. gbbct39.seq - Bacterial sequence entries, part 39.
71. gbbct4.seq - Bacterial sequence entries, part 4.
72. gbbct40.seq - Bacterial sequence entries, part 40.
73. gbbct41.seq - Bacterial sequence entries, part 41.
74. gbbct42.seq - Bacterial sequence entries, part 42.
75. gbbct43.seq - Bacterial sequence entries, part 43.
76. gbbct44.seq - Bacterial sequence entries, part 44.
77. gbbct45.seq - Bacterial sequence entries, part 45.
78. gbbct46.seq - Bacterial sequence entries, part 46.
79. gbbct47.seq - Bacterial sequence entries, part 47.
80. gbbct48.seq - Bacterial sequence entries, part 48.
81. gbbct49.seq - Bacterial sequence entries, part 49.
82. gbbct5.seq - Bacterial sequence entries, part 5.
83. gbbct50.seq - Bacterial sequence entries, part 50.
84. gbbct51.seq - Bacterial sequence entries, part 51.
85. gbbct52.seq - Bacterial sequence entries, part 52.
86. gbbct53.seq - Bacterial sequence entries, part 53.
87. gbbct54.seq - Bacterial sequence entries, part 54.
88. gbbct55.seq - Bacterial sequence entries, part 55.
89. gbbct56.seq - Bacterial sequence entries, part 56.
90. gbbct57.seq - Bacterial sequence entries, part 57.
91. gbbct58.seq - Bacterial sequence entries, part 58.
92. gbbct59.seq - Bacterial sequence entries, part 59.
93. gbbct6.seq - Bacterial sequence entries, part 6.
94. gbbct60.seq - Bacterial sequence entries, part 60.
95. gbbct61.seq - Bacterial sequence entries, part 61.
96. gbbct62.seq - Bacterial sequence entries, part 62.
97. gbbct63.seq - Bacterial sequence entries, part 63.
98. gbbct64.seq - Bacterial sequence entries, part 64.
99. gbbct65.seq - Bacterial sequence entries, part 65.
100. gbbct66.seq - Bacterial sequence entries, part 66.
101. gbbct67.seq - Bacterial sequence entries, part 67.
102. gbbct68.seq - Bacterial sequence entries, part 68.
103. gbbct69.seq - Bacterial sequence entries, part 69.
104. gbbct7.seq - Bacterial sequence entries, part 7.
105. gbbct70.seq - Bacterial sequence entries, part 70.
106. gbbct71.seq - Bacterial sequence entries, part 71.
107. gbbct72.seq - Bacterial sequence entries, part 72.
108. gbbct73.seq - Bacterial sequence entries, part 73.
109. gbbct74.seq - Bacterial sequence entries, part 74.
110. gbbct75.seq - Bacterial sequence entries, part 75.
111. gbbct76.seq - Bacterial sequence entries, part 76.
112. gbbct77.seq - Bacterial sequence entries, part 77.
113. gbbct78.seq - Bacterial sequence entries, part 78.
114. gbbct79.seq - Bacterial sequence entries, part 79.
115. gbbct8.seq - Bacterial sequence entries, part 8.
116. gbbct80.seq - Bacterial sequence entries, part 80.
117. gbbct81.seq - Bacterial sequence entries, part 81.
118. gbbct82.seq - Bacterial sequence entries, part 82.
119. gbbct83.seq - Bacterial sequence entries, part 83.
120. gbbct84.seq - Bacterial sequence entries, part 84.
121. gbbct85.seq - Bacterial sequence entries, part 85.
122. gbbct86.seq - Bacterial sequence entries, part 86.
123. gbbct87.seq - Bacterial sequence entries, part 87.
124. gbbct88.seq - Bacterial sequence entries, part 88.
125. gbbct89.seq - Bacterial sequence entries, part 89.
126. gbbct9.seq - Bacterial sequence entries, part 9.
127. gbbct90.seq - Bacterial sequence entries, part 90.
128. gbbct91.seq - Bacterial sequence entries, part 91.
129. gbbct92.seq - Bacterial sequence entries, part 92.
130. gbbct93.seq - Bacterial sequence entries, part 93.
131. gbbct94.seq - Bacterial sequence entries, part 94.
132. gbbct95.seq - Bacterial sequence entries, part 95.
133. gbbct96.seq - Bacterial sequence entries, part 96.
134. gbbct97.seq - Bacterial sequence entries, part 97.
135. gbbct98.seq - Bacterial sequence entries, part 98.
136. gbbct99.seq - Bacterial sequence entries, part 99.
137. gbchg.txt - Accession numbers of entries updated since the previous release.
138. gbcon1.seq - Constructed sequence entries, part 1.
139. gbcon10.seq - Constructed sequence entries, part 10.
140. gbcon100.seq - Constructed sequence entries, part 100.
141. gbcon101.seq - Constructed sequence entries, part 101.
142. gbcon102.seq - Constructed sequence entries, part 102.
143. gbcon103.seq - Constructed sequence entries, part 103.
144. gbcon104.seq - Constructed sequence entries, part 104.
145. gbcon105.seq - Constructed sequence entries, part 105.
146. gbcon106.seq - Constructed sequence entries, part 106.
147. gbcon107.seq - Constructed sequence entries, part 107.
148. gbcon108.seq - Constructed sequence entries, part 108.
149. gbcon109.seq - Constructed sequence entries, part 109.
150. gbcon11.seq - Constructed sequence entries, part 11.
151. gbcon110.seq - Constructed sequence entries, part 110.
152. gbcon111.seq - Constructed sequence entries, part 111.
153. gbcon112.seq - Constructed sequence entries, part 112.
154. gbcon113.seq - Constructed sequence entries, part 113.
155. gbcon114.seq - Constructed sequence entries, part 114.
156. gbcon115.seq - Constructed sequence entries, part 115.
157. gbcon116.seq - Constructed sequence entries, part 116.
158. gbcon117.seq - Constructed sequence entries, part 117.
159. gbcon118.seq - Constructed sequence entries, part 118.
160. gbcon119.seq - Constructed sequence entries, part 119.
161. gbcon12.seq - Constructed sequence entries, part 12.
162. gbcon120.seq - Constructed sequence entries, part 120.
163. gbcon121.seq - Constructed sequence entries, part 121.
164. gbcon122.seq - Constructed sequence entries, part 122.
165. gbcon123.seq - Constructed sequence entries, part 123.
166. gbcon124.seq - Constructed sequence entries, part 124.
167. gbcon125.seq - Constructed sequence entries, part 125.
168. gbcon126.seq - Constructed sequence entries, part 126.
169. gbcon127.seq - Constructed sequence entries, part 127.
170. gbcon128.seq - Constructed sequence entries, part 128.
171. gbcon129.seq - Constructed sequence entries, part 129.
172. gbcon13.seq - Constructed sequence entries, part 13.
173. gbcon130.seq - Constructed sequence entries, part 130.
174. gbcon131.seq - Constructed sequence entries, part 131.
175. gbcon132.seq - Constructed sequence entries, part 132.
176. gbcon133.seq - Constructed sequence entries, part 133.
177. gbcon134.seq - Constructed sequence entries, part 134.
178. gbcon135.seq - Constructed sequence entries, part 135.
179. gbcon136.seq - Constructed sequence entries, part 136.
180. gbcon137.seq - Constructed sequence entries, part 137.
181. gbcon138.seq - Constructed sequence entries, part 138.
182. gbcon139.seq - Constructed sequence entries, part 139.
183. gbcon14.seq - Constructed sequence entries, part 14.
184. gbcon140.seq - Constructed sequence entries, part 140.
185. gbcon141.seq - Constructed sequence entries, part 141.
186. gbcon142.seq - Constructed sequence entries, part 142.
187. gbcon143.seq - Constructed sequence entries, part 143.
188. gbcon144.seq - Constructed sequence entries, part 144.
189. gbcon145.seq - Constructed sequence entries, part 145.
190. gbcon146.seq - Constructed sequence entries, part 146.
191. gbcon147.seq - Constructed sequence entries, part 147.
192. gbcon148.seq - Constructed sequence entries, part 148.
193. gbcon149.seq - Constructed sequence entries, part 149.
194. gbcon15.seq - Constructed sequence entries, part 15.
195. gbcon150.seq - Constructed sequence entries, part 150.
196. gbcon151.seq - Constructed sequence entries, part 151.
197. gbcon152.seq - Constructed sequence entries, part 152.
198. gbcon153.seq - Constructed sequence entries, part 153.
199. gbcon154.seq - Constructed sequence entries, part 154.
200. gbcon155.seq - Constructed sequence entries, part 155.
201. gbcon156.seq - Constructed sequence entries, part 156.
202. gbcon157.seq - Constructed sequence entries, part 157.
203. gbcon158.seq - Constructed sequence entries, part 158.
204. gbcon159.seq - Constructed sequence entries, part 159.
205. gbcon16.seq - Constructed sequence entries, part 16.
206. gbcon160.seq - Constructed sequence entries, part 160.
207. gbcon161.seq - Constructed sequence entries, part 161.
208. gbcon162.seq - Constructed sequence entries, part 162.
209. gbcon163.seq - Constructed sequence entries, part 163.
210. gbcon164.seq - Constructed sequence entries, part 164.
211. gbcon165.seq - Constructed sequence entries, part 165.
212. gbcon166.seq - Constructed sequence entries, part 166.
213. gbcon167.seq - Constructed sequence entries, part 167.
214. gbcon168.seq - Constructed sequence entries, part 168.
215. gbcon169.seq - Constructed sequence entries, part 169.
216. gbcon17.seq - Constructed sequence entries, part 17.
217. gbcon170.seq - Constructed sequence entries, part 170.
218. gbcon171.seq - Constructed sequence entries, part 171.
219. gbcon172.seq - Constructed sequence entries, part 172.
220. gbcon173.seq - Constructed sequence entries, part 173.
221. gbcon174.seq - Constructed sequence entries, part 174.
222. gbcon175.seq - Constructed sequence entries, part 175.
223. gbcon176.seq - Constructed sequence entries, part 176.
224. gbcon177.seq - Constructed sequence entries, part 177.
225. gbcon178.seq - Constructed sequence entries, part 178.
226. gbcon179.seq - Constructed sequence entries, part 179.
227. gbcon18.seq - Constructed sequence entries, part 18.
228. gbcon180.seq - Constructed sequence entries, part 180.
229. gbcon181.seq - Constructed sequence entries, part 181.
230. gbcon182.seq - Constructed sequence entries, part 182.
231. gbcon183.seq - Constructed sequence entries, part 183.
232. gbcon184.seq - Constructed sequence entries, part 184.
233. gbcon185.seq - Constructed sequence entries, part 185.
234. gbcon186.seq - Constructed sequence entries, part 186.
235. gbcon187.seq - Constructed sequence entries, part 187.
236. gbcon188.seq - Constructed sequence entries, part 188.
237. gbcon189.seq - Constructed sequence entries, part 189.
238. gbcon19.seq - Constructed sequence entries, part 19.
239. gbcon190.seq - Constructed sequence entries, part 190.
240. gbcon191.seq - Constructed sequence entries, part 191.
241. gbcon192.seq - Constructed sequence entries, part 192.
242. gbcon193.seq - Constructed sequence entries, part 193.
243. gbcon194.seq - Constructed sequence entries, part 194.
244. gbcon195.seq - Constructed sequence entries, part 195.
245. gbcon196.seq - Constructed sequence entries, part 196.
246. gbcon197.seq - Constructed sequence entries, part 197.
247. gbcon198.seq - Constructed sequence entries, part 198.
248. gbcon199.seq - Constructed sequence entries, part 199.
249. gbcon2.seq - Constructed sequence entries, part 2.
250. gbcon20.seq - Constructed sequence entries, part 20.
251. gbcon200.seq - Constructed sequence entries, part 200.
252. gbcon201.seq - Constructed sequence entries, part 201.
253. gbcon202.seq - Constructed sequence entries, part 202.
254. gbcon203.seq - Constructed sequence entries, part 203.
255. gbcon204.seq - Constructed sequence entries, part 204.
256. gbcon205.seq - Constructed sequence entries, part 205.
257. gbcon206.seq - Constructed sequence entries, part 206.
258. gbcon207.seq - Constructed sequence entries, part 207.
259. gbcon208.seq - Constructed sequence entries, part 208.
260. gbcon209.seq - Constructed sequence entries, part 209.
261. gbcon21.seq - Constructed sequence entries, part 21.
262. gbcon210.seq - Constructed sequence entries, part 210.
263. gbcon211.seq - Constructed sequence entries, part 211.
264. gbcon212.seq - Constructed sequence entries, part 212.
265. gbcon213.seq - Constructed sequence entries, part 213.
266. gbcon214.seq - Constructed sequence entries, part 214.
267. gbcon215.seq - Constructed sequence entries, part 215.
268. gbcon216.seq - Constructed sequence entries, part 216.
269. gbcon217.seq - Constructed sequence entries, part 217.
270. gbcon218.seq - Constructed sequence entries, part 218.
271. gbcon219.seq - Constructed sequence entries, part 219.
272. gbcon22.seq - Constructed sequence entries, part 22.
273. gbcon220.seq - Constructed sequence entries, part 220.
274. gbcon221.seq - Constructed sequence entries, part 221.
275. gbcon222.seq - Constructed sequence entries, part 222.
276. gbcon223.seq - Constructed sequence entries, part 223.
277. gbcon224.seq - Constructed sequence entries, part 224.
278. gbcon225.seq - Constructed sequence entries, part 225.
279. gbcon226.seq - Constructed sequence entries, part 226.
280. gbcon227.seq - Constructed sequence entries, part 227.
281. gbcon228.seq - Constructed sequence entries, part 228.
282. gbcon229.seq - Constructed sequence entries, part 229.
283. gbcon23.seq - Constructed sequence entries, part 23.
284. gbcon230.seq - Constructed sequence entries, part 230.
285. gbcon231.seq - Constructed sequence entries, part 231.
286. gbcon232.seq - Constructed sequence entries, part 232.
287. gbcon233.seq - Constructed sequence entries, part 233.
288. gbcon234.seq - Constructed sequence entries, part 234.
289. gbcon235.seq - Constructed sequence entries, part 235.
290. gbcon236.seq - Constructed sequence entries, part 236.
291. gbcon237.seq - Constructed sequence entries, part 237.
292. gbcon238.seq - Constructed sequence entries, part 238.
293. gbcon239.seq - Constructed sequence entries, part 239.
294. gbcon24.seq - Constructed sequence entries, part 24.
295. gbcon240.seq - Constructed sequence entries, part 240.
296. gbcon241.seq - Constructed sequence entries, part 241.
297. gbcon242.seq - Constructed sequence entries, part 242.
298. gbcon243.seq - Constructed sequence entries, part 243.
299. gbcon244.seq - Constructed sequence entries, part 244.
300. gbcon245.seq - Constructed sequence entries, part 245.
301. gbcon246.seq - Constructed sequence entries, part 246.
302. gbcon247.seq - Constructed sequence entries, part 247.
303. gbcon248.seq - Constructed sequence entries, part 248.
304. gbcon249.seq - Constructed sequence entries, part 249.
305. gbcon25.seq - Constructed sequence entries, part 25.
306. gbcon250.seq - Constructed sequence entries, part 250.
307. gbcon251.seq - Constructed sequence entries, part 251.
308. gbcon252.seq - Constructed sequence entries, part 252.
309. gbcon253.seq - Constructed sequence entries, part 253.
310. gbcon254.seq - Constructed sequence entries, part 254.
311. gbcon255.seq - Constructed sequence entries, part 255.
312. gbcon256.seq - Constructed sequence entries, part 256.
313. gbcon257.seq - Constructed sequence entries, part 257.
314. gbcon258.seq - Constructed sequence entries, part 258.
315. gbcon259.seq - Constructed sequence entries, part 259.
316. gbcon26.seq - Constructed sequence entries, part 26.
317. gbcon260.seq - Constructed sequence entries, part 260.
318. gbcon261.seq - Constructed sequence entries, part 261.
319. gbcon262.seq - Constructed sequence entries, part 262.
320. gbcon263.seq - Constructed sequence entries, part 263.
321. gbcon264.seq - Constructed sequence entries, part 264.
322. gbcon265.seq - Constructed sequence entries, part 265.
323. gbcon266.seq - Constructed sequence entries, part 266.
324. gbcon267.seq - Constructed sequence entries, part 267.
325. gbcon27.seq - Constructed sequence entries, part 27.
326. gbcon28.seq - Constructed sequence entries, part 28.
327. gbcon29.seq - Constructed sequence entries, part 29.
328. gbcon3.seq - Constructed sequence entries, part 3.
329. gbcon30.seq - Constructed sequence entries, part 30.
330. gbcon31.seq - Constructed sequence entries, part 31.
331. gbcon32.seq - Constructed sequence entries, part 32.
332. gbcon33.seq - Constructed sequence entries, part 33.
333. gbcon34.seq - Constructed sequence entries, part 34.
334. gbcon35.seq - Constructed sequence entries, part 35.
335. gbcon36.seq - Constructed sequence entries, part 36.
336. gbcon37.seq - Constructed sequence entries, part 37.
337. gbcon38.seq - Constructed sequence entries, part 38.
338. gbcon39.seq - Constructed sequence entries, part 39.
339. gbcon4.seq - Constructed sequence entries, part 4.
340. gbcon40.seq - Constructed sequence entries, part 40.
341. gbcon41.seq - Constructed sequence entries, part 41.
342. gbcon42.seq - Constructed sequence entries, part 42.
343. gbcon43.seq - Constructed sequence entries, part 43.
344. gbcon44.seq - Constructed sequence entries, part 44.
345. gbcon45.seq - Constructed sequence entries, part 45.
346. gbcon46.seq - Constructed sequence entries, part 46.
347. gbcon47.seq - Constructed sequence entries, part 47.
348. gbcon48.seq - Constructed sequence entries, part 48.
349. gbcon49.seq - Constructed sequence entries, part 49.
350. gbcon5.seq - Constructed sequence entries, part 5.
351. gbcon50.seq - Constructed sequence entries, part 50.
352. gbcon51.seq - Constructed sequence entries, part 51.
353. gbcon52.seq - Constructed sequence entries, part 52.
354. gbcon53.seq - Constructed sequence entries, part 53.
355. gbcon54.seq - Constructed sequence entries, part 54.
356. gbcon55.seq - Constructed sequence entries, part 55.
357. gbcon56.seq - Constructed sequence entries, part 56.
358. gbcon57.seq - Constructed sequence entries, part 57.
359. gbcon58.seq - Constructed sequence entries, part 58.
360. gbcon59.seq - Constructed sequence entries, part 59.
361. gbcon6.seq - Constructed sequence entries, part 6.
362. gbcon60.seq - Constructed sequence entries, part 60.
363. gbcon61.seq - Constructed sequence entries, part 61.
364. gbcon62.seq - Constructed sequence entries, part 62.
365. gbcon63.seq - Constructed sequence entries, part 63.
366. gbcon64.seq - Constructed sequence entries, part 64.
367. gbcon65.seq - Constructed sequence entries, part 65.
368. gbcon66.seq - Constructed sequence entries, part 66.
369. gbcon67.seq - Constructed sequence entries, part 67.
370. gbcon68.seq - Constructed sequence entries, part 68.
371. gbcon69.seq - Constructed sequence entries, part 69.
372. gbcon7.seq - Constructed sequence entries, part 7.
373. gbcon70.seq - Constructed sequence entries, part 70.
374. gbcon71.seq - Constructed sequence entries, part 71.
375. gbcon72.seq - Constructed sequence entries, part 72.
376. gbcon73.seq - Constructed sequence entries, part 73.
377. gbcon74.seq - Constructed sequence entries, part 74.
378. gbcon75.seq - Constructed sequence entries, part 75.
379. gbcon76.seq - Constructed sequence entries, part 76.
380. gbcon77.seq - Constructed sequence entries, part 77.
381. gbcon78.seq - Constructed sequence entries, part 78.
382. gbcon79.seq - Constructed sequence entries, part 79.
383. gbcon8.seq - Constructed sequence entries, part 8.
384. gbcon80.seq - Constructed sequence entries, part 80.
385. gbcon81.seq - Constructed sequence entries, part 81.
386. gbcon82.seq - Constructed sequence entries, part 82.
387. gbcon83.seq - Constructed sequence entries, part 83.
388. gbcon84.seq - Constructed sequence entries, part 84.
389. gbcon85.seq - Constructed sequence entries, part 85.
390. gbcon86.seq - Constructed sequence entries, part 86.
391. gbcon87.seq - Constructed sequence entries, part 87.
392. gbcon88.seq - Constructed sequence entries, part 88.
393. gbcon89.seq - Constructed sequence entries, part 89.
394. gbcon9.seq - Constructed sequence entries, part 9.
395. gbcon90.seq - Constructed sequence entries, part 90.
396. gbcon91.seq - Constructed sequence entries, part 91.
397. gbcon92.seq - Constructed sequence entries, part 92.
398. gbcon93.seq - Constructed sequence entries, part 93.
399. gbcon94.seq - Constructed sequence entries, part 94.
400. gbcon95.seq - Constructed sequence entries, part 95.
401. gbcon96.seq - Constructed sequence entries, part 96.
402. gbcon97.seq - Constructed sequence entries, part 97.
403. gbcon98.seq - Constructed sequence entries, part 98.
404. gbcon99.seq - Constructed sequence entries, part 99.
405. gbdel.txt - Accession numbers of entries deleted since the previous release.
406. gbenv1.seq - Environmental sampling sequence entries, part 1.
407. gbenv10.seq - Environmental sampling sequence entries, part 10.
408. gbenv11.seq - Environmental sampling sequence entries, part 11.
409. gbenv12.seq - Environmental sampling sequence entries, part 12.
410. gbenv13.seq - Environmental sampling sequence entries, part 13.
411. gbenv14.seq - Environmental sampling sequence entries, part 14.
412. gbenv15.seq - Environmental sampling sequence entries, part 15.
413. gbenv16.seq - Environmental sampling sequence entries, part 16.
414. gbenv17.seq - Environmental sampling sequence entries, part 17.
415. gbenv18.seq - Environmental sampling sequence entries, part 18.
416. gbenv19.seq - Environmental sampling sequence entries, part 19.
417. gbenv2.seq - Environmental sampling sequence entries, part 2.
418. gbenv20.seq - Environmental sampling sequence entries, part 20.
419. gbenv21.seq - Environmental sampling sequence entries, part 21.
420. gbenv22.seq - Environmental sampling sequence entries, part 22.
421. gbenv23.seq - Environmental sampling sequence entries, part 23.
422. gbenv24.seq - Environmental sampling sequence entries, part 24.
423. gbenv25.seq - Environmental sampling sequence entries, part 25.
424. gbenv26.seq - Environmental sampling sequence entries, part 26.
425. gbenv27.seq - Environmental sampling sequence entries, part 27.
426. gbenv28.seq - Environmental sampling sequence entries, part 28.
427. gbenv29.seq - Environmental sampling sequence entries, part 29.
428. gbenv3.seq - Environmental sampling sequence entries, part 3.
429. gbenv30.seq - Environmental sampling sequence entries, part 30.
430. gbenv31.seq - Environmental sampling sequence entries, part 31.
431. gbenv32.seq - Environmental sampling sequence entries, part 32.
432. gbenv33.seq - Environmental sampling sequence entries, part 33.
433. gbenv34.seq - Environmental sampling sequence entries, part 34.
434. gbenv35.seq - Environmental sampling sequence entries, part 35.
435. gbenv36.seq - Environmental sampling sequence entries, part 36.
436. gbenv37.seq - Environmental sampling sequence entries, part 37.
437. gbenv38.seq - Environmental sampling sequence entries, part 38.
438. gbenv39.seq - Environmental sampling sequence entries, part 39.
439. gbenv4.seq - Environmental sampling sequence entries, part 4.
440. gbenv40.seq - Environmental sampling sequence entries, part 40.
441. gbenv41.seq - Environmental sampling sequence entries, part 41.
442. gbenv42.seq - Environmental sampling sequence entries, part 42.
443. gbenv43.seq - Environmental sampling sequence entries, part 43.
444. gbenv44.seq - Environmental sampling sequence entries, part 44.
445. gbenv45.seq - Environmental sampling sequence entries, part 45.
446. gbenv46.seq - Environmental sampling sequence entries, part 46.
447. gbenv47.seq - Environmental sampling sequence entries, part 47.
448. gbenv48.seq - Environmental sampling sequence entries, part 48.
449. gbenv49.seq - Environmental sampling sequence entries, part 49.
450. gbenv5.seq - Environmental sampling sequence entries, part 5.
451. gbenv50.seq - Environmental sampling sequence entries, part 50.
452. gbenv51.seq - Environmental sampling sequence entries, part 51.
453. gbenv52.seq - Environmental sampling sequence entries, part 52.
454. gbenv53.seq - Environmental sampling sequence entries, part 53.
455. gbenv54.seq - Environmental sampling sequence entries, part 54.
456. gbenv55.seq - Environmental sampling sequence entries, part 55.
457. gbenv56.seq - Environmental sampling sequence entries, part 56.
458. gbenv57.seq - Environmental sampling sequence entries, part 57.
459. gbenv58.seq - Environmental sampling sequence entries, part 58.
460. gbenv59.seq - Environmental sampling sequence entries, part 59.
461. gbenv6.seq - Environmental sampling sequence entries, part 6.
462. gbenv60.seq - Environmental sampling sequence entries, part 60.
463. gbenv61.seq - Environmental sampling sequence entries, part 61.
464. gbenv62.seq - Environmental sampling sequence entries, part 62.
465. gbenv63.seq - Environmental sampling sequence entries, part 63.
466. gbenv64.seq - Environmental sampling sequence entries, part 64.
467. gbenv65.seq - Environmental sampling sequence entries, part 65.
468. gbenv66.seq - Environmental sampling sequence entries, part 66.
469. gbenv67.seq - Environmental sampling sequence entries, part 67.
470. gbenv68.seq - Environmental sampling sequence entries, part 68.
471. gbenv69.seq - Environmental sampling sequence entries, part 69.
472. gbenv7.seq - Environmental sampling sequence entries, part 7.
473. gbenv70.seq - Environmental sampling sequence entries, part 70.
474. gbenv71.seq - Environmental sampling sequence entries, part 71.
475. gbenv72.seq - Environmental sampling sequence entries, part 72.
476. gbenv73.seq - Environmental sampling sequence entries, part 73.
477. gbenv8.seq - Environmental sampling sequence entries, part 8.
478. gbenv9.seq - Environmental sampling sequence entries, part 9.
479. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
480. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
481. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
482. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
483. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
484. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
485. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
486. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
487. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
488. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
489. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
490. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
491. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
492. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
493. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
494. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
495. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
496. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
497. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
498. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
499. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
500. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
501. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
502. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
503. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
504. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
505. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
506. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
507. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
508. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
509. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
510. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
511. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
512. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
513. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
514. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
515. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
516. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
517. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
518. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
519. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
520. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
521. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
522. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
523. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
524. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
525. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
526. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
527. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
528. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
529. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
530. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
531. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
532. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
533. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
534. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
535. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
536. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
537. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
538. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
539. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
540. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
541. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
542. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
543. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
544. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
545. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
546. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
547. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
548. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
549. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
550. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
551. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
552. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
553. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
554. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
555. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
556. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
557. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
558. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
559. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
560. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
561. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
562. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
563. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
564. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
565. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
566. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
567. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
568. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
569. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
570. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
571. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
572. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
573. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
574. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
575. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
576. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
577. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
578. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
579. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
580. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
581. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
582. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
583. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
584. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
585. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
586. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
587. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
588. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
589. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
590. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
591. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
592. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
593. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
594. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
595. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
596. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
597. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
598. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
599. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
600. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
601. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
602. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
603. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
604. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
605. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
606. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
607. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
608. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
609. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
610. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
611. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
612. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
613. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
614. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
615. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
616. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
617. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
618. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
619. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
620. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
621. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
622. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
623. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
624. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
625. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
626. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
627. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
628. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
629. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
630. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
631. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
632. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
633. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
634. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
635. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
636. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
637. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
638. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
639. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
640. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
641. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
642. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
643. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
644. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
645. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
646. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
647. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
648. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
649. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
650. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
651. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
652. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
653. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
654. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
655. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
656. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
657. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
658. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
659. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
660. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
661. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
662. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
663. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
664. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
665. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
666. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
667. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
668. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
669. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
670. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
671. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
672. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
673. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
674. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
675. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
676. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
677. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
678. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
679. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
680. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
681. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
682. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
683. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
684. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
685. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
686. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
687. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
688. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
689. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
690. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
691. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
692. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
693. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
694. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
695. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
696. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
697. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
698. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
699. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
700. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
701. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
702. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
703. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
704. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
705. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
706. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
707. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
708. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
709. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
710. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
711. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
712. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
713. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
714. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
715. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
716. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
717. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
718. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
719. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
720. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
721. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
722. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
723. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
724. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
725. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
726. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
727. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
728. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
729. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
730. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
731. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
732. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
733. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
734. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
735. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
736. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
737. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
738. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
739. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
740. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
741. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
742. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
743. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
744. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
745. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
746. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
747. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
748. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
749. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
750. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
751. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
752. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
753. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
754. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
755. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
756. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
757. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
758. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
759. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
760. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
761. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
762. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
763. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
764. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
765. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
766. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
767. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
768. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
769. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
770. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
771. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
772. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
773. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
774. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
775. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
776. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
777. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
778. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
779. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
780. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
781. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
782. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
783. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
784. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
785. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
786. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
787. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
788. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
789. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
790. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
791. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
792. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
793. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
794. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
795. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
796. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
797. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
798. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
799. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
800. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
801. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
802. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
803. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
804. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
805. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
806. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
807. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
808. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
809. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
810. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
811. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
812. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
813. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
814. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
815. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
816. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
817. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
818. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
819. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
820. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
821. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
822. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
823. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
824. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
825. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
826. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
827. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
828. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
829. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
830. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
831. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
832. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
833. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
834. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
835. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
836. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
837. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
838. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
839. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
840. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
841. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
842. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
843. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
844. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
845. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
846. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
847. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
848. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
849. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
850. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
851. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
852. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
853. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
854. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
855. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
856. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
857. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
858. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
859. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
860. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
861. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
862. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
863. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
864. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
865. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
866. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
867. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
868. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
869. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
870. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
871. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
872. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
873. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
874. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
875. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
876. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
877. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
878. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
879. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
880. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
881. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
882. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
883. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
884. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
885. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
886. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
887. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
888. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
889. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
890. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
891. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
892. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
893. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
894. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
895. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
896. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
897. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
898. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
899. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
900. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
901. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
902. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
903. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
904. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
905. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
906. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
907. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
908. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
909. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
910. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
911. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
912. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
913. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
914. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
915. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
916. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
917. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
918. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
919. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
920. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
921. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
922. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
923. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
924. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
925. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
926. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
927. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
928. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
929. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
930. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
931. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
932. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
933. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
934. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
935. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
936. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
937. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
938. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
939. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
940. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
941. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
942. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
943. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
944. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
945. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
946. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
947. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
948. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
949. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
950. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
951. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
952. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
953. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
954. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
955. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
956. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
957. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
958. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
959. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
960. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
961. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
962. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
963. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
964. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
965. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
966. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
967. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
968. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
969. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
970. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
971. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
972. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
973. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
974. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
975. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
976. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
977. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
978. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
979. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
980. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
981. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
982. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
983. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
984. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
985. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
986. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
987. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
988. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
989. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
990. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
991. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
992. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
993. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
994. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
995. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
996. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
997. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
998. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
999. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1000. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1001. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1002. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1003. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1004. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1005. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1006. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1007. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1008. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1009. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1010. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1011. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1012. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1013. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1014. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1015. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1016. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1017. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1018. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1019. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1020. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1021. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1022. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1023. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1024. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1025. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1026. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1027. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1028. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1029. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1030. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1031. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1032. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1033. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1034. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1035. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1036. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1037. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1038. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1039. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1040. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1041. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1042. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1043. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1044. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1045. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1046. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1047. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1048. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1049. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1050. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1051. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1052. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1053. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1054. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1055. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1056. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1057. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1058. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1059. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1060. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1061. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1062. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1063. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1064. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1065. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1066. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1067. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1068. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1069. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1070. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1071. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1072. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1073. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1074. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1075. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1076. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1077. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1078. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1079. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1080. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1081. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1082. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1083. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1084. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1085. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1086. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1087. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1088. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1089. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1090. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1091. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1092. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1093. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1094. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1095. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1096. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1097. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1098. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1099. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1100. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1101. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1102. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1103. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1104. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1105. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1106. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1107. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1108. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1109. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1110. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1111. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1112. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1113. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1114. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1115. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1116. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1117. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1118. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1119. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1120. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1121. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1122. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1123. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1124. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1125. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1126. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1127. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1128. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1129. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1130. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1131. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1132. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1133. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1134. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1135. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1136. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1137. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1138. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1139. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1140. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1141. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1142. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1143. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1144. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1145. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1146. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1147. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1148. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1149. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1150. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1151. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1152. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1153. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1154. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1155. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1156. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1157. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1158. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1159. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1160. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1161. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1162. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1163. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1164. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1165. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1166. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1167. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1168. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1169. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1170. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1171. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1172. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1173. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1174. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1175. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1176. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1177. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1178. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1179. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1180. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1181. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1182. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1183. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1184. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1185. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1186. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1187. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1188. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1189. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1190. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1191. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1192. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1193. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1194. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1195. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1196. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1197. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1198. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1199. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1200. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1201. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1202. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1203. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1204. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1205. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1206. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1207. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1208. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1209. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1210. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1211. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1212. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1213. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1214. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1215. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1216. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1217. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1218. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1219. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1220. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1221. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1222. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1223. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1224. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1225. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1226. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1227. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1228. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1229. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1230. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1231. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1232. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1233. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1234. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1235. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1236. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1237. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1238. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1239. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1240. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1241. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1242. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1243. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1244. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1245. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1246. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1247. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1248. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1249. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1250. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1251. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1252. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1253. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1254. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1255. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1256. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1257. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1258. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1259. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1260. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1261. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1262. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1263. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1264. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1265. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1266. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1267. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1268. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1269. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1270. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1271. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1272. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1273. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1274. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1275. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1276. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1277. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1278. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1279. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1280. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1281. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1282. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1283. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1284. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1285. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1286. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1287. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1288. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1289. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1290. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1291. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1292. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1293. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1294. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1295. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1296. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1297. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1298. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1299. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1300. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1301. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1302. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1303. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1304. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1305. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1306. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1307. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1308. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1309. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1310. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1311. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1312. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1313. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1314. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1315. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1316. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1317. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1318. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1319. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1320. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1321. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1322. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1323. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1324. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1325. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1326. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1327. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1328. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1329. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1330. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1331. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1332. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1333. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1334. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1335. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1336. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1337. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1338. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1339. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1340. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1341. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1342. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1343. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1344. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1345. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1346. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1347. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1348. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1349. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1350. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1351. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1352. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1353. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1354. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1355. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1356. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1357. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1358. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1359. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1360. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1361. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1362. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1363. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1364. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1365. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1366. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1367. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1368. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1369. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1370. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1371. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1372. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1373. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1374. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1375. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1376. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1377. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1378. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1379. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1380. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1381. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1382. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1383. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1384. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1385. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1386. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1387. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1388. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1389. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1390. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1391. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1392. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1393. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1394. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1395. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1396. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1397. gbinv1.seq - Invertebrate sequence entries, part 1.
1398. gbinv10.seq - Invertebrate sequence entries, part 10.
1399. gbinv11.seq - Invertebrate sequence entries, part 11.
1400. gbinv12.seq - Invertebrate sequence entries, part 12.
1401. gbinv13.seq - Invertebrate sequence entries, part 13.
1402. gbinv14.seq - Invertebrate sequence entries, part 14.
1403. gbinv15.seq - Invertebrate sequence entries, part 15.
1404. gbinv16.seq - Invertebrate sequence entries, part 16.
1405. gbinv17.seq - Invertebrate sequence entries, part 17.
1406. gbinv18.seq - Invertebrate sequence entries, part 18.
1407. gbinv19.seq - Invertebrate sequence entries, part 19.
1408. gbinv2.seq - Invertebrate sequence entries, part 2.
1409. gbinv20.seq - Invertebrate sequence entries, part 20.
1410. gbinv21.seq - Invertebrate sequence entries, part 21.
1411. gbinv22.seq - Invertebrate sequence entries, part 22.
1412. gbinv23.seq - Invertebrate sequence entries, part 23.
1413. gbinv24.seq - Invertebrate sequence entries, part 24.
1414. gbinv25.seq - Invertebrate sequence entries, part 25.
1415. gbinv26.seq - Invertebrate sequence entries, part 26.
1416. gbinv27.seq - Invertebrate sequence entries, part 27.
1417. gbinv28.seq - Invertebrate sequence entries, part 28.
1418. gbinv29.seq - Invertebrate sequence entries, part 29.
1419. gbinv3.seq - Invertebrate sequence entries, part 3.
1420. gbinv30.seq - Invertebrate sequence entries, part 30.
1421. gbinv31.seq - Invertebrate sequence entries, part 31.
1422. gbinv32.seq - Invertebrate sequence entries, part 32.
1423. gbinv33.seq - Invertebrate sequence entries, part 33.
1424. gbinv34.seq - Invertebrate sequence entries, part 34.
1425. gbinv35.seq - Invertebrate sequence entries, part 35.
1426. gbinv36.seq - Invertebrate sequence entries, part 36.
1427. gbinv37.seq - Invertebrate sequence entries, part 37.
1428. gbinv38.seq - Invertebrate sequence entries, part 38.
1429. gbinv39.seq - Invertebrate sequence entries, part 39.
1430. gbinv4.seq - Invertebrate sequence entries, part 4.
1431. gbinv5.seq - Invertebrate sequence entries, part 5.
1432. gbinv6.seq - Invertebrate sequence entries, part 6.
1433. gbinv7.seq - Invertebrate sequence entries, part 7.
1434. gbinv8.seq - Invertebrate sequence entries, part 8.
1435. gbinv9.seq - Invertebrate sequence entries, part 9.
1436. gbmam1.seq - Other mammalian sequence entries, part 1.
1437. gbmam2.seq - Other mammalian sequence entries, part 2.
1438. gbmam3.seq - Other mammalian sequence entries, part 3.
1439. gbmam4.seq - Other mammalian sequence entries, part 4.
1440. gbmam5.seq - Other mammalian sequence entries, part 5.
1441. gbmam6.seq - Other mammalian sequence entries, part 6.
1442. gbmam7.seq - Other mammalian sequence entries, part 7.
1443. gbmam8.seq - Other mammalian sequence entries, part 8.
1444. gbmam9.seq - Other mammalian sequence entries, part 9.
1445. gbnew.txt - Accession numbers of entries new since the previous release.
1446. gbpat1.seq - Patent sequence entries, part 1.
1447. gbpat10.seq - Patent sequence entries, part 10.
1448. gbpat100.seq - Patent sequence entries, part 100.
1449. gbpat101.seq - Patent sequence entries, part 101.
1450. gbpat102.seq - Patent sequence entries, part 102.
1451. gbpat103.seq - Patent sequence entries, part 103.
1452. gbpat104.seq - Patent sequence entries, part 104.
1453. gbpat105.seq - Patent sequence entries, part 105.
1454. gbpat106.seq - Patent sequence entries, part 106.
1455. gbpat107.seq - Patent sequence entries, part 107.
1456. gbpat108.seq - Patent sequence entries, part 108.
1457. gbpat109.seq - Patent sequence entries, part 109.
1458. gbpat11.seq - Patent sequence entries, part 11.
1459. gbpat110.seq - Patent sequence entries, part 110.
1460. gbpat111.seq - Patent sequence entries, part 111.
1461. gbpat112.seq - Patent sequence entries, part 112.
1462. gbpat113.seq - Patent sequence entries, part 113.
1463. gbpat114.seq - Patent sequence entries, part 114.
1464. gbpat115.seq - Patent sequence entries, part 115.
1465. gbpat116.seq - Patent sequence entries, part 116.
1466. gbpat117.seq - Patent sequence entries, part 117.
1467. gbpat118.seq - Patent sequence entries, part 118.
1468. gbpat119.seq - Patent sequence entries, part 119.
1469. gbpat12.seq - Patent sequence entries, part 12.
1470. gbpat120.seq - Patent sequence entries, part 120.
1471. gbpat121.seq - Patent sequence entries, part 121.
1472. gbpat122.seq - Patent sequence entries, part 122.
1473. gbpat123.seq - Patent sequence entries, part 123.
1474. gbpat124.seq - Patent sequence entries, part 124.
1475. gbpat125.seq - Patent sequence entries, part 125.
1476. gbpat126.seq - Patent sequence entries, part 126.
1477. gbpat127.seq - Patent sequence entries, part 127.
1478. gbpat128.seq - Patent sequence entries, part 128.
1479. gbpat129.seq - Patent sequence entries, part 129.
1480. gbpat13.seq - Patent sequence entries, part 13.
1481. gbpat130.seq - Patent sequence entries, part 130.
1482. gbpat131.seq - Patent sequence entries, part 131.
1483. gbpat132.seq - Patent sequence entries, part 132.
1484. gbpat133.seq - Patent sequence entries, part 133.
1485. gbpat134.seq - Patent sequence entries, part 134.
1486. gbpat135.seq - Patent sequence entries, part 135.
1487. gbpat136.seq - Patent sequence entries, part 136.
1488. gbpat137.seq - Patent sequence entries, part 137.
1489. gbpat138.seq - Patent sequence entries, part 138.
1490. gbpat139.seq - Patent sequence entries, part 139.
1491. gbpat14.seq - Patent sequence entries, part 14.
1492. gbpat140.seq - Patent sequence entries, part 140.
1493. gbpat141.seq - Patent sequence entries, part 141.
1494. gbpat142.seq - Patent sequence entries, part 142.
1495. gbpat143.seq - Patent sequence entries, part 143.
1496. gbpat144.seq - Patent sequence entries, part 144.
1497. gbpat145.seq - Patent sequence entries, part 145.
1498. gbpat146.seq - Patent sequence entries, part 146.
1499. gbpat147.seq - Patent sequence entries, part 147.
1500. gbpat148.seq - Patent sequence entries, part 148.
1501. gbpat149.seq - Patent sequence entries, part 149.
1502. gbpat15.seq - Patent sequence entries, part 15.
1503. gbpat150.seq - Patent sequence entries, part 150.
1504. gbpat151.seq - Patent sequence entries, part 151.
1505. gbpat152.seq - Patent sequence entries, part 152.
1506. gbpat153.seq - Patent sequence entries, part 153.
1507. gbpat154.seq - Patent sequence entries, part 154.
1508. gbpat155.seq - Patent sequence entries, part 155.
1509. gbpat156.seq - Patent sequence entries, part 156.
1510. gbpat157.seq - Patent sequence entries, part 157.
1511. gbpat158.seq - Patent sequence entries, part 158.
1512. gbpat159.seq - Patent sequence entries, part 159.
1513. gbpat16.seq - Patent sequence entries, part 16.
1514. gbpat160.seq - Patent sequence entries, part 160.
1515. gbpat161.seq - Patent sequence entries, part 161.
1516. gbpat162.seq - Patent sequence entries, part 162.
1517. gbpat163.seq - Patent sequence entries, part 163.
1518. gbpat164.seq - Patent sequence entries, part 164.
1519. gbpat165.seq - Patent sequence entries, part 165.
1520. gbpat166.seq - Patent sequence entries, part 166.
1521. gbpat167.seq - Patent sequence entries, part 167.
1522. gbpat168.seq - Patent sequence entries, part 168.
1523. gbpat169.seq - Patent sequence entries, part 169.
1524. gbpat17.seq - Patent sequence entries, part 17.
1525. gbpat170.seq - Patent sequence entries, part 170.
1526. gbpat171.seq - Patent sequence entries, part 171.
1527. gbpat172.seq - Patent sequence entries, part 172.
1528. gbpat173.seq - Patent sequence entries, part 173.
1529. gbpat174.seq - Patent sequence entries, part 174.
1530. gbpat175.seq - Patent sequence entries, part 175.
1531. gbpat176.seq - Patent sequence entries, part 176.
1532. gbpat177.seq - Patent sequence entries, part 177.
1533. gbpat178.seq - Patent sequence entries, part 178.
1534. gbpat179.seq - Patent sequence entries, part 179.
1535. gbpat18.seq - Patent sequence entries, part 18.
1536. gbpat180.seq - Patent sequence entries, part 180.
1537. gbpat181.seq - Patent sequence entries, part 181.
1538. gbpat182.seq - Patent sequence entries, part 182.
1539. gbpat183.seq - Patent sequence entries, part 183.
1540. gbpat184.seq - Patent sequence entries, part 184.
1541. gbpat185.seq - Patent sequence entries, part 185.
1542. gbpat186.seq - Patent sequence entries, part 186.
1543. gbpat187.seq - Patent sequence entries, part 187.
1544. gbpat188.seq - Patent sequence entries, part 188.
1545. gbpat189.seq - Patent sequence entries, part 189.
1546. gbpat19.seq - Patent sequence entries, part 19.
1547. gbpat190.seq - Patent sequence entries, part 190.
1548. gbpat191.seq - Patent sequence entries, part 191.
1549. gbpat192.seq - Patent sequence entries, part 192.
1550. gbpat193.seq - Patent sequence entries, part 193.
1551. gbpat194.seq - Patent sequence entries, part 194.
1552. gbpat195.seq - Patent sequence entries, part 195.
1553. gbpat196.seq - Patent sequence entries, part 196.
1554. gbpat197.seq - Patent sequence entries, part 197.
1555. gbpat198.seq - Patent sequence entries, part 198.
1556. gbpat199.seq - Patent sequence entries, part 199.
1557. gbpat2.seq - Patent sequence entries, part 2.
1558. gbpat20.seq - Patent sequence entries, part 20.
1559. gbpat200.seq - Patent sequence entries, part 200.
1560. gbpat201.seq - Patent sequence entries, part 201.
1561. gbpat202.seq - Patent sequence entries, part 202.
1562. gbpat203.seq - Patent sequence entries, part 203.
1563. gbpat204.seq - Patent sequence entries, part 204.
1564. gbpat205.seq - Patent sequence entries, part 205.
1565. gbpat206.seq - Patent sequence entries, part 206.
1566. gbpat207.seq - Patent sequence entries, part 207.
1567. gbpat208.seq - Patent sequence entries, part 208.
1568. gbpat209.seq - Patent sequence entries, part 209.
1569. gbpat21.seq - Patent sequence entries, part 21.
1570. gbpat22.seq - Patent sequence entries, part 22.
1571. gbpat23.seq - Patent sequence entries, part 23.
1572. gbpat24.seq - Patent sequence entries, part 24.
1573. gbpat25.seq - Patent sequence entries, part 25.
1574. gbpat26.seq - Patent sequence entries, part 26.
1575. gbpat27.seq - Patent sequence entries, part 27.
1576. gbpat28.seq - Patent sequence entries, part 28.
1577. gbpat29.seq - Patent sequence entries, part 29.
1578. gbpat3.seq - Patent sequence entries, part 3.
1579. gbpat30.seq - Patent sequence entries, part 30.
1580. gbpat31.seq - Patent sequence entries, part 31.
1581. gbpat32.seq - Patent sequence entries, part 32.
1582. gbpat33.seq - Patent sequence entries, part 33.
1583. gbpat34.seq - Patent sequence entries, part 34.
1584. gbpat35.seq - Patent sequence entries, part 35.
1585. gbpat36.seq - Patent sequence entries, part 36.
1586. gbpat37.seq - Patent sequence entries, part 37.
1587. gbpat38.seq - Patent sequence entries, part 38.
1588. gbpat39.seq - Patent sequence entries, part 39.
1589. gbpat4.seq - Patent sequence entries, part 4.
1590. gbpat40.seq - Patent sequence entries, part 40.
1591. gbpat41.seq - Patent sequence entries, part 41.
1592. gbpat42.seq - Patent sequence entries, part 42.
1593. gbpat43.seq - Patent sequence entries, part 43.
1594. gbpat44.seq - Patent sequence entries, part 44.
1595. gbpat45.seq - Patent sequence entries, part 45.
1596. gbpat46.seq - Patent sequence entries, part 46.
1597. gbpat47.seq - Patent sequence entries, part 47.
1598. gbpat48.seq - Patent sequence entries, part 48.
1599. gbpat49.seq - Patent sequence entries, part 49.
1600. gbpat5.seq - Patent sequence entries, part 5.
1601. gbpat50.seq - Patent sequence entries, part 50.
1602. gbpat51.seq - Patent sequence entries, part 51.
1603. gbpat52.seq - Patent sequence entries, part 52.
1604. gbpat53.seq - Patent sequence entries, part 53.
1605. gbpat54.seq - Patent sequence entries, part 54.
1606. gbpat55.seq - Patent sequence entries, part 55.
1607. gbpat56.seq - Patent sequence entries, part 56.
1608. gbpat57.seq - Patent sequence entries, part 57.
1609. gbpat58.seq - Patent sequence entries, part 58.
1610. gbpat59.seq - Patent sequence entries, part 59.
1611. gbpat6.seq - Patent sequence entries, part 6.
1612. gbpat60.seq - Patent sequence entries, part 60.
1613. gbpat61.seq - Patent sequence entries, part 61.
1614. gbpat62.seq - Patent sequence entries, part 62.
1615. gbpat63.seq - Patent sequence entries, part 63.
1616. gbpat64.seq - Patent sequence entries, part 64.
1617. gbpat65.seq - Patent sequence entries, part 65.
1618. gbpat66.seq - Patent sequence entries, part 66.
1619. gbpat67.seq - Patent sequence entries, part 67.
1620. gbpat68.seq - Patent sequence entries, part 68.
1621. gbpat69.seq - Patent sequence entries, part 69.
1622. gbpat7.seq - Patent sequence entries, part 7.
1623. gbpat70.seq - Patent sequence entries, part 70.
1624. gbpat71.seq - Patent sequence entries, part 71.
1625. gbpat72.seq - Patent sequence entries, part 72.
1626. gbpat73.seq - Patent sequence entries, part 73.
1627. gbpat74.seq - Patent sequence entries, part 74.
1628. gbpat75.seq - Patent sequence entries, part 75.
1629. gbpat76.seq - Patent sequence entries, part 76.
1630. gbpat77.seq - Patent sequence entries, part 77.
1631. gbpat78.seq - Patent sequence entries, part 78.
1632. gbpat79.seq - Patent sequence entries, part 79.
1633. gbpat8.seq - Patent sequence entries, part 8.
1634. gbpat80.seq - Patent sequence entries, part 80.
1635. gbpat81.seq - Patent sequence entries, part 81.
1636. gbpat82.seq - Patent sequence entries, part 82.
1637. gbpat83.seq - Patent sequence entries, part 83.
1638. gbpat84.seq - Patent sequence entries, part 84.
1639. gbpat85.seq - Patent sequence entries, part 85.
1640. gbpat86.seq - Patent sequence entries, part 86.
1641. gbpat87.seq - Patent sequence entries, part 87.
1642. gbpat88.seq - Patent sequence entries, part 88.
1643. gbpat89.seq - Patent sequence entries, part 89.
1644. gbpat9.seq - Patent sequence entries, part 9.
1645. gbpat90.seq - Patent sequence entries, part 90.
1646. gbpat91.seq - Patent sequence entries, part 91.
1647. gbpat92.seq - Patent sequence entries, part 92.
1648. gbpat93.seq - Patent sequence entries, part 93.
1649. gbpat94.seq - Patent sequence entries, part 94.
1650. gbpat95.seq - Patent sequence entries, part 95.
1651. gbpat96.seq - Patent sequence entries, part 96.
1652. gbpat97.seq - Patent sequence entries, part 97.
1653. gbpat98.seq - Patent sequence entries, part 98.
1654. gbpat99.seq - Patent sequence entries, part 99.
1655. gbphg1.seq - Phage sequence entries, part 1.
1656. gbphg2.seq - Phage sequence entries, part 2.
1657. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1658. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1659. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1660. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1661. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1662. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1663. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1664. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1665. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1666. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1667. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1668. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1669. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1670. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1671. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1672. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1673. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1674. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1675. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1676. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1677. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1678. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1679. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1680. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1681. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1682. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1683. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1684. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1685. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1686. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1687. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1688. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1689. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1690. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1691. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1692. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1693. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1694. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1695. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1696. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1697. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1698. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1699. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1700. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1701. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1702. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1703. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1704. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1705. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1706. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1707. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1708. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1709. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1710. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1711. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1712. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1713. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
1714. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
1715. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
1716. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
1717. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
1718. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
1719. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
1720. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
1721. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
1722. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
1723. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1724. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
1725. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1726. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1727. gbpri1.seq - Primate sequence entries, part 1.
1728. gbpri10.seq - Primate sequence entries, part 10.
1729. gbpri11.seq - Primate sequence entries, part 11.
1730. gbpri12.seq - Primate sequence entries, part 12.
1731. gbpri13.seq - Primate sequence entries, part 13.
1732. gbpri14.seq - Primate sequence entries, part 14.
1733. gbpri15.seq - Primate sequence entries, part 15.
1734. gbpri16.seq - Primate sequence entries, part 16.
1735. gbpri17.seq - Primate sequence entries, part 17.
1736. gbpri18.seq - Primate sequence entries, part 18.
1737. gbpri19.seq - Primate sequence entries, part 19.
1738. gbpri2.seq - Primate sequence entries, part 2.
1739. gbpri20.seq - Primate sequence entries, part 20.
1740. gbpri21.seq - Primate sequence entries, part 21.
1741. gbpri22.seq - Primate sequence entries, part 22.
1742. gbpri23.seq - Primate sequence entries, part 23.
1743. gbpri24.seq - Primate sequence entries, part 24.
1744. gbpri25.seq - Primate sequence entries, part 25.
1745. gbpri26.seq - Primate sequence entries, part 26.
1746. gbpri27.seq - Primate sequence entries, part 27.
1747. gbpri28.seq - Primate sequence entries, part 28.
1748. gbpri29.seq - Primate sequence entries, part 29.
1749. gbpri3.seq - Primate sequence entries, part 3.
1750. gbpri30.seq - Primate sequence entries, part 30.
1751. gbpri31.seq - Primate sequence entries, part 31.
1752. gbpri32.seq - Primate sequence entries, part 32.
1753. gbpri33.seq - Primate sequence entries, part 33.
1754. gbpri34.seq - Primate sequence entries, part 34.
1755. gbpri35.seq - Primate sequence entries, part 35.
1756. gbpri36.seq - Primate sequence entries, part 36.
1757. gbpri37.seq - Primate sequence entries, part 37.
1758. gbpri38.seq - Primate sequence entries, part 38.
1759. gbpri39.seq - Primate sequence entries, part 39.
1760. gbpri4.seq - Primate sequence entries, part 4.
1761. gbpri40.seq - Primate sequence entries, part 40.
1762. gbpri41.seq - Primate sequence entries, part 41.
1763. gbpri42.seq - Primate sequence entries, part 42.
1764. gbpri43.seq - Primate sequence entries, part 43.
1765. gbpri44.seq - Primate sequence entries, part 44.
1766. gbpri45.seq - Primate sequence entries, part 45.
1767. gbpri46.seq - Primate sequence entries, part 46.
1768. gbpri47.seq - Primate sequence entries, part 47.
1769. gbpri5.seq - Primate sequence entries, part 5.
1770. gbpri6.seq - Primate sequence entries, part 6.
1771. gbpri7.seq - Primate sequence entries, part 7.
1772. gbpri8.seq - Primate sequence entries, part 8.
1773. gbpri9.seq - Primate sequence entries, part 9.
1774. gbrel.txt - Release notes (this document).
1775. gbrod1.seq - Rodent sequence entries, part 1.
1776. gbrod10.seq - Rodent sequence entries, part 10.
1777. gbrod11.seq - Rodent sequence entries, part 11.
1778. gbrod12.seq - Rodent sequence entries, part 12.
1779. gbrod13.seq - Rodent sequence entries, part 13.
1780. gbrod14.seq - Rodent sequence entries, part 14.
1781. gbrod15.seq - Rodent sequence entries, part 15.
1782. gbrod16.seq - Rodent sequence entries, part 16.
1783. gbrod17.seq - Rodent sequence entries, part 17.
1784. gbrod18.seq - Rodent sequence entries, part 18.
1785. gbrod19.seq - Rodent sequence entries, part 19.
1786. gbrod2.seq - Rodent sequence entries, part 2.
1787. gbrod20.seq - Rodent sequence entries, part 20.
1788. gbrod21.seq - Rodent sequence entries, part 21.
1789. gbrod22.seq - Rodent sequence entries, part 22.
1790. gbrod23.seq - Rodent sequence entries, part 23.
1791. gbrod24.seq - Rodent sequence entries, part 24.
1792. gbrod25.seq - Rodent sequence entries, part 25.
1793. gbrod26.seq - Rodent sequence entries, part 26.
1794. gbrod27.seq - Rodent sequence entries, part 27.
1795. gbrod28.seq - Rodent sequence entries, part 28.
1796. gbrod29.seq - Rodent sequence entries, part 29.
1797. gbrod3.seq - Rodent sequence entries, part 3.
1798. gbrod30.seq - Rodent sequence entries, part 30.
1799. gbrod31.seq - Rodent sequence entries, part 31.
1800. gbrod4.seq - Rodent sequence entries, part 4.
1801. gbrod5.seq - Rodent sequence entries, part 5.
1802. gbrod6.seq - Rodent sequence entries, part 6.
1803. gbrod7.seq - Rodent sequence entries, part 7.
1804. gbrod8.seq - Rodent sequence entries, part 8.
1805. gbrod9.seq - Rodent sequence entries, part 9.
1806. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1807. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1808. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1809. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1810. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1811. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1812. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1813. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1814. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1815. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1816. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1817. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1818. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1819. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1820. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1821. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1822. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1823. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1824. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1825. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1826. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1827. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1828. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1829. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1830. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1831. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1832. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1833. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1834. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1835. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
1836. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
1837. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
1838. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
1839. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
1840. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
1841. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
1842. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
1843. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
1844. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
1845. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1846. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
1847. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
1848. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
1849. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
1850. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
1851. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
1852. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
1853. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
1854. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
1855. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
1856. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1857. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
1858. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
1859. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
1860. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
1861. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
1862. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
1863. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
1864. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
1865. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
1866. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
1867. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1868. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
1869. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
1870. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
1871. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
1872. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
1873. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
1874. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
1875. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
1876. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
1877. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
1878. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1879. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
1880. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
1881. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
1882. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
1883. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
1884. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
1885. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
1886. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
1887. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
1888. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
1889. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1890. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
1891. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
1892. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
1893. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
1894. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
1895. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
1896. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
1897. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1898. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1899. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1900. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1901. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1902. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1903. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1904. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1905. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1906. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1907. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1908. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1909. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1910. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1911. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1912. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1913. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1914. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1915. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1916. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1917. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1918. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1919. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1920. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1921. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1922. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1923. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1924. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1925. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1926. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1927. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1928. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1929. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1930. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1931. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1932. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1933. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1934. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1935. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1936. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1937. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1938. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1939. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1940. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1941. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1942. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1943. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1944. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1945. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1946. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1947. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1948. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1949. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1950. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1951. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1952. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1953. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1954. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1955. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1956. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1957. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1958. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1959. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1960. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1961. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1962. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1963. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1964. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1965. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1966. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1967. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1968. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1969. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1970. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1971. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1972. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1973. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1974. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1975. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
1976. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
1977. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
1978. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1979. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
1980. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
1981. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
1982. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
1983. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
1984. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
1985. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
1986. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
1987. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
1988. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
1989. gbuna1.seq - Unannotated sequence entries, part 1.
1990. gbvrl1.seq - Viral sequence entries, part 1.
1991. gbvrl10.seq - Viral sequence entries, part 10.
1992. gbvrl11.seq - Viral sequence entries, part 11.
1993. gbvrl12.seq - Viral sequence entries, part 12.
1994. gbvrl13.seq - Viral sequence entries, part 13.
1995. gbvrl14.seq - Viral sequence entries, part 14.
1996. gbvrl15.seq - Viral sequence entries, part 15.
1997. gbvrl16.seq - Viral sequence entries, part 16.
1998. gbvrl17.seq - Viral sequence entries, part 17.
1999. gbvrl18.seq - Viral sequence entries, part 18.
2000. gbvrl19.seq - Viral sequence entries, part 19.
2001. gbvrl2.seq - Viral sequence entries, part 2.
2002. gbvrl20.seq - Viral sequence entries, part 20.
2003. gbvrl21.seq - Viral sequence entries, part 21.
2004. gbvrl22.seq - Viral sequence entries, part 22.
2005. gbvrl23.seq - Viral sequence entries, part 23.
2006. gbvrl24.seq - Viral sequence entries, part 24.
2007. gbvrl25.seq - Viral sequence entries, part 25.
2008. gbvrl26.seq - Viral sequence entries, part 26.
2009. gbvrl27.seq - Viral sequence entries, part 27.
2010. gbvrl28.seq - Viral sequence entries, part 28.
2011. gbvrl29.seq - Viral sequence entries, part 29.
2012. gbvrl3.seq - Viral sequence entries, part 3.
2013. gbvrl30.seq - Viral sequence entries, part 30.
2014. gbvrl31.seq - Viral sequence entries, part 31.
2015. gbvrl4.seq - Viral sequence entries, part 4.
2016. gbvrl5.seq - Viral sequence entries, part 5.
2017. gbvrl6.seq - Viral sequence entries, part 6.
2018. gbvrl7.seq - Viral sequence entries, part 7.
2019. gbvrl8.seq - Viral sequence entries, part 8.
2020. gbvrl9.seq - Viral sequence entries, part 9.
2021. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2022. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2023. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2024. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2025. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2026. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2027. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2028. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2029. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2030. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2031. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2032. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2033. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2034. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2035. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2036. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2037. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2038. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2039. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2040. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2041. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2042. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2043. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2044. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2045. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2046. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2047. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2048. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2049. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2050. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2051. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2052. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 202.0 flatfiles require roughly 642 GB (sequence
files only) or 642 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249998855     gbbct1.seq
 245788929     gbbct10.seq
 249129509     gbbct100.seq
 249224889     gbbct101.seq
 242489345     gbbct102.seq
 243138775     gbbct103.seq
 249566272     gbbct104.seq
 217644911     gbbct105.seq
 240216037     gbbct106.seq
  70390176     gbbct107.seq
   6893939     gbbct108.seq
  14226101     gbbct109.seq
 248280217     gbbct11.seq
  23071193     gbbct110.seq
  45141803     gbbct111.seq
  87829731     gbbct112.seq
 170611024     gbbct113.seq
 249997759     gbbct114.seq
 249997987     gbbct115.seq
 246945183     gbbct116.seq
 240357751     gbbct117.seq
 245752486     gbbct118.seq
 249071711     gbbct119.seq
 239032343     gbbct12.seq
 248562791     gbbct120.seq
 248260131     gbbct121.seq
 246031396     gbbct122.seq
 174163979     gbbct123.seq
 246515415     gbbct124.seq
 243899417     gbbct125.seq
 246633597     gbbct126.seq
 241480334     gbbct127.seq
 247938484     gbbct128.seq
 249995111     gbbct129.seq
 246714002     gbbct13.seq
 249998591     gbbct130.seq
  64387823     gbbct131.seq
 249993018     gbbct132.seq
 249998468     gbbct133.seq
 250000110     gbbct134.seq
 249996834     gbbct135.seq
 112316033     gbbct136.seq
 246218509     gbbct14.seq
 242782066     gbbct15.seq
 156268983     gbbct16.seq
 243344119     gbbct17.seq
 249805318     gbbct18.seq
 248179158     gbbct19.seq
 245214449     gbbct2.seq
 249687438     gbbct20.seq
 244053543     gbbct21.seq
 245379631     gbbct22.seq
 242877219     gbbct23.seq
 239679009     gbbct24.seq
 217808916     gbbct25.seq
 242805318     gbbct26.seq
 245838607     gbbct27.seq
 248681194     gbbct28.seq
 247877641     gbbct29.seq
 243506102     gbbct3.seq
 249390867     gbbct30.seq
 244189766     gbbct31.seq
 247339381     gbbct32.seq
 249984621     gbbct33.seq
 249765459     gbbct34.seq
 240948936     gbbct35.seq
 244795539     gbbct36.seq
 249622093     gbbct37.seq
 165336460     gbbct38.seq
 248678824     gbbct39.seq
 244205943     gbbct4.seq
 246942323     gbbct40.seq
 248190418     gbbct41.seq
 246578845     gbbct42.seq
 241884921     gbbct43.seq
 246673305     gbbct44.seq
 249205760     gbbct45.seq
 248558950     gbbct46.seq
 246965565     gbbct47.seq
 241585200     gbbct48.seq
 244262699     gbbct49.seq
 249998784     gbbct5.seq
 244110346     gbbct50.seq
  49416928     gbbct51.seq
 244557955     gbbct52.seq
 245263838     gbbct53.seq
 244223031     gbbct54.seq
 247755718     gbbct55.seq
 246180740     gbbct56.seq
 248412149     gbbct57.seq
 249740778     gbbct58.seq
 244794306     gbbct59.seq
  35821360     gbbct6.seq
 247646038     gbbct60.seq
 248872460     gbbct61.seq
 248407512     gbbct62.seq
 247581111     gbbct63.seq
 249503282     gbbct64.seq
  63783100     gbbct65.seq
 248765405     gbbct66.seq
 248625265     gbbct67.seq
 249954078     gbbct68.seq
 246141876     gbbct69.seq
 249465164     gbbct7.seq
 242884155     gbbct70.seq
 249984121     gbbct71.seq
 234144308     gbbct72.seq
 237679719     gbbct73.seq
 245855058     gbbct74.seq
 242861426     gbbct75.seq
 246471385     gbbct76.seq
 247391699     gbbct77.seq
 248242828     gbbct78.seq
  10359954     gbbct79.seq
 249604258     gbbct8.seq
 246459311     gbbct80.seq
 249822834     gbbct81.seq
 248705016     gbbct82.seq
 240949413     gbbct83.seq
 247217138     gbbct84.seq
 247353774     gbbct85.seq
 239864762     gbbct86.seq
 211356702     gbbct87.seq
 247722102     gbbct88.seq
 248764032     gbbct89.seq
 227662409     gbbct9.seq
 242268559     gbbct90.seq
 248771831     gbbct91.seq
 248920937     gbbct92.seq
 129148698     gbbct93.seq
 247904941     gbbct94.seq
 247789146     gbbct95.seq
 242448058     gbbct96.seq
 245903549     gbbct97.seq
 248180236     gbbct98.seq
 249644278     gbbct99.seq
   8711707     gbchg.txt
 249999120     gbcon1.seq
 249995757     gbcon10.seq
 249998566     gbcon100.seq
 249998527     gbcon101.seq
 249996033     gbcon102.seq
 249999285     gbcon103.seq
 135141019     gbcon104.seq
 249999018     gbcon105.seq
 249995506     gbcon106.seq
 249999938     gbcon107.seq
 249996196     gbcon108.seq
 249994668     gbcon109.seq
 248969709     gbcon11.seq
 158184767     gbcon110.seq
 249997662     gbcon111.seq
 249996981     gbcon112.seq
 249998026     gbcon113.seq
 236167379     gbcon114.seq
 212024720     gbcon115.seq
 249999151     gbcon116.seq
 249991357     gbcon117.seq
 249995392     gbcon118.seq
 249987519     gbcon119.seq
 249362547     gbcon12.seq
  79180141     gbcon120.seq
 249996287     gbcon121.seq
 249999387     gbcon122.seq
 249999532     gbcon123.seq
 223665233     gbcon124.seq
 245417782     gbcon125.seq
 175794823     gbcon126.seq
 249457094     gbcon127.seq
 249844836     gbcon128.seq
 249999148     gbcon129.seq
 247959033     gbcon13.seq
 249998587     gbcon130.seq
 249998139     gbcon131.seq
 200711506     gbcon132.seq
 249998604     gbcon133.seq
 249664036     gbcon134.seq
 248606553     gbcon135.seq
 249867670     gbcon136.seq
 249997704     gbcon137.seq
 249927035     gbcon138.seq
 249998973     gbcon139.seq
 249875925     gbcon14.seq
 140247469     gbcon140.seq
 249999500     gbcon141.seq
 249957262     gbcon142.seq
 249998469     gbcon143.seq
 249999433     gbcon144.seq
 249999984     gbcon145.seq
 249999778     gbcon146.seq
 249998475     gbcon147.seq
 249995741     gbcon148.seq
 234330522     gbcon149.seq
 245299263     gbcon15.seq
 249999875     gbcon150.seq
 249999394     gbcon151.seq
 246338038     gbcon152.seq
 250000258     gbcon153.seq
 205024921     gbcon154.seq
 250000262     gbcon155.seq
 249151565     gbcon156.seq
 249993587     gbcon157.seq
 249999592     gbcon158.seq
 249997174     gbcon159.seq
 249990746     gbcon16.seq
 249997445     gbcon160.seq
 250000116     gbcon161.seq
 162474830     gbcon162.seq
 249999135     gbcon163.seq
 249995358     gbcon164.seq
 249999784     gbcon165.seq
 249994296     gbcon166.seq
 249999931     gbcon167.seq
 191397974     gbcon168.seq
 249997092     gbcon169.seq
  12790430     gbcon17.seq
 248618593     gbcon170.seq
 249992323     gbcon171.seq
 249594558     gbcon172.seq
 249597321     gbcon173.seq
 250000033     gbcon174.seq
 249931039     gbcon175.seq
 249991080     gbcon176.seq
 250000120     gbcon177.seq
 249997509     gbcon178.seq
 143775186     gbcon179.seq
 249993313     gbcon18.seq
 248961058     gbcon180.seq
 249752920     gbcon181.seq
 249999569     gbcon182.seq
 249998949     gbcon183.seq
 249998578     gbcon184.seq
 249998554     gbcon185.seq
 184000347     gbcon186.seq
 249803138     gbcon187.seq
 249999617     gbcon188.seq
 249998001     gbcon189.seq
 249998710     gbcon19.seq
 249999431     gbcon190.seq
 241476631     gbcon191.seq
 249962598     gbcon192.seq
 249995807     gbcon193.seq
 249917505     gbcon194.seq
 248719135     gbcon195.seq
 249995418     gbcon196.seq
 249990737     gbcon197.seq
 249999188     gbcon198.seq
 249999265     gbcon199.seq
 249741633     gbcon2.seq
 249997795     gbcon20.seq
  96662478     gbcon200.seq
 249998885     gbcon201.seq
 249999422     gbcon202.seq
 249999751     gbcon203.seq
 249998203     gbcon204.seq
 178583557     gbcon205.seq
 250000110     gbcon206.seq
 249999468     gbcon207.seq
 249999605     gbcon208.seq
 249999663     gbcon209.seq
 247360413     gbcon21.seq
 138364205     gbcon210.seq
 249998205     gbcon211.seq
 249997897     gbcon212.seq
 249951020     gbcon213.seq
 249999094     gbcon214.seq
 249998675     gbcon215.seq
 148490004     gbcon216.seq
 249998051     gbcon217.seq
 249999468     gbcon218.seq
 249999352     gbcon219.seq
 249999921     gbcon22.seq
 250000204     gbcon220.seq
 249997969     gbcon221.seq
 249998958     gbcon222.seq
 112006167     gbcon223.seq
 249998257     gbcon224.seq
 249994642     gbcon225.seq
 249999210     gbcon226.seq
 249998808     gbcon227.seq
 219065861     gbcon228.seq
 249998544     gbcon229.seq
 249997316     gbcon23.seq
 249990146     gbcon230.seq
 250000040     gbcon231.seq
 249999732     gbcon232.seq
 179694446     gbcon233.seq
 249999780     gbcon234.seq
 249999888     gbcon235.seq
 249999017     gbcon236.seq
 249998855     gbcon237.seq
 250000149     gbcon238.seq
 249927493     gbcon239.seq
  12422265     gbcon24.seq
  21914257     gbcon240.seq
 249996911     gbcon241.seq
 249349046     gbcon242.seq
 249997748     gbcon243.seq
 249997919     gbcon244.seq
 249998424     gbcon245.seq
 249832419     gbcon246.seq
 249987830     gbcon247.seq
 249994827     gbcon248.seq
  87207542     gbcon249.seq
 249996485     gbcon25.seq
 250000047     gbcon250.seq
 250000232     gbcon251.seq
 249995651     gbcon252.seq
 249999033     gbcon253.seq
 200554404     gbcon254.seq
 249907002     gbcon255.seq
 249998607     gbcon256.seq
 249995733     gbcon257.seq
 249992150     gbcon258.seq
 249996798     gbcon259.seq
 249150042     gbcon26.seq
 250000260     gbcon260.seq
 249998560     gbcon261.seq
 249998664     gbcon262.seq
 250000036     gbcon263.seq
 249983873     gbcon264.seq
 249999449     gbcon265.seq
 178792243     gbcon266.seq
  18878472     gbcon267.seq
 134013244     gbcon27.seq
 249999786     gbcon28.seq
 119794062     gbcon29.seq
 248799977     gbcon3.seq
 249993709     gbcon30.seq
 249940538     gbcon31.seq
 249999953     gbcon32.seq
 249990483     gbcon33.seq
 173320925     gbcon34.seq
 249998917     gbcon35.seq
 249996531     gbcon36.seq
 249997326     gbcon37.seq
 249998915     gbcon38.seq
 249999856     gbcon39.seq
 249999336     gbcon4.seq
 212306910     gbcon40.seq
 249997270     gbcon41.seq
 249999221     gbcon42.seq
 249994732     gbcon43.seq
 249996897     gbcon44.seq
 249997078     gbcon45.seq
 249997414     gbcon46.seq
  63412389     gbcon47.seq
 249995423     gbcon48.seq
 249997315     gbcon49.seq
 249997392     gbcon5.seq
 249997250     gbcon50.seq
 249997590     gbcon51.seq
 249996159     gbcon52.seq
  44928861     gbcon53.seq
 249994872     gbcon54.seq
 249995799     gbcon55.seq
 249997684     gbcon56.seq
 249996690     gbcon57.seq
 249997782     gbcon58.seq
  38241897     gbcon59.seq
 249992700     gbcon6.seq
 249998302     gbcon60.seq
 249999150     gbcon61.seq
 249998346     gbcon62.seq
 249994564     gbcon63.seq
 249999492     gbcon64.seq
 154672375     gbcon65.seq
 249999016     gbcon66.seq
 249996777     gbcon67.seq
 249999159     gbcon68.seq
 249995190     gbcon69.seq
  84845138     gbcon7.seq
 185611272     gbcon70.seq
 249996810     gbcon71.seq
 249998700     gbcon72.seq
 249997155     gbcon73.seq
 249997874     gbcon74.seq
 247616447     gbcon75.seq
 249998269     gbcon76.seq
 249995941     gbcon77.seq
 249998068     gbcon78.seq
 249999277     gbcon79.seq
 249993190     gbcon8.seq
 249999797     gbcon80.seq
  98773033     gbcon81.seq
 249997150     gbcon82.seq
 249997442     gbcon83.seq
 249995516     gbcon84.seq
 249996111     gbcon85.seq
 249995971     gbcon86.seq
  64633499     gbcon87.seq
 249998451     gbcon88.seq
 249995859     gbcon89.seq
 249997980     gbcon9.seq
 249994386     gbcon90.seq
 249994858     gbcon91.seq
 249998199     gbcon92.seq
  23638323     gbcon93.seq
 249997115     gbcon94.seq
 249995538     gbcon95.seq
 249998987     gbcon96.seq
 249999150     gbcon97.seq
 199759401     gbcon98.seq
 249994089     gbcon99.seq
    141630     gbdel.txt
 250000146     gbenv1.seq
 249999061     gbenv10.seq
 250000072     gbenv11.seq
  60800566     gbenv12.seq
 249999679     gbenv13.seq
 249999640     gbenv14.seq
 249999583     gbenv15.seq
 249998918     gbenv16.seq
 249998252     gbenv17.seq
 249999022     gbenv18.seq
 249997937     gbenv19.seq
 249997451     gbenv2.seq
 237485187     gbenv20.seq
 249997197     gbenv21.seq
 249998721     gbenv22.seq
 249999065     gbenv23.seq
 249998936     gbenv24.seq
 165266681     gbenv25.seq
 249997957     gbenv26.seq
 249970454     gbenv27.seq
 249999472     gbenv28.seq
 249999115     gbenv29.seq
 249997997     gbenv3.seq
 249999883     gbenv30.seq
 249999260     gbenv31.seq
  38510541     gbenv32.seq
 249999624     gbenv33.seq
 249999262     gbenv34.seq
 249999081     gbenv35.seq
 249998779     gbenv36.seq
 187619797     gbenv37.seq
 249998559     gbenv38.seq
 250000163     gbenv39.seq
 249999002     gbenv4.seq
 249998814     gbenv40.seq
 249999289     gbenv41.seq
 249998579     gbenv42.seq
 250000034     gbenv43.seq
  52546605     gbenv44.seq
 249999817     gbenv45.seq
 249998380     gbenv46.seq
 249998303     gbenv47.seq
 249998213     gbenv48.seq
 195502945     gbenv49.seq
 249998595     gbenv5.seq
 249997555     gbenv50.seq
 249997638     gbenv51.seq
 249995124     gbenv52.seq
 249998999     gbenv53.seq
 249999966     gbenv54.seq
  87987047     gbenv55.seq
 249997289     gbenv56.seq
 249999083     gbenv57.seq
 249999513     gbenv58.seq
 249999748     gbenv59.seq
 249999564     gbenv6.seq
 249999594     gbenv60.seq
  32267399     gbenv61.seq
 249999027     gbenv62.seq
 249998251     gbenv63.seq
 249999864     gbenv64.seq
 249998334     gbenv65.seq
 249998986     gbenv66.seq
    620906     gbenv67.seq
 249998919     gbenv68.seq
 249999285     gbenv69.seq
 132645967     gbenv7.seq
 249999322     gbenv70.seq
 249999622     gbenv71.seq
 249997859     gbenv72.seq
  96970056     gbenv73.seq
 249998566     gbenv8.seq
 249999183     gbenv9.seq
 524289247     gbest1.seq
 524289158     gbest10.seq
 524291902     gbest100.seq
 524289912     gbest101.seq
 524290743     gbest102.seq
 524289639     gbest103.seq
 351828724     gbest104.seq
 524290388     gbest105.seq
 524289379     gbest106.seq
 524294385     gbest107.seq
 382514106     gbest108.seq
 386187830     gbest109.seq
 524291654     gbest11.seq
 379999081     gbest110.seq
 380751998     gbest111.seq
 377681277     gbest112.seq
 381797780     gbest113.seq
 385876837     gbest114.seq
 385240642     gbest115.seq
 384101423     gbest116.seq
 380304624     gbest117.seq
 403282341     gbest118.seq
 479248247     gbest119.seq
 524289807     gbest12.seq
 524289245     gbest120.seq
 524289524     gbest121.seq
 524290259     gbest122.seq
 524290697     gbest123.seq
 470856777     gbest124.seq
 524289979     gbest125.seq
 524289237     gbest126.seq
 524289942     gbest127.seq
 524289528     gbest128.seq
 524292074     gbest129.seq
 144503941     gbest13.seq
 524291514     gbest130.seq
 524291028     gbest131.seq
 524290971     gbest132.seq
 524290429     gbest133.seq
 524291156     gbest134.seq
 524291952     gbest135.seq
 524289008     gbest136.seq
 281121036     gbest137.seq
 524289351     gbest138.seq
 524290231     gbest139.seq
 524290711     gbest14.seq
 524291514     gbest140.seq
 524292168     gbest141.seq
 524292518     gbest142.seq
 524289386     gbest143.seq
 524290933     gbest144.seq
 524292358     gbest145.seq
 524288879     gbest146.seq
 524291013     gbest147.seq
 524290279     gbest148.seq
 524291368     gbest149.seq
 524291671     gbest15.seq
 524289202     gbest150.seq
 458105576     gbest151.seq
 524289935     gbest152.seq
 524289196     gbest153.seq
 524291765     gbest154.seq
 524290591     gbest155.seq
 524290430     gbest156.seq
 524289629     gbest157.seq
 524290851     gbest158.seq
 524288744     gbest159.seq
 524289754     gbest16.seq
 524291723     gbest160.seq
 524290316     gbest161.seq
 524289437     gbest162.seq
 524289769     gbest163.seq
 227436356     gbest164.seq
 524289543     gbest165.seq
 524290264     gbest166.seq
 524290884     gbest167.seq
 524292917     gbest168.seq
 524289588     gbest169.seq
 524290917     gbest17.seq
 524290663     gbest170.seq
 524290043     gbest171.seq
 524290803     gbest172.seq
 524290195     gbest173.seq
 524289733     gbest174.seq
 524289069     gbest175.seq
 524291302     gbest176.seq
 524289846     gbest177.seq
  92085645     gbest178.seq
 524290600     gbest179.seq
 524289433     gbest18.seq
 524291089     gbest180.seq
 524289632     gbest181.seq
 524291377     gbest182.seq
 524290079     gbest183.seq
 524289730     gbest184.seq
 524289078     gbest185.seq
 524290139     gbest186.seq
 524289727     gbest187.seq
 524292493     gbest188.seq
 524291222     gbest189.seq
 524290174     gbest19.seq
 524290791     gbest190.seq
 455649833     gbest191.seq
 524289944     gbest192.seq
 524289606     gbest193.seq
 524292286     gbest194.seq
 524289098     gbest195.seq
 524290866     gbest196.seq
 524289654     gbest197.seq
 524289023     gbest198.seq
 524289969     gbest199.seq
 524289009     gbest2.seq
 524290755     gbest20.seq
 524291168     gbest200.seq
 524289108     gbest201.seq
 524291353     gbest202.seq
 524290862     gbest203.seq
 524291359     gbest204.seq
  54073324     gbest205.seq
 524289867     gbest206.seq
 524290644     gbest207.seq
 524288894     gbest208.seq
 524290897     gbest209.seq
 524289096     gbest21.seq
 524291381     gbest210.seq
 524289067     gbest211.seq
 524289364     gbest212.seq
 524292963     gbest213.seq
 524290160     gbest214.seq
 524290743     gbest215.seq
 478274382     gbest216.seq
 524291397     gbest217.seq
 524288920     gbest218.seq
 524288728     gbest219.seq
 494041803     gbest22.seq
 524291370     gbest220.seq
 524291716     gbest221.seq
 524297366     gbest222.seq
 524291041     gbest223.seq
 524290406     gbest224.seq
 524288857     gbest225.seq
 524290405     gbest226.seq
 524288768     gbest227.seq
 524289313     gbest228.seq
 458472787     gbest229.seq
 491131658     gbest23.seq
 524290219     gbest230.seq
 524289065     gbest231.seq
 524289140     gbest232.seq
 524290878     gbest233.seq
 524288734     gbest234.seq
 524289564     gbest235.seq
 524290899     gbest236.seq
 524292083     gbest237.seq
 524288738     gbest238.seq
 524291570     gbest239.seq
 502305935     gbest24.seq
 524290528     gbest240.seq
 524289385     gbest241.seq
 524289610     gbest242.seq
 524290369     gbest243.seq
 237362312     gbest244.seq
 524291286     gbest245.seq
 524288782     gbest246.seq
 524289168     gbest247.seq
 524289807     gbest248.seq
 524288988     gbest249.seq
 329424071     gbest25.seq
 524290495     gbest250.seq
 524290253     gbest251.seq
 510453232     gbest252.seq
 524290016     gbest253.seq
 524291217     gbest254.seq
 524288936     gbest255.seq
 333952541     gbest256.seq
 524291697     gbest257.seq
 524291013     gbest258.seq
 524288866     gbest259.seq
 524289885     gbest26.seq
 524290473     gbest260.seq
 524289656     gbest261.seq
 524289129     gbest262.seq
 524288905     gbest263.seq
 524290361     gbest264.seq
 524289151     gbest265.seq
 524289534     gbest266.seq
 218245031     gbest267.seq
 524288771     gbest268.seq
 524291609     gbest269.seq
 524291003     gbest27.seq
 524289567     gbest270.seq
 524291890     gbest271.seq
 524290006     gbest272.seq
 524290253     gbest273.seq
 524288871     gbest274.seq
 524292812     gbest275.seq
 524289523     gbest276.seq
 524289671     gbest277.seq
 524290876     gbest278.seq
 356957516     gbest279.seq
 524292474     gbest28.seq
 524292115     gbest280.seq
 524290848     gbest281.seq
 524290421     gbest282.seq
 524289331     gbest283.seq
 524289175     gbest284.seq
 524288979     gbest285.seq
 524288909     gbest286.seq
 524289418     gbest287.seq
 524290646     gbest288.seq
 524291369     gbest289.seq
 524289988     gbest29.seq
 524289872     gbest290.seq
 280316511     gbest291.seq
 524290495     gbest292.seq
 524290101     gbest293.seq
 524290062     gbest294.seq
 524290780     gbest295.seq
 524289263     gbest296.seq
 524289455     gbest297.seq
 524290503     gbest298.seq
 524291609     gbest299.seq
 488098562     gbest3.seq
 524292177     gbest30.seq
 524290935     gbest300.seq
 524289876     gbest301.seq
 469527762     gbest302.seq
 328983341     gbest303.seq
 475757540     gbest304.seq
 472173654     gbest305.seq
 524289492     gbest306.seq
 524291444     gbest307.seq
 524292479     gbest308.seq
 524290514     gbest309.seq
 524290361     gbest31.seq
 524290653     gbest310.seq
 524291153     gbest311.seq
 524290573     gbest312.seq
 524289898     gbest313.seq
 524289790     gbest314.seq
 524291192     gbest315.seq
 387838208     gbest316.seq
 524288779     gbest317.seq
 524289636     gbest318.seq
 524290697     gbest319.seq
 524289000     gbest32.seq
 524290606     gbest320.seq
 524290820     gbest321.seq
 524291042     gbest322.seq
 524290901     gbest323.seq
 524288983     gbest324.seq
 524290507     gbest325.seq
 524288899     gbest326.seq
 524291743     gbest327.seq
 517375944     gbest328.seq
 516142553     gbest329.seq
 524290175     gbest33.seq
 223004388     gbest330.seq
 524289702     gbest331.seq
 524291851     gbest332.seq
 524289653     gbest333.seq
 524290187     gbest334.seq
 524291859     gbest335.seq
 524292602     gbest336.seq
 495804634     gbest337.seq
 524290247     gbest338.seq
 524291872     gbest339.seq
 508717669     gbest34.seq
 524290686     gbest340.seq
 524289419     gbest341.seq
 524291731     gbest342.seq
 524291823     gbest343.seq
 326657456     gbest344.seq
 524289973     gbest345.seq
 524288887     gbest346.seq
 524290696     gbest347.seq
 524290731     gbest348.seq
 524289584     gbest349.seq
 486378327     gbest35.seq
 524290763     gbest350.seq
 510450996     gbest351.seq
 524289691     gbest352.seq
 524290475     gbest353.seq
 524290217     gbest354.seq
 524292022     gbest355.seq
 524290647     gbest356.seq
 524288937     gbest357.seq
 524288760     gbest358.seq
 150934824     gbest359.seq
 488134693     gbest36.seq
 524289567     gbest360.seq
 524289419     gbest361.seq
 524288749     gbest362.seq
 524288991     gbest363.seq
 524290828     gbest364.seq
 524290377     gbest365.seq
 524291700     gbest366.seq
 524290383     gbest367.seq
 524289045     gbest368.seq
 524291228     gbest369.seq
 486983833     gbest37.seq
 524290802     gbest370.seq
  24494285     gbest371.seq
 524289115     gbest372.seq
 524290271     gbest373.seq
 524289891     gbest374.seq
 524288798     gbest375.seq
 524292899     gbest376.seq
 524289881     gbest377.seq
 465181673     gbest378.seq
 524289378     gbest379.seq
 481675618     gbest38.seq
 524291463     gbest380.seq
 524291043     gbest381.seq
 524290413     gbest382.seq
 293440329     gbest383.seq
 524289118     gbest384.seq
 524289922     gbest385.seq
 524289556     gbest386.seq
 524289603     gbest387.seq
 524289764     gbest388.seq
 524291432     gbest389.seq
 485737344     gbest39.seq
 524290548     gbest390.seq
 524288929     gbest391.seq
 524289499     gbest392.seq
 524290416     gbest393.seq
 194545346     gbest394.seq
 524289651     gbest395.seq
 524291810     gbest396.seq
 524290801     gbest397.seq
 524291517     gbest398.seq
 524290159     gbest399.seq
 524290610     gbest4.seq
 132671335     gbest40.seq
 524290323     gbest400.seq
 524289741     gbest401.seq
 524291572     gbest402.seq
 524289407     gbest403.seq
 524289021     gbest404.seq
 524289390     gbest405.seq
 524290202     gbest406.seq
 508752223     gbest407.seq
 524289628     gbest408.seq
 524289807     gbest409.seq
 524289521     gbest41.seq
 524290476     gbest410.seq
 524289696     gbest411.seq
 524290667     gbest412.seq
 524289906     gbest413.seq
 524291772     gbest414.seq
 524290231     gbest415.seq
 524291208     gbest416.seq
 524291072     gbest417.seq
 524291362     gbest418.seq
 524291176     gbest419.seq
 524114197     gbest42.seq
 493363538     gbest420.seq
 524291414     gbest421.seq
 524289776     gbest422.seq
 524289578     gbest423.seq
 524290239     gbest424.seq
 524291978     gbest425.seq
 524291042     gbest426.seq
 524292848     gbest427.seq
 524292102     gbest428.seq
 524290153     gbest429.seq
 524290928     gbest43.seq
 524291080     gbest430.seq
 524289391     gbest431.seq
 524291201     gbest432.seq
 524292560     gbest433.seq
 524289583     gbest434.seq
 126581896     gbest435.seq
 524290543     gbest436.seq
 524292116     gbest437.seq
 524290002     gbest438.seq
 524289359     gbest439.seq
 524289829     gbest44.seq
 524289031     gbest440.seq
 524290864     gbest441.seq
 524289113     gbest442.seq
 524288977     gbest443.seq
 524289179     gbest444.seq
 524289880     gbest445.seq
 524290418     gbest446.seq
 524291613     gbest447.seq
 196382321     gbest448.seq
 524290198     gbest449.seq
 524291541     gbest45.seq
 524288750     gbest450.seq
 524289808     gbest451.seq
 524289953     gbest452.seq
 524291358     gbest453.seq
 524290737     gbest454.seq
 524289353     gbest455.seq
 524289375     gbest456.seq
 524289032     gbest457.seq
 524289994     gbest458.seq
 367838314     gbest459.seq
 524289121     gbest46.seq
 524289914     gbest460.seq
 524289029     gbest461.seq
 524289345     gbest462.seq
 524292395     gbest463.seq
 524289385     gbest464.seq
 524290793     gbest465.seq
 524291457     gbest466.seq
 524291421     gbest467.seq
 524289199     gbest468.seq
 524289992     gbest469.seq
 524291456     gbest47.seq
 524288754     gbest470.seq
 511043289     gbest471.seq
 524289769     gbest472.seq
 524291775     gbest473.seq
 524290953     gbest474.seq
 456477172     gbest475.seq
 524289187     gbest48.seq
 524290643     gbest49.seq
 524289238     gbest5.seq
 524289995     gbest50.seq
 524289587     gbest51.seq
 524290319     gbest52.seq
 524288769     gbest53.seq
 232045247     gbest54.seq
 524288877     gbest55.seq
 524290194     gbest56.seq
 524291006     gbest57.seq
 524288737     gbest58.seq
 524289692     gbest59.seq
 524290797     gbest6.seq
 524290766     gbest60.seq
 524291325     gbest61.seq
 524288984     gbest62.seq
 524291350     gbest63.seq
 524290137     gbest64.seq
 524288742     gbest65.seq
 524290610     gbest66.seq
 442992744     gbest67.seq
 524292321     gbest68.seq
 524288840     gbest69.seq
 524290024     gbest7.seq
 524289814     gbest70.seq
 524289118     gbest71.seq
 524290673     gbest72.seq
 524289023     gbest73.seq
 524291862     gbest74.seq
 524292781     gbest75.seq
 524289441     gbest76.seq
 524289768     gbest77.seq
 524289533     gbest78.seq
 524290805     gbest79.seq
 524291210     gbest8.seq
 159271246     gbest80.seq
 524290746     gbest81.seq
 524290424     gbest82.seq
 524290606     gbest83.seq
 524289906     gbest84.seq
 524289572     gbest85.seq
 524291425     gbest86.seq
 524291229     gbest87.seq
 524290119     gbest88.seq
 524290072     gbest89.seq
 524291402     gbest9.seq
 524290728     gbest90.seq
 524288948     gbest91.seq
 444972403     gbest92.seq
 524289401     gbest93.seq
 524289819     gbest94.seq
 524290182     gbest95.seq
 524290829     gbest96.seq
 524291217     gbest97.seq
 524291574     gbest98.seq
 524289469     gbest99.seq
 524289359     gbgss1.seq
 524291395     gbgss10.seq
 524291969     gbgss100.seq
 524291063     gbgss101.seq
 524290739     gbgss102.seq
 524290507     gbgss103.seq
 410409205     gbgss104.seq
 524290721     gbgss105.seq
 524290122     gbgss106.seq
 524290552     gbgss107.seq
 524290653     gbgss108.seq
 524290925     gbgss109.seq
 524290026     gbgss11.seq
 524288946     gbgss110.seq
 524290885     gbgss111.seq
 524290666     gbgss112.seq
 524290496     gbgss113.seq
 524290738     gbgss114.seq
 524291050     gbgss115.seq
  53849926     gbgss116.seq
 524291170     gbgss117.seq
 524290169     gbgss118.seq
 524289854     gbgss119.seq
 524289031     gbgss12.seq
 524290493     gbgss120.seq
 524289655     gbgss121.seq
 524289488     gbgss122.seq
 524289919     gbgss123.seq
 524290479     gbgss124.seq
 524289236     gbgss125.seq
 524290198     gbgss126.seq
 524291116     gbgss127.seq
 524289301     gbgss128.seq
 192775543     gbgss129.seq
 524291863     gbgss13.seq
 524289379     gbgss130.seq
 524291778     gbgss131.seq
 524290292     gbgss132.seq
 524291495     gbgss133.seq
 524289499     gbgss134.seq
 524291800     gbgss135.seq
 524291144     gbgss136.seq
 524290676     gbgss137.seq
 524290143     gbgss138.seq
 498457742     gbgss139.seq
 524291805     gbgss14.seq
 498423455     gbgss140.seq
 181258331     gbgss141.seq
 524290239     gbgss142.seq
 524292035     gbgss143.seq
 524289138     gbgss144.seq
 524290670     gbgss145.seq
 524290075     gbgss146.seq
 524289364     gbgss147.seq
 524291181     gbgss148.seq
 524288787     gbgss149.seq
 524289526     gbgss15.seq
 524289307     gbgss150.seq
 524290575     gbgss151.seq
 312983605     gbgss152.seq
 524289805     gbgss153.seq
 524290869     gbgss154.seq
 524290428     gbgss155.seq
 524291382     gbgss156.seq
 524289371     gbgss157.seq
 524291208     gbgss158.seq
 524291428     gbgss159.seq
 524289307     gbgss16.seq
 524289136     gbgss160.seq
 524290154     gbgss161.seq
 524289539     gbgss162.seq
 524289491     gbgss163.seq
 132365435     gbgss164.seq
 249999339     gbgss165.seq
 249997712     gbgss166.seq
 250000147     gbgss167.seq
 249997472     gbgss168.seq
  31024228     gbgss169.seq
 524289539     gbgss17.seq
 249997137     gbgss170.seq
 250000033     gbgss171.seq
 249998542     gbgss172.seq
 249998333     gbgss173.seq
 224919493     gbgss174.seq
 249998415     gbgss175.seq
 249998695     gbgss176.seq
 249998511     gbgss177.seq
 249997770     gbgss178.seq
 192950372     gbgss179.seq
 524289024     gbgss18.seq
 249998070     gbgss180.seq
 249997802     gbgss181.seq
 249999823     gbgss182.seq
 249998645     gbgss183.seq
 249999356     gbgss184.seq
  72072573     gbgss185.seq
 249999835     gbgss186.seq
   2112081     gbgss187.seq
  80345119     gbgss188.seq
 249999264     gbgss189.seq
 297814638     gbgss19.seq
 249998538     gbgss190.seq
  87602941     gbgss191.seq
 249999685     gbgss192.seq
 249998355     gbgss193.seq
 249998971     gbgss194.seq
 203257936     gbgss195.seq
 249999232     gbgss196.seq
 249998813     gbgss197.seq
 249999964     gbgss198.seq
 246326993     gbgss199.seq
 524288869     gbgss2.seq
 524290290     gbgss20.seq
 249997836     gbgss200.seq
 249999647     gbgss201.seq
 249998223     gbgss202.seq
 244710946     gbgss203.seq
 249999336     gbgss204.seq
 250000173     gbgss205.seq
 249997063     gbgss206.seq
 249999769     gbgss207.seq
 126496662     gbgss208.seq
 249997387     gbgss209.seq
 524290630     gbgss21.seq
 249997998     gbgss210.seq
 249999931     gbgss211.seq
 249998615     gbgss212.seq
  92409107     gbgss213.seq
 249999742     gbgss214.seq
 249999443     gbgss215.seq
 249998678     gbgss216.seq
 249998232     gbgss217.seq
 249999410     gbgss218.seq
 143863233     gbgss219.seq
 524289208     gbgss22.seq
 249997846     gbgss220.seq
 249999124     gbgss221.seq
 249997821     gbgss222.seq
 249997789     gbgss223.seq
  84917634     gbgss224.seq
 249999461     gbgss225.seq
 249999350     gbgss226.seq
 249998406     gbgss227.seq
 249998619     gbgss228.seq
 249999398     gbgss229.seq
 524289472     gbgss23.seq
 249998013     gbgss230.seq
 100149165     gbgss231.seq
 249999424     gbgss232.seq
 249999963     gbgss233.seq
 249997369     gbgss234.seq
  43648880     gbgss235.seq
  52925443     gbgss236.seq
 249999258     gbgss237.seq
 249998794     gbgss238.seq
 249999176     gbgss239.seq
 524288813     gbgss24.seq
 250000241     gbgss240.seq
 249999861     gbgss241.seq
 249998823     gbgss242.seq
 100729953     gbgss243.seq
 249999617     gbgss244.seq
 250000113     gbgss245.seq
 249997380     gbgss246.seq
 249999823     gbgss247.seq
  27507329     gbgss248.seq
 249997661     gbgss249.seq
 524289565     gbgss25.seq
 249998123     gbgss250.seq
 249999868     gbgss251.seq
 249997812     gbgss252.seq
 249999385     gbgss253.seq
 249998171     gbgss254.seq
 191670984     gbgss255.seq
 249998299     gbgss256.seq
 249998824     gbgss257.seq
 249998817     gbgss258.seq
 225684315     gbgss259.seq
 524290185     gbgss26.seq
 250000034     gbgss260.seq
 249999411     gbgss261.seq
 249998949     gbgss262.seq
 249998290     gbgss263.seq
 249997496     gbgss264.seq
  66032843     gbgss265.seq
 249999961     gbgss266.seq
 249999246     gbgss267.seq
 249997183     gbgss268.seq
 249998878     gbgss269.seq
 524290974     gbgss27.seq
 249998009     gbgss270.seq
 249998219     gbgss271.seq
 249997440     gbgss272.seq
 249999904     gbgss273.seq
  42595235     gbgss274.seq
 249999562     gbgss275.seq
 249998752     gbgss276.seq
 249999600     gbgss277.seq
 249999029     gbgss278.seq
 221982324     gbgss279.seq
 524291373     gbgss28.seq
 249999329     gbgss280.seq
 249998347     gbgss281.seq
 249998273     gbgss282.seq
 249999290     gbgss283.seq
 249998381     gbgss284.seq
 249999821     gbgss285.seq
 249997941     gbgss286.seq
 136832175     gbgss287.seq
 524288970     gbgss29.seq
 524291421     gbgss3.seq
 524290483     gbgss30.seq
  27024235     gbgss31.seq
 524291144     gbgss32.seq
 524289799     gbgss33.seq
 524290542     gbgss34.seq
 524289125     gbgss35.seq
 524290210     gbgss36.seq
 524290379     gbgss37.seq
 524290748     gbgss38.seq
 490815577     gbgss39.seq
 524290271     gbgss4.seq
 524288865     gbgss40.seq
 524291165     gbgss41.seq
 524288864     gbgss42.seq
  20496839     gbgss43.seq
 524290093     gbgss44.seq
 524289612     gbgss45.seq
 524288815     gbgss46.seq
 524290935     gbgss47.seq
 216683422     gbgss48.seq
 524290958     gbgss49.seq
 159850274     gbgss5.seq
 524290909     gbgss50.seq
 524289412     gbgss51.seq
 524290739     gbgss52.seq
 524289834     gbgss53.seq
 524289264     gbgss54.seq
 524290933     gbgss55.seq
 524290452     gbgss56.seq
 524289295     gbgss57.seq
 524290956     gbgss58.seq
 524291484     gbgss59.seq
 524291244     gbgss6.seq
  16241083     gbgss60.seq
 524290870     gbgss61.seq
 524290087     gbgss62.seq
 524291264     gbgss63.seq
 454607847     gbgss64.seq
 524290791     gbgss65.seq
 524288859     gbgss66.seq
 524289978     gbgss67.seq
 524290979     gbgss68.seq
 524291504     gbgss69.seq
 524289786     gbgss7.seq
 524290502     gbgss70.seq
 524288929     gbgss71.seq
 524291182     gbgss72.seq
 524289624     gbgss73.seq
 524289999     gbgss74.seq
 524290884     gbgss75.seq
 524288965     gbgss76.seq
  33474508     gbgss77.seq
 524290001     gbgss78.seq
 524290860     gbgss79.seq
 524289368     gbgss8.seq
 524290604     gbgss80.seq
 524288793     gbgss81.seq
 524290534     gbgss82.seq
 524293309     gbgss83.seq
 524291129     gbgss84.seq
 524288951     gbgss85.seq
 524289843     gbgss86.seq
 524292329     gbgss87.seq
 524291486     gbgss88.seq
 378890090     gbgss89.seq
 524291677     gbgss9.seq
 524291919     gbgss90.seq
 524289553     gbgss91.seq
 524292535     gbgss92.seq
 524291749     gbgss93.seq
 524291967     gbgss94.seq
 524289937     gbgss95.seq
 524291779     gbgss96.seq
 524292054     gbgss97.seq
 524288810     gbgss98.seq
 524290782     gbgss99.seq
 249986576     gbhtc1.seq
 249997636     gbhtc10.seq
 249999382     gbhtc11.seq
 106880201     gbhtc12.seq
 249998849     gbhtc13.seq
 249999799     gbhtc14.seq
 108687018     gbhtc15.seq
 249998271     gbhtc2.seq
 249993125     gbhtc3.seq
 249988171     gbhtc4.seq
 249990143     gbhtc5.seq
 249997249     gbhtc6.seq
 249999642     gbhtc7.seq
  83923962     gbhtc8.seq
 249999161     gbhtc9.seq
 249909505     gbhtg1.seq
 249953472     gbhtg10.seq
 249912288     gbhtg100.seq
 249866447     gbhtg101.seq
 249548804     gbhtg102.seq
 249948054     gbhtg103.seq
   3703991     gbhtg104.seq
 249884211     gbhtg105.seq
 249900259     gbhtg106.seq
 249867899     gbhtg107.seq
 249954817     gbhtg108.seq
 249974896     gbhtg109.seq
    799345     gbhtg11.seq
 249774322     gbhtg110.seq
 167855779     gbhtg111.seq
 249811005     gbhtg112.seq
 249854435     gbhtg113.seq
 249790554     gbhtg114.seq
 249920554     gbhtg115.seq
 249895428     gbhtg116.seq
 249953652     gbhtg117.seq
 244811137     gbhtg118.seq
 184662682     gbhtg119.seq
 249888187     gbhtg12.seq
 249814763     gbhtg120.seq
 249467733     gbhtg121.seq
 249998003     gbhtg122.seq
 249871765     gbhtg123.seq
 249972482     gbhtg124.seq
  95846595     gbhtg125.seq
 249860737     gbhtg126.seq
 249838185     gbhtg127.seq
 249821150     gbhtg128.seq
 249911176     gbhtg129.seq
 249968064     gbhtg13.seq
 249980071     gbhtg130.seq
 134314079     gbhtg131.seq
 249758419     gbhtg132.seq
 249798662     gbhtg133.seq
 249841930     gbhtg134.seq
 249821694     gbhtg135.seq
 249958549     gbhtg136.seq
 249841932     gbhtg137.seq
 249912548     gbhtg138.seq
 249889808     gbhtg139.seq
 249584228     gbhtg14.seq
 249983218     gbhtg140.seq
 217122091     gbhtg141.seq
 249771919     gbhtg15.seq
 249739055     gbhtg16.seq
 249165958     gbhtg17.seq
 249979906     gbhtg18.seq
 249677324     gbhtg19.seq
 249996486     gbhtg2.seq
 249986017     gbhtg20.seq
 237141712     gbhtg21.seq
 249756771     gbhtg22.seq
 249864520     gbhtg23.seq
 249983387     gbhtg24.seq
 249917987     gbhtg25.seq
 249757014     gbhtg26.seq
 249887743     gbhtg27.seq
 249957959     gbhtg28.seq
 249838349     gbhtg29.seq
 249996436     gbhtg3.seq
 249989483     gbhtg30.seq
 225321816     gbhtg31.seq
 249823600     gbhtg32.seq
 249917467     gbhtg33.seq
 249925852     gbhtg34.seq
 249914652     gbhtg35.seq
 249854015     gbhtg36.seq
 249811756     gbhtg37.seq
 249764947     gbhtg38.seq
 249624028     gbhtg39.seq
 249972999     gbhtg4.seq
 249836270     gbhtg40.seq
 224361298     gbhtg41.seq
 249887371     gbhtg42.seq
 249786751     gbhtg43.seq
 249974443     gbhtg44.seq
 249775813     gbhtg45.seq
 249970855     gbhtg46.seq
 249705898     gbhtg47.seq
 249863791     gbhtg48.seq
 249890155     gbhtg49.seq
 249908886     gbhtg5.seq
 249899893     gbhtg50.seq
 234810527     gbhtg51.seq
 249734802     gbhtg52.seq
 249975057     gbhtg53.seq
 249785122     gbhtg54.seq
 249720629     gbhtg55.seq
 249959671     gbhtg56.seq
  18795824     gbhtg57.seq
 249859967     gbhtg58.seq
 249826451     gbhtg59.seq
 249993239     gbhtg6.seq
 249998076     gbhtg60.seq
 249924538     gbhtg61.seq
 225131070     gbhtg62.seq
 249972686     gbhtg63.seq
 249907389     gbhtg64.seq
 249800911     gbhtg65.seq
 249764876     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249979624     gbhtg69.seq
 249808932     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249765531     gbhtg72.seq
 223423710     gbhtg73.seq
 249942316     gbhtg74.seq
 249842954     gbhtg75.seq
 249912144     gbhtg76.seq
 249849389     gbhtg77.seq
 235439678     gbhtg78.seq
 249876265     gbhtg79.seq
 249827069     gbhtg8.seq
 249973670     gbhtg80.seq
 249883625     gbhtg81.seq
 249894302     gbhtg82.seq
 202307563     gbhtg83.seq
 249860907     gbhtg84.seq
 249957364     gbhtg85.seq
 249853168     gbhtg86.seq
 249877911     gbhtg87.seq
 206015973     gbhtg88.seq
 249886785     gbhtg89.seq
 249952731     gbhtg9.seq
 249869354     gbhtg90.seq
 249776257     gbhtg91.seq
 249874994     gbhtg92.seq
 194411500     gbhtg93.seq
 249975900     gbhtg94.seq
 250000054     gbhtg95.seq
 249903804     gbhtg96.seq
 249804903     gbhtg97.seq
 161658952     gbhtg98.seq
 249871688     gbhtg99.seq
 249998358     gbinv1.seq
 249997328     gbinv10.seq
 249998464     gbinv11.seq
 197581339     gbinv12.seq
 250000106     gbinv13.seq
 249998467     gbinv14.seq
 249999750     gbinv15.seq
 163781061     gbinv16.seq
 249999364     gbinv17.seq
 249756592     gbinv18.seq
 249998678     gbinv19.seq
 249972234     gbinv2.seq
 249997938     gbinv20.seq
 250000053     gbinv21.seq
  31656658     gbinv22.seq
 229852251     gbinv23.seq
 175506967     gbinv24.seq
 249988731     gbinv25.seq
 249998905     gbinv26.seq
 203976956     gbinv27.seq
 249999121     gbinv28.seq
 249997791     gbinv29.seq
 249936500     gbinv3.seq
 249999022     gbinv30.seq
 249997969     gbinv31.seq
 118630972     gbinv32.seq
 249997675     gbinv33.seq
 249999821     gbinv34.seq
 249998097     gbinv35.seq
 249997278     gbinv36.seq
 249999891     gbinv37.seq
 249993550     gbinv38.seq
  65430594     gbinv39.seq
 228550560     gbinv4.seq
 250000256     gbinv5.seq
 249997953     gbinv6.seq
 249974355     gbinv7.seq
 173126159     gbinv8.seq
 249999705     gbinv9.seq
 249918160     gbmam1.seq
 249999722     gbmam2.seq
 249994022     gbmam3.seq
 250000230     gbmam4.seq
 249999675     gbmam5.seq
 249997467     gbmam6.seq
 249998429     gbmam7.seq
 249821656     gbmam8.seq
  39080545     gbmam9.seq
  45548407     gbnew.txt
 249993276     gbpat1.seq
 249999223     gbpat10.seq
 249999065     gbpat100.seq
 249999793     gbpat101.seq
 149112469     gbpat102.seq
 249999880     gbpat103.seq
 249999565     gbpat104.seq
 249929731     gbpat105.seq
 249824879     gbpat106.seq
 249998856     gbpat107.seq
 192960437     gbpat108.seq
 249999696     gbpat109.seq
 179916914     gbpat11.seq
 249999649     gbpat110.seq
 249998813     gbpat111.seq
  80207713     gbpat112.seq
 249999531     gbpat113.seq
 249999485     gbpat114.seq
 249994753     gbpat115.seq
 250000067     gbpat116.seq
 249951788     gbpat117.seq
  66835452     gbpat118.seq
 249999441     gbpat119.seq
 249999086     gbpat12.seq
 249999845     gbpat120.seq
 249999888     gbpat121.seq
 249999095     gbpat122.seq
 160256390     gbpat123.seq
 249999974     gbpat124.seq
 249999633     gbpat125.seq
 234784218     gbpat126.seq
 249991591     gbpat127.seq
 249970935     gbpat128.seq
 249999681     gbpat129.seq
 250000225     gbpat13.seq
 249997397     gbpat130.seq
 249997452     gbpat131.seq
  66832984     gbpat132.seq
 249992315     gbpat133.seq
 249999867     gbpat134.seq
 250000197     gbpat135.seq
 249999821     gbpat136.seq
 249998337     gbpat137.seq
  18437114     gbpat138.seq
 249999655     gbpat139.seq
 250000237     gbpat14.seq
 249998828     gbpat140.seq
 249999803     gbpat141.seq
 249999630     gbpat142.seq
  46945969     gbpat143.seq
 249999271     gbpat144.seq
 249999873     gbpat145.seq
 249999008     gbpat146.seq
 234349056     gbpat147.seq
 249999644     gbpat148.seq
 249999868     gbpat149.seq
 249999168     gbpat15.seq
 249999695     gbpat150.seq
  86184716     gbpat151.seq
 249999922     gbpat152.seq
 249998538     gbpat153.seq
 249999946     gbpat154.seq
  63657567     gbpat155.seq
 249998676     gbpat156.seq
 249997142     gbpat157.seq
 249999537     gbpat158.seq
 249999298     gbpat159.seq
 249999998     gbpat16.seq
 249999382     gbpat160.seq
 249998805     gbpat161.seq
 223254614     gbpat162.seq
 250000249     gbpat163.seq
 249999893     gbpat164.seq
 249999893     gbpat165.seq
 220539897     gbpat166.seq
 249999753     gbpat167.seq
 249998398     gbpat168.seq
 250000034     gbpat169.seq
  65961427     gbpat17.seq
  12462061     gbpat170.seq
 249993169     gbpat171.seq
 249996832     gbpat172.seq
 249999784     gbpat173.seq
 249998974     gbpat174.seq
  90655381     gbpat175.seq
 249999464     gbpat176.seq
 249999105     gbpat177.seq
 249997208     gbpat178.seq
 245678256     gbpat179.seq
 250000027     gbpat18.seq
 249999880     gbpat180.seq
 249997984     gbpat181.seq
 250000215     gbpat182.seq
 249997743     gbpat183.seq
 214724548     gbpat184.seq
 249991734     gbpat185.seq
 249199085     gbpat186.seq
 250000089     gbpat187.seq
 249998602     gbpat188.seq
 181175428     gbpat189.seq
 249999801     gbpat19.seq
 249548891     gbpat190.seq
 248492767     gbpat191.seq
 249998205     gbpat192.seq
 250000136     gbpat193.seq
 249978931     gbpat194.seq
 166099261     gbpat195.seq
 249999315     gbpat196.seq
 249999444     gbpat197.seq
 249999502     gbpat198.seq
 249999714     gbpat199.seq
 249999989     gbpat2.seq
 249999814     gbpat20.seq
  66614059     gbpat200.seq
 249998696     gbpat201.seq
 249997196     gbpat202.seq
 250000245     gbpat203.seq
 249994750     gbpat204.seq
 249997233     gbpat205.seq
 243856578     gbpat206.seq
 249999450     gbpat207.seq
 249999362     gbpat208.seq
 219351226     gbpat209.seq
 249995258     gbpat21.seq
 186236630     gbpat22.seq
 249999403     gbpat23.seq
 249792347     gbpat24.seq
 249999102     gbpat25.seq
 249999706     gbpat26.seq
  71630022     gbpat27.seq
 250000026     gbpat28.seq
 249999640     gbpat29.seq
 249998811     gbpat3.seq
 249999163     gbpat30.seq
 249993028     gbpat31.seq
 249999291     gbpat32.seq
 180375704     gbpat33.seq
 249998562     gbpat34.seq
 249998936     gbpat35.seq
 250000016     gbpat36.seq
 250000107     gbpat37.seq
 250000020     gbpat38.seq
  53341844     gbpat39.seq
 249999974     gbpat4.seq
 249998516     gbpat40.seq
 249949799     gbpat41.seq
 249999682     gbpat42.seq
 249999820     gbpat43.seq
 249999045     gbpat44.seq
 249912322     gbpat45.seq
 249999213     gbpat46.seq
 249996401     gbpat47.seq
 171736605     gbpat48.seq
 250000117     gbpat49.seq
  71727149     gbpat5.seq
 249999139     gbpat50.seq
 249996276     gbpat51.seq
 249999732     gbpat52.seq
 222942647     gbpat53.seq
 249999057     gbpat54.seq
 249999815     gbpat55.seq
 250000246     gbpat56.seq
 165006348     gbpat57.seq
 249906083     gbpat58.seq
 249999009     gbpat59.seq
 249999527     gbpat6.seq
 250000264     gbpat60.seq
 249999270     gbpat61.seq
 135430612     gbpat62.seq
 249998924     gbpat63.seq
 249998801     gbpat64.seq
 249997619     gbpat65.seq
 249998578     gbpat66.seq
 249999274     gbpat67.seq
 249999367     gbpat68.seq
 144894652     gbpat69.seq
 249999328     gbpat7.seq
 249999757     gbpat70.seq
 249999899     gbpat71.seq
 249998837     gbpat72.seq
 244406583     gbpat73.seq
 248969297     gbpat74.seq
 244459306     gbpat75.seq
 247876384     gbpat76.seq
 249999804     gbpat77.seq
 160624439     gbpat78.seq
 250000121     gbpat79.seq
 249988536     gbpat8.seq
 249999657     gbpat80.seq
 249999470     gbpat81.seq
 249999644     gbpat82.seq
 249994702     gbpat83.seq
 249999365     gbpat84.seq
  99333366     gbpat85.seq
 249159493     gbpat86.seq
 249999916     gbpat87.seq
 249999834     gbpat88.seq
 249999380     gbpat89.seq
 249999495     gbpat9.seq
 249999163     gbpat90.seq
 249999627     gbpat91.seq
 145305049     gbpat92.seq
 249999209     gbpat93.seq
 249998968     gbpat94.seq
 249999939     gbpat95.seq
 250000257     gbpat96.seq
 196969104     gbpat97.seq
 249999051     gbpat98.seq
 249998995     gbpat99.seq
 249996524     gbphg1.seq
  93552747     gbphg2.seq
 249996609     gbpln1.seq
  37685750     gbpln10.seq
 249997348     gbpln11.seq
 249995109     gbpln12.seq
 249999015     gbpln13.seq
 249970511     gbpln14.seq
 215758243     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
 249747885     gbpln19.seq
 249947683     gbpln2.seq
 249776707     gbpln20.seq
 249151402     gbpln21.seq
 249675716     gbpln22.seq
  73966772     gbpln23.seq
 249998149     gbpln24.seq
 100100004     gbpln25.seq
 249997512     gbpln26.seq
 249998502     gbpln27.seq
 249146142     gbpln28.seq
 222591760     gbpln29.seq
 249874577     gbpln3.seq
 181013464     gbpln30.seq
 247224100     gbpln31.seq
 249998637     gbpln32.seq
 249702155     gbpln33.seq
 249999217     gbpln34.seq
 249999437     gbpln35.seq
 205699591     gbpln36.seq
 249996806     gbpln37.seq
 249997670     gbpln38.seq
 249996758     gbpln39.seq
 249907423     gbpln4.seq
 249998631     gbpln40.seq
 145944005     gbpln41.seq
 249997877     gbpln42.seq
 249998040     gbpln43.seq
 250000172     gbpln44.seq
 249998447     gbpln45.seq
 249964501     gbpln46.seq
 239171441     gbpln47.seq
 249999558     gbpln48.seq
 248794738     gbpln49.seq
 249899068     gbpln5.seq
 249999566     gbpln50.seq
 249999482     gbpln51.seq
 249999282     gbpln52.seq
 249997775     gbpln53.seq
  21455376     gbpln54.seq
 249999613     gbpln55.seq
 249998265     gbpln56.seq
 249998737     gbpln57.seq
 249999676     gbpln58.seq
 249997932     gbpln59.seq
 249833673     gbpln6.seq
   5990957     gbpln60.seq
 249997713     gbpln61.seq
 249998093     gbpln62.seq
 250000044     gbpln63.seq
 249997092     gbpln64.seq
 249964418     gbpln65.seq
 249973237     gbpln66.seq
 249999639     gbpln67.seq
 249995939     gbpln68.seq
 249982654     gbpln69.seq
 249905829     gbpln7.seq
   3330988     gbpln70.seq
 250000254     gbpln8.seq
 249999618     gbpln9.seq
 149065922     gbpri1.seq
 249904984     gbpri10.seq
 138478001     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249865833     gbpri16.seq
 249867629     gbpri17.seq
 249758014     gbpri18.seq
 249922775     gbpri19.seq
 249999705     gbpri2.seq
 249959135     gbpri20.seq
 249969488     gbpri21.seq
 249999952     gbpri22.seq
  88142377     gbpri23.seq
 177417344     gbpri24.seq
 249994724     gbpri25.seq
 211429449     gbpri26.seq
 249925296     gbpri27.seq
 249919042     gbpri28.seq
 249998469     gbpri29.seq
 249750175     gbpri3.seq
 249893395     gbpri30.seq
 249950984     gbpri31.seq
 249970932     gbpri32.seq
 249999192     gbpri33.seq
 249998555     gbpri34.seq
  27100713     gbpri35.seq
 249993971     gbpri36.seq
 249995513     gbpri37.seq
 249735396     gbpri38.seq
 249995925     gbpri39.seq
 249843903     gbpri4.seq
 250000098     gbpri40.seq
 193102969     gbpri41.seq
 249999919     gbpri42.seq
 249967224     gbpri43.seq
 249939406     gbpri44.seq
 249996826     gbpri45.seq
 250000013     gbpri46.seq
 244526973     gbpri47.seq
 249884061     gbpri5.seq
 249911054     gbpri6.seq
 249908601     gbpri7.seq
 249974370     gbpri8.seq
 249851215     gbpri9.seq
    350742     gbrel.txt
 249844181     gbrod1.seq
 249851139     gbrod10.seq
  71330010     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249939922     gbrod18.seq
 249999726     gbrod19.seq
 249818042     gbrod2.seq
   5744990     gbrod20.seq
 249865336     gbrod21.seq
 249753433     gbrod22.seq
 191021026     gbrod23.seq
 249998777     gbrod24.seq
 249995608     gbrod25.seq
 249786180     gbrod26.seq
 249999644     gbrod27.seq
 249999231     gbrod28.seq
 249995978     gbrod29.seq
 249938719     gbrod3.seq
 249989465     gbrod30.seq
  79170742     gbrod31.seq
 249827380     gbrod4.seq
 249762390     gbrod5.seq
 249830922     gbrod6.seq
 249784750     gbrod7.seq
 249863832     gbrod8.seq
 249958019     gbrod9.seq
 249999089     gbsts1.seq
 249997655     gbsts10.seq
 210923828     gbsts11.seq
 249996524     gbsts12.seq
 249998489     gbsts13.seq
 249998087     gbsts14.seq
 249998702     gbsts15.seq
  24527763     gbsts16.seq
 250000234     gbsts17.seq
 249998034     gbsts18.seq
 249999674     gbsts19.seq
 249999717     gbsts2.seq
 150125217     gbsts20.seq
 250000241     gbsts3.seq
 249999087     gbsts4.seq
  39693597     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998399     gbsts9.seq
 249995907     gbsyn1.seq
 249997565     gbsyn2.seq
 249971346     gbsyn3.seq
 249964346     gbsyn4.seq
 249959740     gbsyn5.seq
 249968832     gbsyn6.seq
 202255311     gbsyn7.seq
 249999751     gbtsa1.seq
  56875503     gbtsa10.seq
 249999340     gbtsa100.seq
 249999346     gbtsa101.seq
 249997672     gbtsa102.seq
 249999551     gbtsa103.seq
 249999779     gbtsa104.seq
 227289492     gbtsa105.seq
 249998448     gbtsa106.seq
 249999610     gbtsa107.seq
 249999372     gbtsa108.seq
 249997269     gbtsa109.seq
 249999071     gbtsa11.seq
 249999746     gbtsa110.seq
    176605     gbtsa111.seq
 249998403     gbtsa112.seq
 249999879     gbtsa113.seq
 249998407     gbtsa114.seq
 220793968     gbtsa115.seq
 249989678     gbtsa116.seq
 249996801     gbtsa117.seq
 249998091     gbtsa118.seq
 249999633     gbtsa119.seq
 249997105     gbtsa12.seq
 249999198     gbtsa120.seq
 249999901     gbtsa121.seq
 143845765     gbtsa122.seq
 249999536     gbtsa123.seq
 249998915     gbtsa124.seq
 250000174     gbtsa125.seq
 249999584     gbtsa126.seq
 249997105     gbtsa127.seq
 196200322     gbtsa128.seq
 249999600     gbtsa129.seq
 249999445     gbtsa13.seq
 249996475     gbtsa130.seq
 249999082     gbtsa131.seq
 249996441     gbtsa132.seq
 133581626     gbtsa133.seq
 249995766     gbtsa134.seq
 249998592     gbtsa135.seq
 249999280     gbtsa136.seq
 249997940     gbtsa137.seq
  36107534     gbtsa138.seq
 249998620     gbtsa139.seq
 250000126     gbtsa14.seq
 249999594     gbtsa140.seq
 249997728     gbtsa141.seq
 249999490     gbtsa142.seq
 249998415     gbtsa143.seq
 249999441     gbtsa144.seq
 249999497     gbtsa145.seq
 249998320     gbtsa146.seq
  53889829     gbtsa147.seq
 249997955     gbtsa148.seq
 249998444     gbtsa149.seq
 209212004     gbtsa15.seq
 249999972     gbtsa150.seq
 249998889     gbtsa151.seq
 249998461     gbtsa152.seq
 249998274     gbtsa153.seq
 249999603     gbtsa154.seq
 249997468     gbtsa155.seq
  47576562     gbtsa156.seq
 249997341     gbtsa16.seq
 249999795     gbtsa17.seq
 249998909     gbtsa18.seq
 250000152     gbtsa19.seq
 249999086     gbtsa2.seq
 160756224     gbtsa20.seq
 249998989     gbtsa21.seq
 249996697     gbtsa22.seq
 250000202     gbtsa23.seq
 249996363     gbtsa24.seq
 249996354     gbtsa25.seq
  14680057     gbtsa26.seq
 249999463     gbtsa27.seq
 249999328     gbtsa28.seq
 249999843     gbtsa29.seq
 249998297     gbtsa3.seq
 249999306     gbtsa30.seq
 249999445     gbtsa31.seq
 249996845     gbtsa32.seq
  77066999     gbtsa33.seq
 249998838     gbtsa34.seq
 250000120     gbtsa35.seq
 249997735     gbtsa36.seq
 249997498     gbtsa37.seq
 249998198     gbtsa38.seq
 249998877     gbtsa39.seq
 249999402     gbtsa4.seq
 249998290     gbtsa40.seq
  34398944     gbtsa41.seq
 249999415     gbtsa42.seq
 249998692     gbtsa43.seq
 249999756     gbtsa44.seq
 249999818     gbtsa45.seq
  77518171     gbtsa46.seq
 249999788     gbtsa47.seq
 249999066     gbtsa48.seq
 249996389     gbtsa49.seq
 151775259     gbtsa5.seq
 249998945     gbtsa50.seq
 141892200     gbtsa51.seq
 250000009     gbtsa52.seq
 249999189     gbtsa53.seq
 249999159     gbtsa54.seq
 249999078     gbtsa55.seq
 249996922     gbtsa56.seq
 249997972     gbtsa57.seq
 249999445     gbtsa58.seq
 245793553     gbtsa59.seq
 249997875     gbtsa6.seq
 249999221     gbtsa60.seq
 249998419     gbtsa61.seq
 249998860     gbtsa62.seq
 249998692     gbtsa63.seq
 249998779     gbtsa64.seq
 249999046     gbtsa65.seq
 232310747     gbtsa66.seq
 249999409     gbtsa67.seq
 249999138     gbtsa68.seq
 249998170     gbtsa69.seq
 249998005     gbtsa7.seq
 249998697     gbtsa70.seq
 249995875     gbtsa71.seq
 249998691     gbtsa72.seq
 185136198     gbtsa73.seq
 249999580     gbtsa74.seq
 249997881     gbtsa75.seq
 249999346     gbtsa76.seq
 249997691     gbtsa77.seq
 249991851     gbtsa78.seq
 108251130     gbtsa79.seq
 249999806     gbtsa8.seq
 249998527     gbtsa80.seq
 249998189     gbtsa81.seq
 249997886     gbtsa82.seq
 249992593     gbtsa83.seq
 249997814     gbtsa84.seq
  41122362     gbtsa85.seq
 249999310     gbtsa86.seq
 249999938     gbtsa87.seq
 249999285     gbtsa88.seq
 249999199     gbtsa89.seq
 249999617     gbtsa9.seq
 201625362     gbtsa90.seq
 249994299     gbtsa91.seq
 249999674     gbtsa92.seq
 249997982     gbtsa93.seq
 249999245     gbtsa94.seq
 249997038     gbtsa95.seq
 249999884     gbtsa96.seq
 249999225     gbtsa97.seq
 106366042     gbtsa98.seq
 249999742     gbtsa99.seq
    557490     gbuna1.seq
 249994362     gbvrl1.seq
 249998187     gbvrl10.seq
 249999012     gbvrl11.seq
 249998551     gbvrl12.seq
 249997358     gbvrl13.seq
  95007474     gbvrl14.seq
 249993177     gbvrl15.seq
 249999429     gbvrl16.seq
 249997560     gbvrl17.seq
 249997344     gbvrl18.seq
 214607688     gbvrl19.seq
 249997969     gbvrl2.seq
 249998361     gbvrl20.seq
 249999707     gbvrl21.seq
 250000143     gbvrl22.seq
 249997213     gbvrl23.seq
 136414582     gbvrl24.seq
 249997314     gbvrl25.seq
 249993421     gbvrl26.seq
 249996509     gbvrl27.seq
 249999730     gbvrl28.seq
 249999685     gbvrl29.seq
 249997385     gbvrl3.seq
 249998917     gbvrl30.seq
 166059823     gbvrl31.seq
 249998921     gbvrl4.seq
 249996592     gbvrl5.seq
  45424199     gbvrl6.seq
 249996699     gbvrl7.seq
 249998016     gbvrl8.seq
 249995447     gbvrl9.seq
 249867452     gbvrt1.seq
 249775579     gbvrt10.seq
 249866871     gbvrt11.seq
 142846059     gbvrt12.seq
 249977829     gbvrt13.seq
 249999702     gbvrt14.seq
 249996518     gbvrt15.seq
 250000028     gbvrt16.seq
 249998744     gbvrt17.seq
 249999343     gbvrt18.seq
  63846271     gbvrt19.seq
 249896690     gbvrt2.seq
 249986561     gbvrt20.seq
 249998592     gbvrt21.seq
 249999985     gbvrt22.seq
 249999111     gbvrt23.seq
 249999982     gbvrt24.seq
  95892550     gbvrt25.seq
 249999240     gbvrt26.seq
 249998062     gbvrt27.seq
 249999974     gbvrt28.seq
 249998072     gbvrt29.seq
 249997665     gbvrt3.seq
 249999685     gbvrt30.seq
 249997101     gbvrt31.seq
 203026997     gbvrt32.seq
 249972632     gbvrt4.seq
 169849639     gbvrt5.seq
 249996158     gbvrt6.seq
 249999187     gbvrt7.seq
 249929070     gbvrt8.seq
 249988839     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63783      86224111
BCT10        6838       96100195
BCT100       22         104487138
BCT101       23         109912463
BCT102       37         107695066
BCT103       39         103623930
BCT104       40         112620061
BCT105       86         92268476
BCT106       213        95163922
BCT107       325        25743984
BCT108       1589       2511877
BCT109       3180       5275409
BCT11        66         116730258
BCT110       6346       7804593
BCT111       12648      15077034
BCT112       25619      27729818
BCT113       50574      54096426
BCT114       76003      77708125
BCT115       71337      76879213
BCT116       10186      95029870
BCT117       5443       100113517
BCT118       3170       107677050
BCT119       137        104303394
BCT12        74         112572581
BCT120       68         117066999
BCT121       3934       105956798
BCT122       5170       103374451
BCT123       40409      57249350
BCT124       71142      76250544
BCT125       4002       110129774
BCT126       4241       110662040
BCT127       6246       106554392
BCT128       3936       107406830
BCT129       68705      82077332
BCT13        110        114056408
BCT130       74515      78023327
BCT131       17531      21628103
BCT132       75889      78496199
BCT133       72243      77188066
BCT134       71851      77619625
BCT135       48800      88022209
BCT136       21024      40258271
BCT14        63         115267569
BCT15        65         115718592
BCT16        16120      69180262
BCT17        53935      85395991
BCT18        93         110189094
BCT19        143        97370347
BCT2         24156      101587300
BCT20        58         112869568
BCT21        52         109549606
BCT22        46         112848421
BCT23        57         112994744
BCT24        66         108817610
BCT25        36         96325907
BCT26        40         106881287
BCT27        59         107430269
BCT28        74         111675186
BCT29        55         110045255
BCT3         48         109636136
BCT30        63         106845575
BCT31        55         109391288
BCT32        53         108650404
BCT33        46         110496749
BCT34        95         109522868
BCT35        58         106383536
BCT36        67         109486091
BCT37        125        110095720
BCT38        37         71643089
BCT39        200        111474100
BCT4         57         108959639
BCT40        54         111189650
BCT41        35         108859141
BCT42        59         107860764
BCT43        56         105257887
BCT44        45         109560296
BCT45        74         109517239
BCT46        64         110904710
BCT47        45         108836596
BCT48        59         106741684
BCT49        69         107012469
BCT5         29407      101704824
BCT50        77         109262802
BCT51        22         22714378
BCT52        67         109336234
BCT53        60         104664634
BCT54        54         104983933
BCT55        56         108908758
BCT56        58         107145869
BCT57        57         111394309
BCT58        69         108480601
BCT59        61         106681610
BCT6         8924       12489136
BCT60        70         111010690
BCT61        36         115917629
BCT62        79         110703954
BCT63        50         110061582
BCT64        62         113995020
BCT65        25         28242590
BCT66        43         109822487
BCT67        50         116699480
BCT68        66         111693041
BCT69        50         111462164
BCT7         39033      85133645
BCT70        52         110768449
BCT71        104        115905210
BCT72        67         104262489
BCT73        77         103079244
BCT74        63         114250996
BCT75        69         113369380
BCT76        47         115823384
BCT77        58         111202921
BCT78        59         116021522
BCT79        2          4854991
BCT8         5504       96546226
BCT80        58         117239794
BCT81        255        116498285
BCT82        64         116382193
BCT83        283        105254326
BCT84        62         110726375
BCT85        55         110920452
BCT86        50         104365229
BCT87        54         93702616
BCT88        64         112538235
BCT89        46         113713429
BCT9         13772      81354333
BCT90        53         107650515
BCT91        36         107511012
BCT92        60         111558091
BCT93        30         57018974
BCT94        26         104794980
BCT95        22         104529551
BCT96        22         103088452
BCT97        22         103958878
BCT98        23         107940285
BCT99        23         107771217
ENV1         92482      71800346
ENV10        93118      72863655
ENV11        82355      86646796
ENV12        21766      18620359
ENV13        84735      80838450
ENV14        118359     43039383
ENV15        89204      77152573
ENV16        96484      67747612
ENV17        96078      63275372
ENV18        109770     66818223
ENV19        121993     64629314
ENV2         97018      68972142
ENV20        61144      82551443
ENV21        70040      85924755
ENV22        90577      74867180
ENV23        126996     36602453
ENV24        122968     29005086
ENV25        82118      18872620
ENV26        123104     49763298
ENV27        97813      67171666
ENV28        115023     56511021
ENV29        136093     52773372
ENV3         79926      76970810
ENV30        108000     61215501
ENV31        96041      64859402
ENV32        10104      13125213
ENV33        62536      84995133
ENV34        88893      73356958
ENV35        102578     44146393
ENV36        96871      56133397
ENV37        70816      54849370
ENV38        111204     47238824
ENV39        100939     61154664
ENV4         84598      80290261
ENV40        106903     61774909
ENV41        63565      90703261
ENV42        72570      78894203
ENV43        62026      84270833
ENV44        13033      17733515
ENV45        70521      78321726
ENV46        107961     49617541
ENV47        112474     56237715
ENV48        104724     61476732
ENV49        79435      41112881
ENV5         85648      81253357
ENV50        100693     44100022
ENV51        42816      53344159
ENV52        41972      54588367
ENV53        57586      57097090
ENV54        96655      61615748
ENV55        34531      19255809
ENV56        92147      66863874
ENV57        81206      71664185
ENV58        82341      71938946
ENV59        86951      68476277
ENV6         91495      83087864
ENV60        83851      73671400
ENV61        13906      6229650
ENV62        109742     46065818
ENV63        90298      60820082
ENV64        110250     57003002
ENV65        90187      63891859
ENV66        78166      76136919
ENV67        178        238347
ENV68        79650      87940979
ENV69        85112      50039053
ENV7         59103      28135003
ENV70        84177      62958318
ENV71        102657     37981617
ENV72        105228     32107579
ENV73        27709      32055490
ENV8         131425     31030486
ENV9         86254      70388166
EST1         159501     61802328
EST10        168138     72500963
EST100       233341     141722951
EST101       238400     125261723
EST102       190945     104644588
EST103       184901     102275828
EST104       101067     70460182
EST105       160793     120247045
EST106       172974     105847978
EST107       135140     84857896
EST108       63928      23804827
EST109       63340      22262338
EST11        169705     73892795
EST110       63851      23134675
EST111       63869      26850293
EST112       64351      23025197
EST113       64591      24540250
EST114       63592      26978214
EST115       63768      26212453
EST116       64046      27332031
EST117       63899      25168577
EST118       61272      33485480
EST119       120366     61748482
EST12        168229     70578562
EST120       160950     86010917
EST121       189412     92914779
EST122       149901     96421812
EST123       158932     93614679
EST124       130999     85230203
EST125       189825     91002758
EST126       156522     83233528
EST127       157647     84664206
EST128       157533     85064562
EST129       151396     84981695
EST13        68150      33147295
EST130       174406     93565138
EST131       183154     117009513
EST132       202733     102492136
EST133       160197     87326383
EST134       162699     82780822
EST135       142931     84108878
EST136       145126     91016139
EST137       95705      49786930
EST138       172887     97721434
EST139       246301     113800044
EST14        217666     109081070
EST140       154961     83748016
EST141       167533     92440221
EST142       150737     88005315
EST143       134712     82780134
EST144       154963     96408142
EST145       155539     85601293
EST146       124329     63563844
EST147       121381     65181741
EST148       127995     57748730
EST149       127274     51199224
EST15        169469     105930889
EST150       128601     51246718
EST151       112781     42022629
EST152       164121     82774105
EST153       176883     74099141
EST154       162653     110622396
EST155       201469     123524767
EST156       214785     122028618
EST157       175917     97119917
EST158       155536     108272647
EST159       140733     95482056
EST16        180300     112981813
EST160       156017     96072290
EST161       156872     82307990
EST162       138745     78190407
EST163       170233     94579476
EST164       65969      41372740
EST165       150527     92132334
EST166       192306     110523420
EST167       146185     84147972
EST168       142992     72509410
EST169       150371     87696611
EST17        195712     114394628
EST170       191202     104880048
EST171       156735     96087563
EST172       168076     82971267
EST173       127536     86867448
EST174       171591     100698857
EST175       173514     100386012
EST176       121069     67811094
EST177       157638     90743054
EST178       30201      17578612
EST179       170567     103102349
EST18        193547     121835151
EST180       181365     119546236
EST181       143939     116883765
EST182       194599     99424308
EST183       153361     103514345
EST184       155042     101533634
EST185       141169     81759548
EST186       176917     71907828
EST187       151084     84446210
EST188       157605     100356788
EST189       157188     96405974
EST19        157898     113087660
EST190       141344     84436531
EST191       157718     95155130
EST192       146177     93536034
EST193       129694     90615016
EST194       144248     88234301
EST195       136461     88931805
EST196       130161     93068919
EST197       163917     87141903
EST198       174665     96032769
EST199       174066     96944030
EST2         162336     61672462
EST20        190148     100225707
EST200       172161     96157381
EST201       169389     95495685
EST202       172289     95604347
EST203       174060     95360354
EST204       174613     96171956
EST205       18092      9746248
EST206       189449     105525321
EST207       206036     105156241
EST208       172488     102458776
EST209       180709     102093624
EST21        218466     107503208
EST210       201555     122948701
EST211       195441     112764547
EST212       192930     124459364
EST213       138281     92721074
EST214       220449     140645045
EST215       236428     118631034
EST216       159071     108341651
EST217       186194     100253668
EST218       205670     102545513
EST219       128110     93536278
EST22        191475     62801870
EST220       146808     85129975
EST221       209060     116548367
EST222       156245     101398915
EST223       107275     114243904
EST224       156433     101718818
EST225       161079     96958986
EST226       144878     102079806
EST227       220048     107907043
EST228       136802     97131340
EST229       121398     87230291
EST23        139231     39628987
EST230       136387     96068727
EST231       123155     88128480
EST232       144999     90841053
EST233       129020     88138256
EST234       140286     105286461
EST235       130896     91732935
EST236       124985     84438051
EST237       142970     89038406
EST238       162116     122038182
EST239       121308     117223382
EST24        102645     27799928
EST240       139574     103356103
EST241       178812     108165565
EST242       163239     101522933
EST243       160413     100734277
EST244       81830      48680871
EST245       165731     126096938
EST246       142497     105057167
EST247       159024     101011266
EST248       216829     95552917
EST249       178422     113593655
EST25        123152     51198906
EST250       158709     82233158
EST251       221635     33880313
EST252       215896     85765972
EST253       163336     122983528
EST254       173061     101689032
EST255       163592     108352862
EST256       113882     70378724
EST257       155784     114773746
EST258       185050     110393385
EST259       188005     98615077
EST26        214450     97497762
EST260       176854     111518003
EST261       165032     110044888
EST262       233514     110569114
EST263       278542     120538813
EST264       185402     112622699
EST265       188044     37101335
EST266       260211     124640545
EST267       63533      41755784
EST268       154825     99465681
EST269       168223     103104977
EST27        219630     110419278
EST270       167941     114479659
EST271       193267     101394539
EST272       162473     109187060
EST273       191488     111867910
EST274       202034     44377845
EST275       201758     48676601
EST276       184667     102927507
EST277       183214     119482570
EST278       175268     114357851
EST279       119453     67918544
EST28        190696     88595411
EST280       175257     113875880
EST281       176129     76781064
EST282       126761     80278990
EST283       135279     86696541
EST284       159552     98422284
EST285       260824     27489261
EST286       262031     26378003
EST287       144416     107406196
EST288       168972     111017788
EST289       159303     99674400
EST29        158204     69018226
EST290       161430     89088645
EST291       148489     13599095
EST292       204613     77396612
EST293       169080     106808314
EST294       175797     106154969
EST295       154329     101243266
EST296       201556     107840266
EST297       151805     109989405
EST298       167616     101440791
EST299       186986     114807714
EST3         151288     53609752
EST30        171907     69753647
EST300       179966     103656142
EST301       186948     97764160
EST302       184123     64368544
EST303       128494     45788644
EST304       183843     71386874
EST305       184790     69463433
EST306       184696     98991053
EST307       181680     130645980
EST308       144356     83139393
EST309       151780     93001443
EST31        150496     63761809
EST310       132024     100188027
EST311       161393     96170797
EST312       173324     99543241
EST313       149464     96694439
EST314       166709     94106832
EST315       160559     107555618
EST316       104953     74416097
EST317       164399     107652281
EST318       158170     110592922
EST319       181443     154115009
EST32        168375     76222369
EST320       170417     106773332
EST321       141537     79068533
EST322       142461     96861643
EST323       146264     99781113
EST324       135602     91080418
EST325       149441     100307844
EST326       150294     101305902
EST327       178772     108254392
EST328       148786     85628718
EST329       149552     85015870
EST33        176128     68282933
EST330       62862      39782940
EST331       151282     107724816
EST332       160924     97937011
EST333       143269     90723497
EST334       142778     89354476
EST335       208887     112263140
EST336       130093     71573777
EST337       91159      55047858
EST338       132051     87359475
EST339       138352     87798298
EST34        118192     40557064
EST340       124186     78968653
EST341       168737     85659676
EST342       212405     84970410
EST343       166809     88556387
EST344       108321     62922991
EST345       165322     103821797
EST346       143785     88501380
EST347       133283     88818762
EST348       136607     89312055
EST349       189733     121812621
EST35        96372      29582115
EST350       157225     96235097
EST351       156521     77968357
EST352       185801     129581911
EST353       113664     78197995
EST354       73463      43902441
EST355       139566     77272986
EST356       130651     78073736
EST357       149037     56100889
EST358       158619     32560229
EST359       45830      8973596
EST36        96776      30247477
EST360       154771     46414086
EST361       191949     123636684
EST362       248379     115024472
EST363       252243     115502883
EST364       176051     99657455
EST365       142710     92637696
EST366       138382     86399503
EST367       158355     94495122
EST368       195700     120237710
EST369       222229     58581165
EST37        95687      29027141
EST370       187269     114192828
EST371       11054      6451163
EST372       214496     117713997
EST373       203220     120923178
EST374       195407     105708728
EST375       150408     74524629
EST376       178736     118457625
EST377       180216     112651248
EST378       149767     117885699
EST379       181812     143561066
EST38        97560      29503169
EST380       154383     90432973
EST381       164976     107001651
EST382       191059     108901478
EST383       111721     59159271
EST384       205611     113492081
EST385       181212     107036083
EST386       207110     128262965
EST387       182825     119509042
EST388       205852     138062508
EST389       226649     130539343
EST39        97737      30978268
EST390       201230     139604285
EST391       209697     169355631
EST392       215346     131434268
EST393       160913     101113658
EST394       82127      36543469
EST395       174460     76785531
EST396       168991     13110499
EST397       154797     14226026
EST398       158543     32729330
EST399       158898     31880328
EST4         171413     67335709
EST40        27790      7116542
EST400       158343     33464031
EST401       147357     96024346
EST402       188422     113904281
EST403       161696     108562742
EST404       166021     102123403
EST405       148210     101860867
EST406       143094     100013938
EST407       142939     89966828
EST408       175736     125472554
EST409       143654     93966342
EST41        101339     52998634
EST410       178073     104218340
EST411       167931     26572577
EST412       167853     70013975
EST413       151768     108406534
EST414       170963     106400343
EST415       149018     92851727
EST416       170860     96371201
EST417       185565     126810024
EST418       139813     92501306
EST419       131690     90207307
EST42        119702     50948483
EST420       146988     90601181
EST421       162109     94881683
EST422       175890     94318316
EST423       153177     94615729
EST424       170427     96108332
EST425       173674     106465567
EST426       130376     84987252
EST427       102112     73357691
EST428       79205      60728515
EST429       113801     73864361
EST43        166488     92097144
EST430       155300     85111641
EST431       128477     78096043
EST432       137473     91015058
EST433       141891     83343406
EST434       167547     97628012
EST435       34329      23255110
EST436       180282     93942935
EST437       163057     104988080
EST438       155836     96658719
EST439       172108     77295726
EST44        170695     72232564
EST440       194335     107898826
EST441       153500     83554538
EST442       171299     100164338
EST443       219792     128439618
EST444       159731     108763715
EST445       166531     103520588
EST446       139909     89937281
EST447       135897     92042195
EST448       52528      29659420
EST449       209293     78786441
EST45        167873     85241426
EST450       188040     83622153
EST451       206252     88339575
EST452       197692     84149023
EST453       182991     113573673
EST454       182502     109269897
EST455       188783     114022580
EST456       200600     123038178
EST457       189777     89524096
EST458       186860     85144479
EST459       146914     82781765
EST46        169013     87092795
EST460       194788     118468424
EST461       173755     103716390
EST462       200796     124272541
EST463       150742     92491192
EST464       147797     108308206
EST465       164338     89615501
EST466       174427     89418908
EST467       156335     83193795
EST468       148755     78949986
EST469       192120     108943245
EST47        163875     88136831
EST470       170713     109951626
EST471       175182     108035398
EST472       174523     127732013
EST473       180716     81510509
EST474       169297     59276003
EST475       141923     55489488
EST48        162663     83100062
EST49        160156     91339734
EST5         169507     66374636
EST50        162204     88540377
EST51        157813     99186634
EST52        160051     70189338
EST53        147632     82721823
EST54        70496      46811667
EST55        167564     70085835
EST56        165210     74997334
EST57        165156     91184837
EST58        159384     97139327
EST59        156928     102353654
EST6         172145     67172196
EST60        165196     99296535
EST61        160364     108442345
EST62        172141     80345687
EST63        174127     93626746
EST64        155326     84270870
EST65        148827     81553104
EST66        158977     98439564
EST67        130799     74758241
EST68        150079     91993833
EST69        196026     108835883
EST7         170538     73088646
EST70        182694     95695707
EST71        222663     122068262
EST72        186917     112082274
EST73        203403     120465234
EST74        164681     90627600
EST75        132261     60473209
EST76        137517     67714743
EST77        158989     99615864
EST78        157438     96480280
EST79        142910     78854673
EST8         180030     73172043
EST80        44407      20661406
EST81        164191     100547380
EST82        212726     115179270
EST83        224894     124325119
EST84        200992     94599125
EST85        211918     93239152
EST86        161284     92993251
EST87        144314     87635576
EST88        164574     80865898
EST89        159051     80104204
EST9         169003     69438217
EST90        153983     102487359
EST91        151719     89341287
EST92        130299     84060099
EST93        156143     112997905
EST94        141138     103350042
EST95        141965     101530042
EST96        141298     97679557
EST97        147707     81885382
EST98        178938     111002076
EST99        224157     135807078
GSS1         200944     87996853
GSS10        132705     60745240
GSS100       145433     114443307
GSS101       141764     116180696
GSS102       143557     116922653
GSS103       168501     129420855
GSS104       146799     80635635
GSS105       192097     121271500
GSS106       168774     112786909
GSS107       197855     115901315
GSS108       204285     134283587
GSS109       209638     138124591
GSS11        137159     73866503
GSS110       207373     140787683
GSS111       206085     142316725
GSS112       205116     143592111
GSS113       204992     143857183
GSS114       202044     146586344
GSS115       182354     139826297
GSS116       17871      10600096
GSS117       133162     84221146
GSS118       170189     80224521
GSS119       184009     79459818
GSS12        148406     75892516
GSS120       170128     148246108
GSS121       177780     120665165
GSS122       180455     146454330
GSS123       188036     121100436
GSS124       187020     138821799
GSS125       192389     127469972
GSS126       191930     93613492
GSS127       167265     155861603
GSS128       163815     114347104
GSS129       59253      35515574
GSS13        145697     69144434
GSS130       170924     155391140
GSS131       172238     154355826
GSS132       172284     155048214
GSS133       173670     154060692
GSS134       171880     154915342
GSS135       180819     138728375
GSS136       178921     146932479
GSS137       165756     119157815
GSS138       190645     95938075
GSS139       258272     39830264
GSS14        171223     85489549
GSS140       258271     39805898
GSS141       93953      14435600
GSS142       255965     58806170
GSS143       260425     57449975
GSS144       191730     85707414
GSS145       196898     67821266
GSS146       186512     148755419
GSS147       182886     151529266
GSS148       168597     155742158
GSS149       171019     157769882
GSS15        161656     98232070
GSS150       238045     70591905
GSS151       226815     82624596
GSS152       129341     51996947
GSS153       209214     56380289
GSS154       157841     95882122
GSS155       181030     114522149
GSS156       135934     86658000
GSS157       166404     133078418
GSS158       184516     161559473
GSS159       194054     159477525
GSS16        173477     87330139
GSS160       191212     124836337
GSS161       217172     138250007
GSS162       221443     132912352
GSS163       159474     98241538
GSS164       40459      4411488
GSS165       87040      63874629
GSS166       83570      62791964
GSS167       103201     48366781
GSS168       68836      58577766
GSS169       8346       7528861
GSS17        184270     114513921
GSS170       68591      57924394
GSS171       69224      56650935
GSS172       69460      56187403
GSS173       71202      55998401
GSS174       68561      51865315
GSS175       75915      58209304
GSS176       86719      74437329
GSS177       81366      44383585
GSS178       92226      45007635
GSS179       64706      48323348
GSS18        192267     113918440
GSS180       77749      61614583
GSS181       70133      59131247
GSS182       68139      63204160
GSS183       62574      52956385
GSS184       95090      42455501
GSS185       19778      4599948
GSS186       112930     70870954
GSS187       830        565879
GSS188       23226      28867035
GSS189       109084     70678875
GSS19        107975     48381098
GSS190       84403      34582519
GSS191       35904      22282147
GSS192       103304     62490220
GSS193       102329     63761256
GSS194       104196     67611234
GSS195       82171      41322048
GSS196       83102      54651503
GSS197       95552      61239914
GSS198       107362     78589696
GSS199       106457     76738025
GSS2         182784     92562255
GSS20        181829     101799517
GSS200       106101     79982459
GSS201       104001     80014803
GSS202       75801      50678132
GSS203       105097     63619915
GSS204       109868     66415305
GSS205       105995     59196161
GSS206       68060      37226354
GSS207       69100      38526913
GSS208       38147      18321461
GSS209       85817      46213833
GSS21        166507     114368711
GSS210       97756      56282806
GSS211       94838      49467300
GSS212       96276      55952494
GSS213       41313      23149851
GSS214       114055     43442995
GSS215       116422     39251295
GSS216       108546     52732208
GSS217       108722     67128836
GSS218       101583     78242275
GSS219       56990      34054442
GSS22        170134     97973870
GSS220       96897      36918766
GSS221       96399      37676586
GSS222       97739      35452830
GSS223       95145      39751140
GSS224       33820      15967145
GSS225       103939     66277823
GSS226       94551      61190929
GSS227       95128      60357048
GSS228       94773      60868501
GSS229       75675      70017159
GSS23        187501     127418165
GSS230       80658      68522367
GSS231       32685      33693673
GSS232       83736      28233267
GSS233       84219      27346468
GSS234       84926      25909272
GSS235       14851      4422302
GSS236       16547      7508221
GSS237       94015      60525590
GSS238       97343      65451675
GSS239       96145      65710591
GSS24        195138     130441517
GSS240       87638      48550983
GSS241       96977      54088515
GSS242       89375      48778507
GSS243       36019      19640944
GSS244       90839      57016024
GSS245       89674      61866093
GSS246       88534      63668650
GSS247       89290      62493340
GSS248       9699       6996370
GSS249       87995      63795538
GSS25        177571     104698436
GSS250       90555      62718679
GSS251       94893      59921704
GSS252       74652      63687287
GSS253       84376      78697470
GSS254       82895      80772906
GSS255       69576      51780572
GSS256       114900     62956729
GSS257       109229     55656739
GSS258       107532     52126493
GSS259       99054      44380734
GSS26        187094     109222395
GSS260       109801     49060015
GSS261       97917      46046727
GSS262       73058      72226496
GSS263       77174      72621583
GSS264       92147      71194681
GSS265       24563      18498472
GSS266       92250      71055526
GSS267       85869      83025280
GSS268       83675      87061685
GSS269       82362      86366324
GSS27        169152     151332055
GSS270       87240      67099066
GSS271       90053      72027971
GSS272       91450      69749412
GSS273       92046      60723737
GSS274       16098      9822461
GSS275       94787      57200301
GSS276       93517      59081345
GSS277       93900      58510429
GSS278       94714      57307691
GSS279       83843      51265303
GSS28        190447     145246366
GSS280       104594     69753809
GSS281       105287     75065932
GSS282       110489     69020768
GSS283       108020     71887545
GSS284       110248     69302693
GSS285       101083     62760440
GSS286       106737     56950052
GSS287       58043      30890170
GSS29        152604     107741277
GSS3         175722     88078887
GSS30        192351     131462383
GSS31        10203      6766212
GSS32        196657     127651461
GSS33        217776     116759610
GSS34        219644     114213054
GSS35        220777     112664012
GSS36        214622     123365339
GSS37        199352     157077838
GSS38        195922     147426365
GSS39        191244     68588056
GSS4         167454     85331195
GSS40        185344     98001166
GSS41        190662     126767714
GSS42        171525     159218326
GSS43        6466       4247063
GSS44        184473     100545750
GSS45        173355     121951456
GSS46        183637     123764089
GSS47        189153     121131646
GSS48        73070      64213035
GSS49        172209     102210173
GSS5         50998      30384869
GSS50        168276     103464302
GSS51        168453     103104964
GSS52        182981     120642594
GSS53        184863     116613625
GSS54        180879     122036323
GSS55        186104     112853478
GSS56        190344     135518328
GSS57        178542     104539353
GSS58        193547     119337137
GSS59        179844     132180242
GSS6         162011     84658147
GSS60        5264       4796855
GSS61        173080     139097497
GSS62        162251     111940135
GSS63        162287     111957763
GSS64        157141     106504657
GSS65        156916     129183900
GSS66        170503     142796915
GSS67        179240     116632250
GSS68        202718     127006598
GSS69        193517     110494126
GSS7         165849     79606985
GSS70        244856     126493749
GSS71        160931     106882703
GSS72        159281     119594532
GSS73        162713     124578948
GSS74        162678     124640845
GSS75        175220     109076415
GSS76        190380     140117556
GSS77        13389      7910297
GSS78        197174     125284313
GSS79        170016     111056766
GSS8         165859     89017102
GSS80        199327     130684654
GSS81        211301     88469191
GSS82        190102     97407234
GSS83        132380     92454155
GSS84        146938     118024102
GSS85        139719     117096418
GSS86        142930     114056110
GSS87        144161     119955967
GSS88        141896     115755407
GSS89        107456     89572117
GSS9         138220     67303044
GSS90        149553     122345018
GSS91        147788     117792665
GSS92        144115     113155638
GSS93        142979     115531478
GSS94        144339     119769367
GSS95        148217     121718869
GSS96        147793     117902839
GSS97        146200     121153918
GSS98        146261     121035223
GSS99        146701     120155849
HTC1         25070      27067745
HTC10        70436      71574832
HTC11        72156      70048891
HTC12        25563      31246478
HTC13        67444      60477387
HTC14        68893      69668487
HTC15        41539      26813836
HTC2         16086      36248594
HTC3         16029      36625145
HTC4         16251      35561378
HTC5         15980      40342205
HTC6         16068      37475860
HTC7         53862      31518631
HTC8         31094      19381346
HTC9         60735      77635959
HTG1         1318       188778000
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1439       190837848
HTG113       1518       189527436
HTG114       1397       176270675
HTG115       1216       154265619
HTG116       1335       175214595
HTG117       1346       190074483
HTG118       1037       184522039
HTG119       866        136599513
HTG12        1452       184004673
HTG120       1554       186401663
HTG121       1175       190789299
HTG122       993        187618402
HTG123       1089       193718853
HTG124       1104       193175956
HTG125       397        74240304
HTG126       1031       189469892
HTG127       1055       192678789
HTG128       1163       191852916
HTG129       1080       192395749
HTG13        875        191786413
HTG130       1084       193090210
HTG131       588        103686357
HTG132       1122       192519796
HTG133       1078       192373539
HTG134       1078       192352380
HTG135       1167       191892724
HTG136       2115       191534139
HTG137       1092       192391421
HTG138       1077       192101569
HTG139       1091       192432207
HTG14        753        191921309
HTG140       1049       190333557
HTG141       1337       158142861
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192170442
HTG76        1147       192487651
HTG77        1188       192461752
HTG78        1071       181302309
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93674      48160751
INV10        52233      89511536
INV11        82437      65440201
INV12        66055      52092775
INV13        84563      65945578
INV14        80777      66734970
INV15        78654      66837923
INV16        49190      46411007
INV17        26302      113774162
INV18        10809      140728508
INV19        39463      115288695
INV2         50180      106112930
INV20        77507      57087937
INV21        73470      62905884
INV22        8479       5529647
INV23        23023      127254317
INV24        6          133712559
INV25        55993      101759078
INV26        74926      49580412
INV27        63266      46172108
INV28        78068      55765137
INV29        75226      57637030
INV3         1446       185814640
INV30        78125      61036453
INV31        71550      48184279
INV32        37706      25087039
INV33        78818      56563649
INV34        76069      54553627
INV35        73714      61868647
INV36        77634      57171945
INV37        76376      52705529
INV38        64070      74634766
INV39        2410       30476891
INV4         651        133226215
INV5         45226      95186133
INV6         77434      72586991
INV7         40900      102741271
INV8         37663      60573493
INV9         80276      71511387
MAM1         20357      155828773
MAM2         14891      163772514
MAM3         62291      79909454
MAM4         3635       188170400
MAM5         79963      74579492
MAM6         45458      132552974
MAM7         76090      61854526
MAM8         65270      74888228
MAM9         11746      12048479
PAT1         222549     70107814
PAT10        124429     102493405
PAT100       178198     3385762
PAT101       178185     3385515
PAT102       132610     2848492
PAT103       342935     8573375
PAT104       188806     88519660
PAT105       111348     132068608
PAT106       3850       194703659
PAT107       131292     110979300
PAT108       158599     54826034
PAT109       224686     34110691
PAT11        98881      64214767
PAT110       250080     15844307
PAT111       180711     63630717
PAT112       51661      26095410
PAT113       114163     110461600
PAT114       137643     83253103
PAT115       164240     99295352
PAT116       158779     103376955
PAT117       137518     115016173
PAT118       42311      27994848
PAT119       193712     81686401
PAT12        142046     62828374
PAT120       150217     108404022
PAT121       356051     11379688
PAT122       257211     57607099
PAT123       138161     48226925
PAT124       322021     22795469
PAT125       155639     102753887
PAT126       132727     110696284
PAT127       128341     121313309
PAT128       21664      184390005
PAT129       144888     112900567
PAT13        105890     59870601
PAT130       171997     96403773
PAT131       44618      171217879
PAT132       9167       47581637
PAT133       33645      178334734
PAT134       153558     109675196
PAT135       178705     90913377
PAT136       136049     115324159
PAT137       120392     123342367
PAT138       8527       8992390
PAT139       155429     101473147
PAT14        103627     50161278
PAT140       184764     88815933
PAT141       182409     85292093
PAT142       174403     93928365
PAT143       28829      20461016
PAT144       147929     108545966
PAT145       160945     101973668
PAT146       185311     90980420
PAT147       231649     49265020
PAT148       203540     47701039
PAT149       277765     9659534
PAT15        121155     53309163
PAT150       220400     46464910
PAT151       106913     2885992
PAT152       270386     21672571
PAT153       186717     61206554
PAT154       109745     106071993
PAT155       47606      9568509
PAT156       87244      88073273
PAT157       78303      95522032
PAT158       144678     77919505
PAT159       167880     71102299
PAT16        113123     61268279
PAT160       121231     93121739
PAT161       103324     85080202
PAT162       165812     46438948
PAT163       270022     5130418
PAT164       269978     5129582
PAT165       269978     5129582
PAT166       237888     4519872
PAT167       269396     5118524
PAT168       235458     25558526
PAT169       203678     47168325
PAT17        39198      16253492
PAT170       12111      425241
PAT171       165316     74866922
PAT172       91680      126651183
PAT173       172438     71668663
PAT174       213536     66912052
PAT175       42478      48670950
PAT176       235138     59544089
PAT177       123750     125093767
PAT178       217500     66593101
PAT179       109061     85077809
PAT18        146771     52594264
PAT180       93072      87231074
PAT181       91814      79965559
PAT182       83780      91675984
PAT183       108701     54187266
PAT184       101031     56670672
PAT185       150189     24631215
PAT186       93817      82459162
PAT187       26010      162900357
PAT188       113946     65760783
PAT189       81611      28133789
PAT19        153705     78039102
PAT190       3631       191518875
PAT191       84408      78157905
PAT192       145070     26290630
PAT193       76961      99954355
PAT194       95297      71301921
PAT195       113209     34505206
PAT196       86789      129976514
PAT197       158946     78754682
PAT198       213427     47118723
PAT199       169396     66576353
PAT2         194512     84659689
PAT20        104712     118084998
PAT200       59671      8563521
PAT201       161907     78478468
PAT202       120049     100582858
PAT203       86564      129140118
PAT204       37994      167174248
PAT205       35972      168657914
PAT206       75244      137650569
PAT207       252342     29172458
PAT208       137374     91939040
PAT209       128014     73122366
PAT21        133770     95332049
PAT22        84661      79580685
PAT23        123521     103391384
PAT24        119456     105503763
PAT25        145185     86776082
PAT26        175028     64348723
PAT27        71810      1795250
PAT28        102161     77384804
PAT29        93919      87638403
PAT3         171980     95897348
PAT30        119959     61667805
PAT31        96616      78961086
PAT32        128349     55020896
PAT33        92306      51149840
PAT34        118109     69082288
PAT35        105234     63069866
PAT36        162029     21539306
PAT37        134849     41764458
PAT38        102055     67006385
PAT39        23540      17470281
PAT4         153750     106057444
PAT40        95721      83165220
PAT41        100234     70851403
PAT42        136071     39459525
PAT43        143788     35448269
PAT44        123821     64575799
PAT45        104398     81176714
PAT46        93299      74375876
PAT47        113234     66602624
PAT48        65388      54850684
PAT49        135191     107998311
PAT5         57146      23927792
PAT50        167081     97032801
PAT51        116396     127553842
PAT52        196336     76726384
PAT53        80312      127991532
PAT54        27631      180872621
PAT55        185408     93066629
PAT56        274259     6856475
PAT57        129447     31627433
PAT58        161320     77719729
PAT59        92714      89267122
PAT6         170642     91909261
PAT60        106336     74862816
PAT61        122365     64031899
PAT62        67700      30352858
PAT63        70749      109767380
PAT64        87947      82758205
PAT65        92970      78936927
PAT66        93166      72442104
PAT67        93383      75086630
PAT68        115772     60531684
PAT69        102742     9941933
PAT7         154743     88216372
PAT70        175930     10547617
PAT71        171510     10872561
PAT72        171496     10866737
PAT73        99862      86225235
PAT74        99         196466297
PAT75        67         192869889
PAT76        103        195600591
PAT77        1137       196318757
PAT78        97599      5772236
PAT79        151009     9636510
PAT8         131233     96856483
PAT80        151022     9621259
PAT81        151024     9622125
PAT82        151021     9620837
PAT83        94629      88051226
PAT84        92265      94525310
PAT85        37552      34674369
PAT86        83459      93185861
PAT87        15567      180450135
PAT88        164893     19209778
PAT89        178944     3399936
PAT9         129157     101181588
PAT90        177434     3371246
PAT91        175305     3330795
PAT92        101399     1926581
PAT93        169168     12412189
PAT94        178699     3395281
PAT95        178691     3395129
PAT96        178677     3394863
PAT97        140783     2674877
PAT98        178683     3394977
PAT99        178342     3388498
PHG1         5937       104191551
PHG2         2559       38121701
PLN1         59835      93474401
PLN10        11373      11263725
PLN11        72963      75784051
PLN12        37378      49242076
PLN13        40168      65478733
PLN14        22690      123592732
PLN15        21110      100271020
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        24729      127753568
PLN2         72222      79895246
PLN20        5972       146407699
PLN21        1288       168147499
PLN22        1448       166987774
PLN23        19849      20384654
PLN24        66950      69783835
PLN25        30122      32284794
PLN26        76768      76391570
PLN27        64724      80259214
PLN28        61845      100020675
PLN29        77         96423259
PLN3         1485       165849548
PLN30        3          61743175
PLN31        54         123504479
PLN32        4794       140674195
PLN33        22928      132801585
PLN34        64298      83065358
PLN35        76007      77387851
PLN36        83844      42159615
PLN37        80231      71516691
PLN38        77630      75773697
PLN39        80136      70326361
PLN4         1572       182751110
PLN40        81997      75290126
PLN41        58885      32676757
PLN42        98834      55162709
PLN43        82305      68456906
PLN44        45236      98987316
PLN45        15532      129162637
PLN46        32943      123782466
PLN47        66342      80188768
PLN48        80942      72381463
PLN49        65449      79614219
PLN5         1958       191271060
PLN50        23005      112873083
PLN51        38148      109648154
PLN52        82406      64677151
PLN53        93791      57530299
PLN54        8123       5349866
PLN55        77361      71121182
PLN56        70375      84176630
PLN57        77216      67572960
PLN58        70369      76076824
PLN59        80005      66998493
PLN6         1604       194653546
PLN60        1762       1757305
PLN61        78166      63257011
PLN62        75050      70002683
PLN63        87350      50742361
PLN64        75693      65265938
PLN65        73005      63250059
PLN66        67230      78570877
PLN67        66542      78167513
PLN68        62998      80599246
PLN69        45678      97300053
PLN7         1762       193837456
PLN70        553        1309947
PLN8         13253      160070645
PLN9         75119      80112934
PRI1         23024      59718385
PRI10        1257       179218013
PRI11        832        100158021
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         20347      146856952
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        4001       187843425
PRI23        17162      38335365
PRI24        31527      84612036
PRI25        61958      78186750
PRI26        31358      70664664
PRI27        8758       172032991
PRI28        2266       191526296
PRI29        1666       190957810
PRI3         1437       174794942
PRI30        2074       192186893
PRI31        2197       191169864
PRI32        13063      162311426
PRI33        2085       170473464
PRI34        58192      87724884
PRI35        5414       10850199
PRI36        32189      63608729
PRI37        20541      119199459
PRI38        18967      150691930
PRI39        67762      85230206
PRI4         1279       185694154
PRI40        50188      89302728
PRI41        41571      79580650
PRI42        47316      95814961
PRI43        26910      100958422
PRI44        28300      109569313
PRI45        24249      104172767
PRI46        34691      109807170
PRI47        59309      97729511
PRI5         1330       184451461
PRI6         1181       179894674
PRI7         1231       180411363
PRI8         1225       178939788
PRI9         1366       174930741
ROD1         35358      135921970
ROD10        989        181666341
ROD11        272        51502351
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190636468
ROD19        15550      158887048
ROD2         911        175641332
ROD20        1264       2318133
ROD21        20403      157183388
ROD22        1220       193661762
ROD23        937        147781632
ROD24        15484      168705171
ROD25        37962      68985705
ROD26        20911      110770842
ROD27        1538       193325584
ROD28        146357     23459124
ROD29        77879      76001341
ROD3         908        173372552
ROD30        84467      56263991
ROD31        20957      25306447
ROD4         901        173571262
ROD5         918        174457910
ROD6         964        177762826
ROD7         973        179476109
ROD8         974        181241708
ROD9         996        181768092
STS1         85203      36725149
STS10        57907      44420216
STS11        48911      37504044
STS12        57924      43637361
STS13        64259      42839951
STS14        93607      34189825
STS15        104286     26516379
STS16        10140      2746967
STS17        103700     27504029
STS18        86956      34470434
STS19        99773      33355956
STS2         84238      49869957
STS20        55515      21304282
STS3         66815      26317756
STS4         77154      36963324
STS5         8571       5028493
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55715      37766563
SYN1         37870      82226165
SYN2         50297      67201401
SYN3         16748      146156216
SYN4         4596       176604141
SYN5         4593       176460993
SYN6         4602       176550077
SYN7         10206      129819194
TSA1         120201     38168038
TSA10        18501      20932212
TSA100       80229      75622518
TSA101       84814      72313292
TSA102       77875      83688591
TSA103       94381      51984420
TSA104       99491      69631030
TSA105       58883      96679889
TSA106       109175     49378845
TSA107       67189      70080278
TSA108       80849      89010324
TSA109       72031      75745861
TSA11        134181     34620238
TSA110       57428      120481138
TSA111       78         46339
TSA112       106689     67779914
TSA113       93410      83369889
TSA114       98615      76609458
TSA115       88033      68056906
TSA116       85153      59467890
TSA117       81073      64427204
TSA118       81080      78013460
TSA119       99998      58115409
TSA12        60167      20022990
TSA120       94371      41923160
TSA121       77447      57059121
TSA122       37783      35943213
TSA123       64087      65481741
TSA124       62776      67314514
TSA125       62796      68082050
TSA126       83597      81259826
TSA127       77368      53642425
TSA128       52890      45157231
TSA129       78372      34800123
TSA13        64386      59430252
TSA130       74749      67769223
TSA131       81134      78516520
TSA132       74738      64368149
TSA133       41094      34067132
TSA134       87573      70203780
TSA135       88950      68200532
TSA136       84674      76995574
TSA137       76777      81340708
TSA138       12114      10094014
TSA139       104187     53670971
TSA14        92644      61562171
TSA140       81024      61412061
TSA141       69807      78230935
TSA142       73068      68063462
TSA143       87167      75197912
TSA144       89965      70421878
TSA145       62321      102799580
TSA146       95551      74305126
TSA147       20005      13967517
TSA148       84454      64336299
TSA149       79426      73969961
TSA15        86754      43106045
TSA150       77312      74949414
TSA151       75763      75067651
TSA152       103547     59015615
TSA153       104401     63272294
TSA154       101744     66774144
TSA155       97636      72225662
TSA156       17384      15356121
TSA16        76033      85960467
TSA17        93083      61961098
TSA18        101679     72919448
TSA19        99545      56113860
TSA2         112876     41351442
TSA20        67214      20107438
TSA21        85797      70106183
TSA22        120080     38852195
TSA23        135073     34045322
TSA24        52641      68389460
TSA25        47693      62712879
TSA26        2567       4355759
TSA27        60987      81840924
TSA28        93007      67047844
TSA29        109158     50156094
TSA3         109737     40820021
TSA30        105985     49608229
TSA31        101802     53927291
TSA32        104196     47869725
TSA33        25155      16078008
TSA34        66195      59263498
TSA35        92595      67984800
TSA36        92725      62222647
TSA37        79900      85994127
TSA38        99632      49714517
TSA39        113604     34184810
TSA4         110863     47429708
TSA40        95081      67746092
TSA41        13342      8212550
TSA42        94353      35365815
TSA43        77391      35904179
TSA44        106332     43403178
TSA45        113806     45488371
TSA46        29846      20501254
TSA47        105735     50140224
TSA48        100655     54491793
TSA49        94817      63356575
TSA5         76797      23195889
TSA50        83277      83596257
TSA51        63297      25469672
TSA52        90365      71288560
TSA53        97490      54396288
TSA54        60102      105473410
TSA55        87072      65322428
TSA56        78659      70601613
TSA57        83093      72167197
TSA58        82780      72071571
TSA59        68825      90745962
TSA6         111583     58975350
TSA60        90777      66753345
TSA61        75897      84474971
TSA62        71839      73169267
TSA63        68788      60790053
TSA64        84929      78084013
TSA65        85243      78217517
TSA66        70183      97610780
TSA67        85540      69665112
TSA68        84998      51586540
TSA69        102325     68656057
TSA7         87421      57901423
TSA70        87168      58768010
TSA71        103817     56958943
TSA72        73541      73023551
TSA73        78857      44745962
TSA74        87334      79220475
TSA75        91715      69203605
TSA76        78648      53425286
TSA77        79096      57205952
TSA78        97059      60761749
TSA79        38217      34954526
TSA8         104450     72517643
TSA80        89257      76980939
TSA81        96925      56383758
TSA82        110529     44786219
TSA83        96832      58660994
TSA84        65384      96482971
TSA85        13773      13507088
TSA86        95516      57898304
TSA87        93168      44533868
TSA88        89442      62706611
TSA89        77578      74114825
TSA9         109298     60842426
TSA90        51052      62842939
TSA91        77437      80992651
TSA92        77545      54883790
TSA93        84159      38595329
TSA94        76607      52796861
TSA95        66522      67080686
TSA96        64005      75825743
TSA97        87314      55376103
TSA98        51068      27412276
TSA99        74245      86358066
UNA1         268        139804
VRL1         65191      70977486
VRL10        47117      72617273
VRL11        62096      72665769
VRL12        68618      66210525
VRL13        61833      72872136
VRL14        18568      28360198
VRL15        62818      70989029
VRL16        57377      72698007
VRL17        63094      64483507
VRL18        56315      73621679
VRL19        49518      62831075
VRL2         69652      63012196
VRL20        54769      72397040
VRL21        58685      71301784
VRL22        55846      73808927
VRL23        55766      73459419
VRL24        26984      44411001
VRL25        52723      75211867
VRL26        37843      82065344
VRL27        48332      74959953
VRL28        49353      73538752
VRL29        47047      78978286
VRL3         71580      61543937
VRL30        47718      82237560
VRL31        45372      47020533
VRL4         70163      66283133
VRL5         68471      67649644
VRL6         8469       14201485
VRL7         48105      77431957
VRL8         46627      71871009
VRL9         43920      71436951
VRT1         59024      92191306
VRT10        1313       193268600
VRT11        8959       180749495
VRT12        3174       106674176
VRT13        13369      172264404
VRT14        5825       185118453
VRT15        3794       188791406
VRT16        49392      115568769
VRT17        79196      69227962
VRT18        77136      66234193
VRT19        20571      15270714
VRT2         1210       194312383
VRT20        71483      76176379
VRT21        44787      123125149
VRT22        77207      63100129
VRT23        78857      62027434
VRT24        81614      57849772
VRT25        31286      21676248
VRT26        102757     65982975
VRT27        81216      56062059
VRT28        85588      58121151
VRT29        77093      59543617
VRT3         60428      101443640
VRT30        92268      52324499
VRT31        74224      56928837
VRT32        60507      50930253
VRT4         13463      168076046
VRT5         39041      60358807
VRT6         72901      66622223
VRT7         31774      63578219
VRT8         30885      112588529
VRT9         1264       193552177

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 202.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

20600925 17531092687   Homo sapiens
9722856   9988486238   Mus musculus
2193424   6525535790   Rattus norvegicus
2202936   5390962725   Bos taurus
3966796   5078639012   Zea mays
3296387   4894085447   Sus scrofa
1727251   3126295836   Danio rerio
1332150   1617515482   Hordeum vulgare subsp. vulgare
257614    1435261003   Strongylocentrotus purpuratus
456184    1288119875   Macaca mulatta
1376112   1265095091   Oryza sativa Japonica Group
1588337   1249787956   Xenopus (Silurana) tropicalis
1778102   1199738734   Nicotiana tabacum
2378745   1165019820   Arabidopsis thaliana
1796025   1150200847   Triticum aestivum
1264890   1131310204   Drosophila melanogaster
809415    1071409505   Vitis vinifera
2103959   1020134014   Glycine max
217070    1010271912   Pan troglodytes
744214     983078057   Solanum lycopersicum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          June 15 2014

                NCBI-GenBank Flat File Release 202.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         October 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ02).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


    Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. 
    GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 202.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Karen Clark, Jianli Dai, Francescopaolo di Cello,
	Michel Eschenbrenner, Irene Fang, Michael Fetchko, Linda Frisse,
	Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry, Suzanne Mate,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Ilya Dondoshansky, J. Bradley Holmes, WonHee Jang, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh, Jim Ostell,
	Vasuki Palanigobu, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov,
	Elena Starchenko, Hanzhen Sun, Tatiana Tatusova, Kamen Todorov,
	Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center