Release Notes For GenBank Release 204

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2014

               NCBI-GenBank Flat File Release 204.0

                    Distribution Release Notes

 178322253 loci, 181563676918 bases, from 178322253 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 204.0
1.2 Cutoff Date
1.3 Important Changes in Release 204.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 204.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 204.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 204.0, incorporates data processed by the INSDC databases
as of Saturday October 18, 2014 at approximately 1:33am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 204.0

1.3.1 Organizational changes

The total number of sequence data files increased by 123 with this release:

  - the BCT division is now composed of 152 142 files (+10)
  - the CON division is now composed of 286 278 files (+8)
  - the ENV division is now composed of  76  74 files (+2)
  - the EST division is now composed of 477 476 files (+1)
  - the INV division is now composed of 124  40 files (+84)
  - the PAT division is now composed of 214 210 files (+4)
  - the PLN division is now composed of  89  86 files (+3)
  - the VRT division is now composed of  44  33 files (+11)

  There is an unusually large increase in the number of INV-division sequence
files for Release 204. Nearly 3 million sequence records, with nearly
12 gigabases, which should have been handled as WGS projects, were distributed
by the European Nucleotide Archive (ENA) on September 22 2014 as individual
records. ENA has investigated the possibility of switching to a WGS
representation, but for the moment has decided that it isn't practical.
Hence, the unusual growth in the INV-division for this release.

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 123
of the GSS flatfiles in Release 204.0. Consider gbgss165.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                         October 15 2014

                NCBI-GenBank Flat File Release 204.0

                           GSS Sequences (Part 1)

   87046 loci,    63874704 bases, from    87046 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "165" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New 'Regulatory' feature to replace eleven existing feature types.

  As of the December 2015 GenBank release, eleven different features that
describe various aspects of regulation will be brought under the umbrella
of a single new feature: Regulatory . This new feature will have a
mandatory qualifier (/regulatory_class) to indicate the nature of its
regulatory activity.

  The existing features that will be replaced include: enhancer, promoter,
CAAT_signal, TATA_signal, -35_signal, -10_signal, RBS, GC_signal,
polyA_signal, attenuator, and terminator .

  A preliminary description of the new feature and qualifier is available,
and the October 2014 version of the Feature Table document will be updated
accordingly :

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Feature Key:	Regulatory

Definition:	any region of sequence that functions in the regulation of
		transcription or translation

Mandatory qualifiers:	/regulatory_class= "TYPE"

Optional qualifiers:	/allele="text"
	 		/bound_moiety="text"
			/citation=[number]
			/db_xref="<database>:<identifier>"
			/experiment="[CATEGORY:]text"
			/function="text"
			/gene="text"
			/gene_synonym="text"
			/inference="[CATEGORY:]TYPE[ (same species)][:EVIDENCE_BASIS]"
			/locus_tag="text" (single token)
			/map="text"
			/note="text"
			/old_locus_tag="text" (single token)
			/operon="text"
			/phenotype="text"
			/pseudo
			/pseudogene="TYPE"
			/standard_name="text"

Comment:		This feature will replace the following Feature Keys
			in DEC-2014: enhancer, promoter, CAAT_signal,
			TATA_signal, -35_signal, -10_signal, RBS, GC_signal,
			polyA_signal, attenuator, terminator

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Qualifier:		/regulatory_class

Definition:		a structured description of the classification of
			transcriptional	and translational regulatory elements
			in a sequence                

Value format:		"TYPE"

Example:		/regulatory_class="promoter"
			/regulatory_class="enhancer"
			/regulatory_class="ribosome_binding_site"       

Comment:		TYPE is a term taken from the INSDC controlled
			vocabulary for regulatory classes; on 15-DEC-2014,
			the following terms were valid:

			"attenuator"  (replaces attenuator feature key)
			"CAAT_signal"  (replaces CAAT_signal Feature Key)
			"enhancer"  (replaces enhancer Feature Key)
			"enhancer_blocking_element"
			"GC_signal"  (replaces GC_signal Feature Key)
			"imprinting_control_region"
			"insulator"
			"locus_control_region"
			"minus_35_signal" (replaces -10_signal Feature Key)
			"minus_10_signal"  (replaces -10_signal Feature Key)
			"response_element"
			"polyA_signal_sequence"  (replaces polyA_signal Feature Key)
			"promoter" (replaces promoter Feature Key)
			"ribosome_binding_site" (replaces RBS feature key)
			"riboswitch"
			"silencer"
			"TATA_box"  (replaces TATA_signal Feature Key)
			"terminator" (replaces terminator feature key)
			"other"	

Comment:		regulatory classes not yet in the INSDC
			/regulatory_class controlled vocabulary can be
			annotated by entering /regulatory_class="other"
			together with :
			/note="[brief explanation of novel regulatory_class]"

1.4.2 GI sequence identifiers to be phased out (slowly!) at NCBI

  The numeric GI sequence identifier that NCBI assigns to all nucleotide
and protein sequences was first introduced for GenBank Release products
as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for nearly 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who utilize
GIs in their own information systems and analysis pipelines, so it will not be
introduced quickly. You can expect that a great deal of additional detail will
be made available via NCBI's various announcement mechanisms.

  *This* particular announcement is chiefly intended to provide some advance
warning to our users. There _will_ be classes of GenBank sequences that
are not assigned GIs in the not-too-distant future. If GIs are central to
your operations, then it might be appropriate to begin planning a switch to
the use of Accession.Version identifiers instead.

  And in fact, NCBI now has several WGS submissions for which GIs have
not been assigned, for both the contigs and the scaffolds.

  For example: Here are excerpts of the flatfile representation for the
first ALWZ02 (second assembly-version of the ALWZ project) contig, and the
'singleton' scaffold which is constructed from it:

LOCUS       ALWZ020000001            701 bp    DNA     linear   PLN 28-MAY-2013
DEFINITION  Picea glauca contig316_0, whole genome shotgun sequence.
ACCESSION   ALWZ020000001 ALWZ020000000
VERSION     ALWZ020000001.1
DBLINK      BioProject: PRJNA83435
....
ORIGIN      
        1 cgttgtgttg gggcacccaa ccttggtgag gccgtattaa aaagtctacc tccaagccaa
       61 aatttgttct tatccatcct ccaactcgtc tttttgccta gtgctcccct atgtggacgt
      121 tttcgttgtg gaggagtttt tcgtttgggc gcccatcttg cgaactcacc ttgcattgcg
      181 tttggtcgcc caacttgtga acgtgccttg gattgcgttg gggcgcccaa gttgcggacg
      241 tgcggacgtg cctttctttg ccgacatgcc ttgcgtttgc gttgcggacg tgcaatgggg
      301 cccccagctt gctgacgtgc cttgcgttgc gttggggtgc ccaacttgcc gacgtgcctt
      361 gcgttgcgtt ggggcaccca accttggtga ggccgtatta aaaagtctac ctccaagata
      421 aaatttgttc ttatccatcc tctagctctt cttttagcct agtgctccct tgtgtggaca
      481 ttttcgttgt ggatcatttt ttcgtttagg tgcccatctt gcagacaagc cttgcgttgc
      541 gtttgggcac ccatcttgcg gacgcgcctt tcattgcgtt ggggcgccca acgttggtga
      601 ggccgtatta aaaagtctac ctccaagaca aaatttgttc ttatccatcc tccatctcgt
      661 ctttttgcct agtgctccct tgtgtggacg ttttcgttgc g
//

LOCUS       ALWZ02S0000001           701 bp    DNA     linear   CON 14-JUN-2013
DEFINITION  Picea glauca scaffold316, whole genome shotgun sequence.
ACCESSION   ALWZ02S0000001 ALWZ000000000
VERSION     ALWZ02S0000001.1
DBLINK      BioProject: PRJNA83435
....
CONTIG      join(ALWZ020000001.1:1..701)
//


**Note the absence of a GI value on the VERSION line of these two records**

Sample URLs from which ALWZ02 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.1.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.1.gbff.gz

Unannotated WGS projects consisting of many millions of contigs and 
scaffolds represent the first class of records for which GIs are no
longer being assigned. But the practice will ultimately expand to
include other classes of records.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2216 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct16.seq - Bacterial sequence entries, part 16.
62. gbbct17.seq - Bacterial sequence entries, part 17.
63. gbbct18.seq - Bacterial sequence entries, part 18.
64. gbbct19.seq - Bacterial sequence entries, part 19.
65. gbbct2.seq - Bacterial sequence entries, part 2.
66. gbbct20.seq - Bacterial sequence entries, part 20.
67. gbbct21.seq - Bacterial sequence entries, part 21.
68. gbbct22.seq - Bacterial sequence entries, part 22.
69. gbbct23.seq - Bacterial sequence entries, part 23.
70. gbbct24.seq - Bacterial sequence entries, part 24.
71. gbbct25.seq - Bacterial sequence entries, part 25.
72. gbbct26.seq - Bacterial sequence entries, part 26.
73. gbbct27.seq - Bacterial sequence entries, part 27.
74. gbbct28.seq - Bacterial sequence entries, part 28.
75. gbbct29.seq - Bacterial sequence entries, part 29.
76. gbbct3.seq - Bacterial sequence entries, part 3.
77. gbbct30.seq - Bacterial sequence entries, part 30.
78. gbbct31.seq - Bacterial sequence entries, part 31.
79. gbbct32.seq - Bacterial sequence entries, part 32.
80. gbbct33.seq - Bacterial sequence entries, part 33.
81. gbbct34.seq - Bacterial sequence entries, part 34.
82. gbbct35.seq - Bacterial sequence entries, part 35.
83. gbbct36.seq - Bacterial sequence entries, part 36.
84. gbbct37.seq - Bacterial sequence entries, part 37.
85. gbbct38.seq - Bacterial sequence entries, part 38.
86. gbbct39.seq - Bacterial sequence entries, part 39.
87. gbbct4.seq - Bacterial sequence entries, part 4.
88. gbbct40.seq - Bacterial sequence entries, part 40.
89. gbbct41.seq - Bacterial sequence entries, part 41.
90. gbbct42.seq - Bacterial sequence entries, part 42.
91. gbbct43.seq - Bacterial sequence entries, part 43.
92. gbbct44.seq - Bacterial sequence entries, part 44.
93. gbbct45.seq - Bacterial sequence entries, part 45.
94. gbbct46.seq - Bacterial sequence entries, part 46.
95. gbbct47.seq - Bacterial sequence entries, part 47.
96. gbbct48.seq - Bacterial sequence entries, part 48.
97. gbbct49.seq - Bacterial sequence entries, part 49.
98. gbbct5.seq - Bacterial sequence entries, part 5.
99. gbbct50.seq - Bacterial sequence entries, part 50.
100. gbbct51.seq - Bacterial sequence entries, part 51.
101. gbbct52.seq - Bacterial sequence entries, part 52.
102. gbbct53.seq - Bacterial sequence entries, part 53.
103. gbbct54.seq - Bacterial sequence entries, part 54.
104. gbbct55.seq - Bacterial sequence entries, part 55.
105. gbbct56.seq - Bacterial sequence entries, part 56.
106. gbbct57.seq - Bacterial sequence entries, part 57.
107. gbbct58.seq - Bacterial sequence entries, part 58.
108. gbbct59.seq - Bacterial sequence entries, part 59.
109. gbbct6.seq - Bacterial sequence entries, part 6.
110. gbbct60.seq - Bacterial sequence entries, part 60.
111. gbbct61.seq - Bacterial sequence entries, part 61.
112. gbbct62.seq - Bacterial sequence entries, part 62.
113. gbbct63.seq - Bacterial sequence entries, part 63.
114. gbbct64.seq - Bacterial sequence entries, part 64.
115. gbbct65.seq - Bacterial sequence entries, part 65.
116. gbbct66.seq - Bacterial sequence entries, part 66.
117. gbbct67.seq - Bacterial sequence entries, part 67.
118. gbbct68.seq - Bacterial sequence entries, part 68.
119. gbbct69.seq - Bacterial sequence entries, part 69.
120. gbbct7.seq - Bacterial sequence entries, part 7.
121. gbbct70.seq - Bacterial sequence entries, part 70.
122. gbbct71.seq - Bacterial sequence entries, part 71.
123. gbbct72.seq - Bacterial sequence entries, part 72.
124. gbbct73.seq - Bacterial sequence entries, part 73.
125. gbbct74.seq - Bacterial sequence entries, part 74.
126. gbbct75.seq - Bacterial sequence entries, part 75.
127. gbbct76.seq - Bacterial sequence entries, part 76.
128. gbbct77.seq - Bacterial sequence entries, part 77.
129. gbbct78.seq - Bacterial sequence entries, part 78.
130. gbbct79.seq - Bacterial sequence entries, part 79.
131. gbbct8.seq - Bacterial sequence entries, part 8.
132. gbbct80.seq - Bacterial sequence entries, part 80.
133. gbbct81.seq - Bacterial sequence entries, part 81.
134. gbbct82.seq - Bacterial sequence entries, part 82.
135. gbbct83.seq - Bacterial sequence entries, part 83.
136. gbbct84.seq - Bacterial sequence entries, part 84.
137. gbbct85.seq - Bacterial sequence entries, part 85.
138. gbbct86.seq - Bacterial sequence entries, part 86.
139. gbbct87.seq - Bacterial sequence entries, part 87.
140. gbbct88.seq - Bacterial sequence entries, part 88.
141. gbbct89.seq - Bacterial sequence entries, part 89.
142. gbbct9.seq - Bacterial sequence entries, part 9.
143. gbbct90.seq - Bacterial sequence entries, part 90.
144. gbbct91.seq - Bacterial sequence entries, part 91.
145. gbbct92.seq - Bacterial sequence entries, part 92.
146. gbbct93.seq - Bacterial sequence entries, part 93.
147. gbbct94.seq - Bacterial sequence entries, part 94.
148. gbbct95.seq - Bacterial sequence entries, part 95.
149. gbbct96.seq - Bacterial sequence entries, part 96.
150. gbbct97.seq - Bacterial sequence entries, part 97.
151. gbbct98.seq - Bacterial sequence entries, part 98.
152. gbbct99.seq - Bacterial sequence entries, part 99.
153. gbchg.txt - Accession numbers of entries updated since the previous release.
154. gbcon1.seq - Constructed sequence entries, part 1.
155. gbcon10.seq - Constructed sequence entries, part 10.
156. gbcon100.seq - Constructed sequence entries, part 100.
157. gbcon101.seq - Constructed sequence entries, part 101.
158. gbcon102.seq - Constructed sequence entries, part 102.
159. gbcon103.seq - Constructed sequence entries, part 103.
160. gbcon104.seq - Constructed sequence entries, part 104.
161. gbcon105.seq - Constructed sequence entries, part 105.
162. gbcon106.seq - Constructed sequence entries, part 106.
163. gbcon107.seq - Constructed sequence entries, part 107.
164. gbcon108.seq - Constructed sequence entries, part 108.
165. gbcon109.seq - Constructed sequence entries, part 109.
166. gbcon11.seq - Constructed sequence entries, part 11.
167. gbcon110.seq - Constructed sequence entries, part 110.
168. gbcon111.seq - Constructed sequence entries, part 111.
169. gbcon112.seq - Constructed sequence entries, part 112.
170. gbcon113.seq - Constructed sequence entries, part 113.
171. gbcon114.seq - Constructed sequence entries, part 114.
172. gbcon115.seq - Constructed sequence entries, part 115.
173. gbcon116.seq - Constructed sequence entries, part 116.
174. gbcon117.seq - Constructed sequence entries, part 117.
175. gbcon118.seq - Constructed sequence entries, part 118.
176. gbcon119.seq - Constructed sequence entries, part 119.
177. gbcon12.seq - Constructed sequence entries, part 12.
178. gbcon120.seq - Constructed sequence entries, part 120.
179. gbcon121.seq - Constructed sequence entries, part 121.
180. gbcon122.seq - Constructed sequence entries, part 122.
181. gbcon123.seq - Constructed sequence entries, part 123.
182. gbcon124.seq - Constructed sequence entries, part 124.
183. gbcon125.seq - Constructed sequence entries, part 125.
184. gbcon126.seq - Constructed sequence entries, part 126.
185. gbcon127.seq - Constructed sequence entries, part 127.
186. gbcon128.seq - Constructed sequence entries, part 128.
187. gbcon129.seq - Constructed sequence entries, part 129.
188. gbcon13.seq - Constructed sequence entries, part 13.
189. gbcon130.seq - Constructed sequence entries, part 130.
190. gbcon131.seq - Constructed sequence entries, part 131.
191. gbcon132.seq - Constructed sequence entries, part 132.
192. gbcon133.seq - Constructed sequence entries, part 133.
193. gbcon134.seq - Constructed sequence entries, part 134.
194. gbcon135.seq - Constructed sequence entries, part 135.
195. gbcon136.seq - Constructed sequence entries, part 136.
196. gbcon137.seq - Constructed sequence entries, part 137.
197. gbcon138.seq - Constructed sequence entries, part 138.
198. gbcon139.seq - Constructed sequence entries, part 139.
199. gbcon14.seq - Constructed sequence entries, part 14.
200. gbcon140.seq - Constructed sequence entries, part 140.
201. gbcon141.seq - Constructed sequence entries, part 141.
202. gbcon142.seq - Constructed sequence entries, part 142.
203. gbcon143.seq - Constructed sequence entries, part 143.
204. gbcon144.seq - Constructed sequence entries, part 144.
205. gbcon145.seq - Constructed sequence entries, part 145.
206. gbcon146.seq - Constructed sequence entries, part 146.
207. gbcon147.seq - Constructed sequence entries, part 147.
208. gbcon148.seq - Constructed sequence entries, part 148.
209. gbcon149.seq - Constructed sequence entries, part 149.
210. gbcon15.seq - Constructed sequence entries, part 15.
211. gbcon150.seq - Constructed sequence entries, part 150.
212. gbcon151.seq - Constructed sequence entries, part 151.
213. gbcon152.seq - Constructed sequence entries, part 152.
214. gbcon153.seq - Constructed sequence entries, part 153.
215. gbcon154.seq - Constructed sequence entries, part 154.
216. gbcon155.seq - Constructed sequence entries, part 155.
217. gbcon156.seq - Constructed sequence entries, part 156.
218. gbcon157.seq - Constructed sequence entries, part 157.
219. gbcon158.seq - Constructed sequence entries, part 158.
220. gbcon159.seq - Constructed sequence entries, part 159.
221. gbcon16.seq - Constructed sequence entries, part 16.
222. gbcon160.seq - Constructed sequence entries, part 160.
223. gbcon161.seq - Constructed sequence entries, part 161.
224. gbcon162.seq - Constructed sequence entries, part 162.
225. gbcon163.seq - Constructed sequence entries, part 163.
226. gbcon164.seq - Constructed sequence entries, part 164.
227. gbcon165.seq - Constructed sequence entries, part 165.
228. gbcon166.seq - Constructed sequence entries, part 166.
229. gbcon167.seq - Constructed sequence entries, part 167.
230. gbcon168.seq - Constructed sequence entries, part 168.
231. gbcon169.seq - Constructed sequence entries, part 169.
232. gbcon17.seq - Constructed sequence entries, part 17.
233. gbcon170.seq - Constructed sequence entries, part 170.
234. gbcon171.seq - Constructed sequence entries, part 171.
235. gbcon172.seq - Constructed sequence entries, part 172.
236. gbcon173.seq - Constructed sequence entries, part 173.
237. gbcon174.seq - Constructed sequence entries, part 174.
238. gbcon175.seq - Constructed sequence entries, part 175.
239. gbcon176.seq - Constructed sequence entries, part 176.
240. gbcon177.seq - Constructed sequence entries, part 177.
241. gbcon178.seq - Constructed sequence entries, part 178.
242. gbcon179.seq - Constructed sequence entries, part 179.
243. gbcon18.seq - Constructed sequence entries, part 18.
244. gbcon180.seq - Constructed sequence entries, part 180.
245. gbcon181.seq - Constructed sequence entries, part 181.
246. gbcon182.seq - Constructed sequence entries, part 182.
247. gbcon183.seq - Constructed sequence entries, part 183.
248. gbcon184.seq - Constructed sequence entries, part 184.
249. gbcon185.seq - Constructed sequence entries, part 185.
250. gbcon186.seq - Constructed sequence entries, part 186.
251. gbcon187.seq - Constructed sequence entries, part 187.
252. gbcon188.seq - Constructed sequence entries, part 188.
253. gbcon189.seq - Constructed sequence entries, part 189.
254. gbcon19.seq - Constructed sequence entries, part 19.
255. gbcon190.seq - Constructed sequence entries, part 190.
256. gbcon191.seq - Constructed sequence entries, part 191.
257. gbcon192.seq - Constructed sequence entries, part 192.
258. gbcon193.seq - Constructed sequence entries, part 193.
259. gbcon194.seq - Constructed sequence entries, part 194.
260. gbcon195.seq - Constructed sequence entries, part 195.
261. gbcon196.seq - Constructed sequence entries, part 196.
262. gbcon197.seq - Constructed sequence entries, part 197.
263. gbcon198.seq - Constructed sequence entries, part 198.
264. gbcon199.seq - Constructed sequence entries, part 199.
265. gbcon2.seq - Constructed sequence entries, part 2.
266. gbcon20.seq - Constructed sequence entries, part 20.
267. gbcon200.seq - Constructed sequence entries, part 200.
268. gbcon201.seq - Constructed sequence entries, part 201.
269. gbcon202.seq - Constructed sequence entries, part 202.
270. gbcon203.seq - Constructed sequence entries, part 203.
271. gbcon204.seq - Constructed sequence entries, part 204.
272. gbcon205.seq - Constructed sequence entries, part 205.
273. gbcon206.seq - Constructed sequence entries, part 206.
274. gbcon207.seq - Constructed sequence entries, part 207.
275. gbcon208.seq - Constructed sequence entries, part 208.
276. gbcon209.seq - Constructed sequence entries, part 209.
277. gbcon21.seq - Constructed sequence entries, part 21.
278. gbcon210.seq - Constructed sequence entries, part 210.
279. gbcon211.seq - Constructed sequence entries, part 211.
280. gbcon212.seq - Constructed sequence entries, part 212.
281. gbcon213.seq - Constructed sequence entries, part 213.
282. gbcon214.seq - Constructed sequence entries, part 214.
283. gbcon215.seq - Constructed sequence entries, part 215.
284. gbcon216.seq - Constructed sequence entries, part 216.
285. gbcon217.seq - Constructed sequence entries, part 217.
286. gbcon218.seq - Constructed sequence entries, part 218.
287. gbcon219.seq - Constructed sequence entries, part 219.
288. gbcon22.seq - Constructed sequence entries, part 22.
289. gbcon220.seq - Constructed sequence entries, part 220.
290. gbcon221.seq - Constructed sequence entries, part 221.
291. gbcon222.seq - Constructed sequence entries, part 222.
292. gbcon223.seq - Constructed sequence entries, part 223.
293. gbcon224.seq - Constructed sequence entries, part 224.
294. gbcon225.seq - Constructed sequence entries, part 225.
295. gbcon226.seq - Constructed sequence entries, part 226.
296. gbcon227.seq - Constructed sequence entries, part 227.
297. gbcon228.seq - Constructed sequence entries, part 228.
298. gbcon229.seq - Constructed sequence entries, part 229.
299. gbcon23.seq - Constructed sequence entries, part 23.
300. gbcon230.seq - Constructed sequence entries, part 230.
301. gbcon231.seq - Constructed sequence entries, part 231.
302. gbcon232.seq - Constructed sequence entries, part 232.
303. gbcon233.seq - Constructed sequence entries, part 233.
304. gbcon234.seq - Constructed sequence entries, part 234.
305. gbcon235.seq - Constructed sequence entries, part 235.
306. gbcon236.seq - Constructed sequence entries, part 236.
307. gbcon237.seq - Constructed sequence entries, part 237.
308. gbcon238.seq - Constructed sequence entries, part 238.
309. gbcon239.seq - Constructed sequence entries, part 239.
310. gbcon24.seq - Constructed sequence entries, part 24.
311. gbcon240.seq - Constructed sequence entries, part 240.
312. gbcon241.seq - Constructed sequence entries, part 241.
313. gbcon242.seq - Constructed sequence entries, part 242.
314. gbcon243.seq - Constructed sequence entries, part 243.
315. gbcon244.seq - Constructed sequence entries, part 244.
316. gbcon245.seq - Constructed sequence entries, part 245.
317. gbcon246.seq - Constructed sequence entries, part 246.
318. gbcon247.seq - Constructed sequence entries, part 247.
319. gbcon248.seq - Constructed sequence entries, part 248.
320. gbcon249.seq - Constructed sequence entries, part 249.
321. gbcon25.seq - Constructed sequence entries, part 25.
322. gbcon250.seq - Constructed sequence entries, part 250.
323. gbcon251.seq - Constructed sequence entries, part 251.
324. gbcon252.seq - Constructed sequence entries, part 252.
325. gbcon253.seq - Constructed sequence entries, part 253.
326. gbcon254.seq - Constructed sequence entries, part 254.
327. gbcon255.seq - Constructed sequence entries, part 255.
328. gbcon256.seq - Constructed sequence entries, part 256.
329. gbcon257.seq - Constructed sequence entries, part 257.
330. gbcon258.seq - Constructed sequence entries, part 258.
331. gbcon259.seq - Constructed sequence entries, part 259.
332. gbcon26.seq - Constructed sequence entries, part 26.
333. gbcon260.seq - Constructed sequence entries, part 260.
334. gbcon261.seq - Constructed sequence entries, part 261.
335. gbcon262.seq - Constructed sequence entries, part 262.
336. gbcon263.seq - Constructed sequence entries, part 263.
337. gbcon264.seq - Constructed sequence entries, part 264.
338. gbcon265.seq - Constructed sequence entries, part 265.
339. gbcon266.seq - Constructed sequence entries, part 266.
340. gbcon267.seq - Constructed sequence entries, part 267.
341. gbcon268.seq - Constructed sequence entries, part 268.
342. gbcon269.seq - Constructed sequence entries, part 269.
343. gbcon27.seq - Constructed sequence entries, part 27.
344. gbcon270.seq - Constructed sequence entries, part 270.
345. gbcon271.seq - Constructed sequence entries, part 271.
346. gbcon272.seq - Constructed sequence entries, part 272.
347. gbcon273.seq - Constructed sequence entries, part 273.
348. gbcon274.seq - Constructed sequence entries, part 274.
349. gbcon275.seq - Constructed sequence entries, part 275.
350. gbcon276.seq - Constructed sequence entries, part 276.
351. gbcon277.seq - Constructed sequence entries, part 277.
352. gbcon278.seq - Constructed sequence entries, part 278.
353. gbcon279.seq - Constructed sequence entries, part 279.
354. gbcon28.seq - Constructed sequence entries, part 28.
355. gbcon280.seq - Constructed sequence entries, part 280.
356. gbcon281.seq - Constructed sequence entries, part 281.
357. gbcon282.seq - Constructed sequence entries, part 282.
358. gbcon283.seq - Constructed sequence entries, part 283.
359. gbcon284.seq - Constructed sequence entries, part 284.
360. gbcon285.seq - Constructed sequence entries, part 285.
361. gbcon286.seq - Constructed sequence entries, part 286.
362. gbcon29.seq - Constructed sequence entries, part 29.
363. gbcon3.seq - Constructed sequence entries, part 3.
364. gbcon30.seq - Constructed sequence entries, part 30.
365. gbcon31.seq - Constructed sequence entries, part 31.
366. gbcon32.seq - Constructed sequence entries, part 32.
367. gbcon33.seq - Constructed sequence entries, part 33.
368. gbcon34.seq - Constructed sequence entries, part 34.
369. gbcon35.seq - Constructed sequence entries, part 35.
370. gbcon36.seq - Constructed sequence entries, part 36.
371. gbcon37.seq - Constructed sequence entries, part 37.
372. gbcon38.seq - Constructed sequence entries, part 38.
373. gbcon39.seq - Constructed sequence entries, part 39.
374. gbcon4.seq - Constructed sequence entries, part 4.
375. gbcon40.seq - Constructed sequence entries, part 40.
376. gbcon41.seq - Constructed sequence entries, part 41.
377. gbcon42.seq - Constructed sequence entries, part 42.
378. gbcon43.seq - Constructed sequence entries, part 43.
379. gbcon44.seq - Constructed sequence entries, part 44.
380. gbcon45.seq - Constructed sequence entries, part 45.
381. gbcon46.seq - Constructed sequence entries, part 46.
382. gbcon47.seq - Constructed sequence entries, part 47.
383. gbcon48.seq - Constructed sequence entries, part 48.
384. gbcon49.seq - Constructed sequence entries, part 49.
385. gbcon5.seq - Constructed sequence entries, part 5.
386. gbcon50.seq - Constructed sequence entries, part 50.
387. gbcon51.seq - Constructed sequence entries, part 51.
388. gbcon52.seq - Constructed sequence entries, part 52.
389. gbcon53.seq - Constructed sequence entries, part 53.
390. gbcon54.seq - Constructed sequence entries, part 54.
391. gbcon55.seq - Constructed sequence entries, part 55.
392. gbcon56.seq - Constructed sequence entries, part 56.
393. gbcon57.seq - Constructed sequence entries, part 57.
394. gbcon58.seq - Constructed sequence entries, part 58.
395. gbcon59.seq - Constructed sequence entries, part 59.
396. gbcon6.seq - Constructed sequence entries, part 6.
397. gbcon60.seq - Constructed sequence entries, part 60.
398. gbcon61.seq - Constructed sequence entries, part 61.
399. gbcon62.seq - Constructed sequence entries, part 62.
400. gbcon63.seq - Constructed sequence entries, part 63.
401. gbcon64.seq - Constructed sequence entries, part 64.
402. gbcon65.seq - Constructed sequence entries, part 65.
403. gbcon66.seq - Constructed sequence entries, part 66.
404. gbcon67.seq - Constructed sequence entries, part 67.
405. gbcon68.seq - Constructed sequence entries, part 68.
406. gbcon69.seq - Constructed sequence entries, part 69.
407. gbcon7.seq - Constructed sequence entries, part 7.
408. gbcon70.seq - Constructed sequence entries, part 70.
409. gbcon71.seq - Constructed sequence entries, part 71.
410. gbcon72.seq - Constructed sequence entries, part 72.
411. gbcon73.seq - Constructed sequence entries, part 73.
412. gbcon74.seq - Constructed sequence entries, part 74.
413. gbcon75.seq - Constructed sequence entries, part 75.
414. gbcon76.seq - Constructed sequence entries, part 76.
415. gbcon77.seq - Constructed sequence entries, part 77.
416. gbcon78.seq - Constructed sequence entries, part 78.
417. gbcon79.seq - Constructed sequence entries, part 79.
418. gbcon8.seq - Constructed sequence entries, part 8.
419. gbcon80.seq - Constructed sequence entries, part 80.
420. gbcon81.seq - Constructed sequence entries, part 81.
421. gbcon82.seq - Constructed sequence entries, part 82.
422. gbcon83.seq - Constructed sequence entries, part 83.
423. gbcon84.seq - Constructed sequence entries, part 84.
424. gbcon85.seq - Constructed sequence entries, part 85.
425. gbcon86.seq - Constructed sequence entries, part 86.
426. gbcon87.seq - Constructed sequence entries, part 87.
427. gbcon88.seq - Constructed sequence entries, part 88.
428. gbcon89.seq - Constructed sequence entries, part 89.
429. gbcon9.seq - Constructed sequence entries, part 9.
430. gbcon90.seq - Constructed sequence entries, part 90.
431. gbcon91.seq - Constructed sequence entries, part 91.
432. gbcon92.seq - Constructed sequence entries, part 92.
433. gbcon93.seq - Constructed sequence entries, part 93.
434. gbcon94.seq - Constructed sequence entries, part 94.
435. gbcon95.seq - Constructed sequence entries, part 95.
436. gbcon96.seq - Constructed sequence entries, part 96.
437. gbcon97.seq - Constructed sequence entries, part 97.
438. gbcon98.seq - Constructed sequence entries, part 98.
439. gbcon99.seq - Constructed sequence entries, part 99.
440. gbdel.txt - Accession numbers of entries deleted since the previous release.
441. gbenv1.seq - Environmental sampling sequence entries, part 1.
442. gbenv10.seq - Environmental sampling sequence entries, part 10.
443. gbenv11.seq - Environmental sampling sequence entries, part 11.
444. gbenv12.seq - Environmental sampling sequence entries, part 12.
445. gbenv13.seq - Environmental sampling sequence entries, part 13.
446. gbenv14.seq - Environmental sampling sequence entries, part 14.
447. gbenv15.seq - Environmental sampling sequence entries, part 15.
448. gbenv16.seq - Environmental sampling sequence entries, part 16.
449. gbenv17.seq - Environmental sampling sequence entries, part 17.
450. gbenv18.seq - Environmental sampling sequence entries, part 18.
451. gbenv19.seq - Environmental sampling sequence entries, part 19.
452. gbenv2.seq - Environmental sampling sequence entries, part 2.
453. gbenv20.seq - Environmental sampling sequence entries, part 20.
454. gbenv21.seq - Environmental sampling sequence entries, part 21.
455. gbenv22.seq - Environmental sampling sequence entries, part 22.
456. gbenv23.seq - Environmental sampling sequence entries, part 23.
457. gbenv24.seq - Environmental sampling sequence entries, part 24.
458. gbenv25.seq - Environmental sampling sequence entries, part 25.
459. gbenv26.seq - Environmental sampling sequence entries, part 26.
460. gbenv27.seq - Environmental sampling sequence entries, part 27.
461. gbenv28.seq - Environmental sampling sequence entries, part 28.
462. gbenv29.seq - Environmental sampling sequence entries, part 29.
463. gbenv3.seq - Environmental sampling sequence entries, part 3.
464. gbenv30.seq - Environmental sampling sequence entries, part 30.
465. gbenv31.seq - Environmental sampling sequence entries, part 31.
466. gbenv32.seq - Environmental sampling sequence entries, part 32.
467. gbenv33.seq - Environmental sampling sequence entries, part 33.
468. gbenv34.seq - Environmental sampling sequence entries, part 34.
469. gbenv35.seq - Environmental sampling sequence entries, part 35.
470. gbenv36.seq - Environmental sampling sequence entries, part 36.
471. gbenv37.seq - Environmental sampling sequence entries, part 37.
472. gbenv38.seq - Environmental sampling sequence entries, part 38.
473. gbenv39.seq - Environmental sampling sequence entries, part 39.
474. gbenv4.seq - Environmental sampling sequence entries, part 4.
475. gbenv40.seq - Environmental sampling sequence entries, part 40.
476. gbenv41.seq - Environmental sampling sequence entries, part 41.
477. gbenv42.seq - Environmental sampling sequence entries, part 42.
478. gbenv43.seq - Environmental sampling sequence entries, part 43.
479. gbenv44.seq - Environmental sampling sequence entries, part 44.
480. gbenv45.seq - Environmental sampling sequence entries, part 45.
481. gbenv46.seq - Environmental sampling sequence entries, part 46.
482. gbenv47.seq - Environmental sampling sequence entries, part 47.
483. gbenv48.seq - Environmental sampling sequence entries, part 48.
484. gbenv49.seq - Environmental sampling sequence entries, part 49.
485. gbenv5.seq - Environmental sampling sequence entries, part 5.
486. gbenv50.seq - Environmental sampling sequence entries, part 50.
487. gbenv51.seq - Environmental sampling sequence entries, part 51.
488. gbenv52.seq - Environmental sampling sequence entries, part 52.
489. gbenv53.seq - Environmental sampling sequence entries, part 53.
490. gbenv54.seq - Environmental sampling sequence entries, part 54.
491. gbenv55.seq - Environmental sampling sequence entries, part 55.
492. gbenv56.seq - Environmental sampling sequence entries, part 56.
493. gbenv57.seq - Environmental sampling sequence entries, part 57.
494. gbenv58.seq - Environmental sampling sequence entries, part 58.
495. gbenv59.seq - Environmental sampling sequence entries, part 59.
496. gbenv6.seq - Environmental sampling sequence entries, part 6.
497. gbenv60.seq - Environmental sampling sequence entries, part 60.
498. gbenv61.seq - Environmental sampling sequence entries, part 61.
499. gbenv62.seq - Environmental sampling sequence entries, part 62.
500. gbenv63.seq - Environmental sampling sequence entries, part 63.
501. gbenv64.seq - Environmental sampling sequence entries, part 64.
502. gbenv65.seq - Environmental sampling sequence entries, part 65.
503. gbenv66.seq - Environmental sampling sequence entries, part 66.
504. gbenv67.seq - Environmental sampling sequence entries, part 67.
505. gbenv68.seq - Environmental sampling sequence entries, part 68.
506. gbenv69.seq - Environmental sampling sequence entries, part 69.
507. gbenv7.seq - Environmental sampling sequence entries, part 7.
508. gbenv70.seq - Environmental sampling sequence entries, part 70.
509. gbenv71.seq - Environmental sampling sequence entries, part 71.
510. gbenv72.seq - Environmental sampling sequence entries, part 72.
511. gbenv73.seq - Environmental sampling sequence entries, part 73.
512. gbenv74.seq - Environmental sampling sequence entries, part 74.
513. gbenv75.seq - Environmental sampling sequence entries, part 75.
514. gbenv76.seq - Environmental sampling sequence entries, part 76.
515. gbenv8.seq - Environmental sampling sequence entries, part 8.
516. gbenv9.seq - Environmental sampling sequence entries, part 9.
517. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
518. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
519. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
520. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
521. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
522. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
523. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
524. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
525. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
526. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
527. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
528. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
529. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
530. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
531. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
532. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
533. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
534. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
535. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
536. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
537. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
538. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
539. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
540. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
541. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
542. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
543. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
544. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
545. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
546. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
547. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
548. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
549. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
550. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
551. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
552. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
553. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
554. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
555. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
556. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
557. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
558. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
559. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
560. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
561. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
562. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
563. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
564. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
565. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
566. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
567. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
568. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
569. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
570. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
571. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
572. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
573. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
574. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
575. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
576. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
577. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
578. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
579. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
580. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
581. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
582. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
583. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
584. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
585. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
586. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
587. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
588. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
589. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
590. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
591. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
592. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
593. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
594. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
595. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
596. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
597. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
598. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
599. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
600. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
601. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
602. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
603. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
604. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
605. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
606. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
607. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
608. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
609. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
610. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
611. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
612. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
613. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
614. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
615. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
616. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
617. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
618. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
619. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
620. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
621. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
622. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
623. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
624. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
625. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
626. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
627. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
628. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
629. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
630. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
631. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
632. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
633. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
634. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
635. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
636. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
637. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
638. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
639. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
640. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
641. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
642. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
643. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
644. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
645. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
646. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
647. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
648. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
649. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
650. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
651. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
652. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
653. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
654. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
655. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
656. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
657. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
658. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
659. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
660. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
661. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
662. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
663. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
664. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
665. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
666. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
667. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
668. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
669. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
670. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
671. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
672. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
673. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
674. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
675. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
676. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
677. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
678. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
679. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
680. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
681. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
682. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
683. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
684. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
685. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
686. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
687. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
688. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
689. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
690. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
691. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
692. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
693. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
694. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
695. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
696. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
697. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
698. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
699. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
700. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
701. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
702. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
703. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
704. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
705. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
706. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
707. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
708. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
709. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
710. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
711. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
712. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
713. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
714. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
715. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
716. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
717. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
718. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
719. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
720. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
721. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
722. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
723. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
724. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
725. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
726. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
727. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
728. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
729. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
730. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
731. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
732. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
733. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
734. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
735. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
736. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
737. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
738. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
739. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
740. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
741. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
742. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
743. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
744. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
745. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
746. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
747. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
748. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
749. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
750. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
751. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
752. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
753. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
754. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
755. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
756. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
757. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
758. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
759. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
760. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
761. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
762. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
763. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
764. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
765. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
766. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
767. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
768. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
769. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
770. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
771. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
772. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
773. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
774. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
775. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
776. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
777. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
778. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
779. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
780. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
781. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
782. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
783. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
784. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
785. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
786. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
787. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
788. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
789. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
790. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
791. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
792. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
793. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
794. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
795. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
796. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
797. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
798. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
799. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
800. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
801. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
802. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
803. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
804. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
805. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
806. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
807. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
808. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
809. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
810. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
811. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
812. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
813. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
814. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
815. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
816. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
817. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
818. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
819. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
820. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
821. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
822. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
823. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
824. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
825. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
826. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
827. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
828. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
829. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
830. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
831. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
832. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
833. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
834. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
835. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
836. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
837. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
838. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
839. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
840. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
841. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
842. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
843. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
844. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
845. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
846. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
847. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
848. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
849. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
850. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
851. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
852. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
853. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
854. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
855. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
856. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
857. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
858. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
859. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
860. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
861. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
862. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
863. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
864. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
865. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
866. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
867. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
868. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
869. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
870. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
871. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
872. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
873. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
874. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
875. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
876. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
877. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
878. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
879. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
880. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
881. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
882. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
883. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
884. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
885. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
886. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
887. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
888. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
889. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
890. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
891. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
892. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
893. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
894. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
895. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
896. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
897. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
898. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
899. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
900. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
901. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
902. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
903. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
904. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
905. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
906. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
907. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
908. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
909. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
910. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
911. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
912. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
913. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
914. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
915. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
916. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
917. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
918. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
919. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
920. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
921. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
922. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
923. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
924. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
925. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
926. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
927. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
928. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
929. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
930. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
931. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
932. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
933. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
934. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
935. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
936. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
937. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
938. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
939. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
940. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
941. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
942. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
943. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
944. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
945. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
946. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
947. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
948. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
949. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
950. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
951. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
952. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
953. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
954. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
955. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
956. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
957. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
958. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
959. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
960. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
961. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
962. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
963. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
964. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
965. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
966. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
967. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
968. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
969. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
970. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
971. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
972. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
973. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
974. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
975. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
976. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
977. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
978. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
979. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
980. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
981. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
982. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
983. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
984. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
985. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
986. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
987. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
988. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
989. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
990. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
991. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
992. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
993. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
994. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
995. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
996. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
997. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
998. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
999. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1000. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1001. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1002. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1003. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1004. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1005. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1006. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1007. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1008. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1009. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1010. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1011. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1012. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1013. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1014. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1015. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1016. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1017. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1018. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1019. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1020. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1021. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1022. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1023. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1024. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1025. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1026. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1027. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1028. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1029. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1030. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1031. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1032. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1033. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1034. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1035. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1036. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1037. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1038. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1039. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1040. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1041. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1042. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1043. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1044. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1045. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1046. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1047. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1048. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1049. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1050. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1051. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1052. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1053. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1054. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1055. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1056. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1057. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1058. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1059. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1060. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1061. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1062. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1063. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1064. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1065. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1066. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1067. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1068. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1069. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1070. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1071. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1072. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1073. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1074. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1075. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1076. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1077. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1078. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1079. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1080. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1081. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1082. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1083. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1084. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1085. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1086. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1087. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1088. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1089. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1090. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1091. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1092. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1093. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1094. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1095. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1096. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1097. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1098. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1099. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1100. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1101. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1102. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1103. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1104. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1105. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1106. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1107. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1108. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1109. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1110. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1111. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1112. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1113. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1114. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1115. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1116. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1117. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1118. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1119. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1120. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1121. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1122. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1123. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1124. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1125. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1126. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1127. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1128. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1129. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1130. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1131. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1132. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1133. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1134. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1135. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1136. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1137. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1138. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1139. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1140. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1141. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1142. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1143. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1144. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1145. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1146. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1147. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1148. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1149. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1150. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1151. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1152. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1153. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1154. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1155. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1156. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1157. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1158. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1159. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1160. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1161. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1162. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1163. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1164. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1165. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1166. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1167. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1168. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1169. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1170. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1171. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1172. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1173. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1174. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1175. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1176. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1177. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1178. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1179. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1180. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1181. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1182. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1183. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1184. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1185. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1186. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1187. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1188. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1189. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1190. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1191. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1192. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1193. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1194. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1195. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1196. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1197. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1198. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1199. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1200. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1201. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1202. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1203. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1204. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1205. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1206. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1207. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1208. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1209. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1210. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1211. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1212. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1213. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1214. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1215. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1216. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1217. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1218. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1219. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1220. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1221. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1222. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1223. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1224. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1225. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1226. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1227. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1228. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1229. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1230. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1231. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1232. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1233. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1234. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1235. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1236. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1237. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1238. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1239. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1240. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1241. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1242. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1243. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1244. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1245. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1246. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1247. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1248. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1249. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1250. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1251. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1252. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1253. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1254. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1255. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1256. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1257. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1258. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1259. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1260. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1261. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1262. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1263. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1264. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1265. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1266. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1267. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1268. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1269. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1270. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1271. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1272. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1273. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1274. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1275. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1276. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1277. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1278. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1279. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1280. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1281. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1282. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1283. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1284. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1285. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1286. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1287. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1288. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1289. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1290. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1291. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1292. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1293. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1294. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1295. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1296. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1297. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1298. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1299. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1300. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1301. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1302. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1303. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1304. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1305. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1306. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1307. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1308. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1309. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1310. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1311. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1312. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1313. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1314. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1315. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1316. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1317. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1318. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1319. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1320. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1321. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1322. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1323. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1324. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1325. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1326. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1327. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1328. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1329. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1330. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1331. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1332. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1333. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1334. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1335. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1336. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1337. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1338. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1339. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1340. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1341. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1342. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1343. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1344. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1345. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1346. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1347. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1348. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1349. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1350. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1351. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1352. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1353. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1354. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1355. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1356. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1357. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1358. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1359. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1360. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1361. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1362. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1363. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1364. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1365. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1366. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1367. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1368. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1369. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1370. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1371. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1372. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1373. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1374. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1375. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1376. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1377. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1378. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1379. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1380. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1381. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1382. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1383. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1384. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1385. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1386. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1387. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1388. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1389. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1390. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1391. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1392. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1393. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1394. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1395. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1396. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1397. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1398. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1399. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1400. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1401. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1402. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1403. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1404. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1405. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1406. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1407. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1408. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1409. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1410. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1411. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1412. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1413. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1414. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1415. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1416. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1417. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1418. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1419. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1420. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1421. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1422. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1423. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1424. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1425. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1426. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1427. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1428. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1429. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1430. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1431. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1432. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1433. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1434. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1435. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1436. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1437. gbinv1.seq - Invertebrate sequence entries, part 1.
1438. gbinv10.seq - Invertebrate sequence entries, part 10.
1439. gbinv100.seq - Invertebrate sequence entries, part 100.
1440. gbinv101.seq - Invertebrate sequence entries, part 101.
1441. gbinv102.seq - Invertebrate sequence entries, part 102.
1442. gbinv103.seq - Invertebrate sequence entries, part 103.
1443. gbinv104.seq - Invertebrate sequence entries, part 104.
1444. gbinv105.seq - Invertebrate sequence entries, part 105.
1445. gbinv106.seq - Invertebrate sequence entries, part 106.
1446. gbinv107.seq - Invertebrate sequence entries, part 107.
1447. gbinv108.seq - Invertebrate sequence entries, part 108.
1448. gbinv109.seq - Invertebrate sequence entries, part 109.
1449. gbinv11.seq - Invertebrate sequence entries, part 11.
1450. gbinv110.seq - Invertebrate sequence entries, part 110.
1451. gbinv111.seq - Invertebrate sequence entries, part 111.
1452. gbinv112.seq - Invertebrate sequence entries, part 112.
1453. gbinv113.seq - Invertebrate sequence entries, part 113.
1454. gbinv114.seq - Invertebrate sequence entries, part 114.
1455. gbinv115.seq - Invertebrate sequence entries, part 115.
1456. gbinv116.seq - Invertebrate sequence entries, part 116.
1457. gbinv117.seq - Invertebrate sequence entries, part 117.
1458. gbinv118.seq - Invertebrate sequence entries, part 118.
1459. gbinv119.seq - Invertebrate sequence entries, part 119.
1460. gbinv12.seq - Invertebrate sequence entries, part 12.
1461. gbinv120.seq - Invertebrate sequence entries, part 120.
1462. gbinv121.seq - Invertebrate sequence entries, part 121.
1463. gbinv122.seq - Invertebrate sequence entries, part 122.
1464. gbinv123.seq - Invertebrate sequence entries, part 123.
1465. gbinv124.seq - Invertebrate sequence entries, part 124.
1466. gbinv13.seq - Invertebrate sequence entries, part 13.
1467. gbinv14.seq - Invertebrate sequence entries, part 14.
1468. gbinv15.seq - Invertebrate sequence entries, part 15.
1469. gbinv16.seq - Invertebrate sequence entries, part 16.
1470. gbinv17.seq - Invertebrate sequence entries, part 17.
1471. gbinv18.seq - Invertebrate sequence entries, part 18.
1472. gbinv19.seq - Invertebrate sequence entries, part 19.
1473. gbinv2.seq - Invertebrate sequence entries, part 2.
1474. gbinv20.seq - Invertebrate sequence entries, part 20.
1475. gbinv21.seq - Invertebrate sequence entries, part 21.
1476. gbinv22.seq - Invertebrate sequence entries, part 22.
1477. gbinv23.seq - Invertebrate sequence entries, part 23.
1478. gbinv24.seq - Invertebrate sequence entries, part 24.
1479. gbinv25.seq - Invertebrate sequence entries, part 25.
1480. gbinv26.seq - Invertebrate sequence entries, part 26.
1481. gbinv27.seq - Invertebrate sequence entries, part 27.
1482. gbinv28.seq - Invertebrate sequence entries, part 28.
1483. gbinv29.seq - Invertebrate sequence entries, part 29.
1484. gbinv3.seq - Invertebrate sequence entries, part 3.
1485. gbinv30.seq - Invertebrate sequence entries, part 30.
1486. gbinv31.seq - Invertebrate sequence entries, part 31.
1487. gbinv32.seq - Invertebrate sequence entries, part 32.
1488. gbinv33.seq - Invertebrate sequence entries, part 33.
1489. gbinv34.seq - Invertebrate sequence entries, part 34.
1490. gbinv35.seq - Invertebrate sequence entries, part 35.
1491. gbinv36.seq - Invertebrate sequence entries, part 36.
1492. gbinv37.seq - Invertebrate sequence entries, part 37.
1493. gbinv38.seq - Invertebrate sequence entries, part 38.
1494. gbinv39.seq - Invertebrate sequence entries, part 39.
1495. gbinv4.seq - Invertebrate sequence entries, part 4.
1496. gbinv40.seq - Invertebrate sequence entries, part 40.
1497. gbinv41.seq - Invertebrate sequence entries, part 41.
1498. gbinv42.seq - Invertebrate sequence entries, part 42.
1499. gbinv43.seq - Invertebrate sequence entries, part 43.
1500. gbinv44.seq - Invertebrate sequence entries, part 44.
1501. gbinv45.seq - Invertebrate sequence entries, part 45.
1502. gbinv46.seq - Invertebrate sequence entries, part 46.
1503. gbinv47.seq - Invertebrate sequence entries, part 47.
1504. gbinv48.seq - Invertebrate sequence entries, part 48.
1505. gbinv49.seq - Invertebrate sequence entries, part 49.
1506. gbinv5.seq - Invertebrate sequence entries, part 5.
1507. gbinv50.seq - Invertebrate sequence entries, part 50.
1508. gbinv51.seq - Invertebrate sequence entries, part 51.
1509. gbinv52.seq - Invertebrate sequence entries, part 52.
1510. gbinv53.seq - Invertebrate sequence entries, part 53.
1511. gbinv54.seq - Invertebrate sequence entries, part 54.
1512. gbinv55.seq - Invertebrate sequence entries, part 55.
1513. gbinv56.seq - Invertebrate sequence entries, part 56.
1514. gbinv57.seq - Invertebrate sequence entries, part 57.
1515. gbinv58.seq - Invertebrate sequence entries, part 58.
1516. gbinv59.seq - Invertebrate sequence entries, part 59.
1517. gbinv6.seq - Invertebrate sequence entries, part 6.
1518. gbinv60.seq - Invertebrate sequence entries, part 60.
1519. gbinv61.seq - Invertebrate sequence entries, part 61.
1520. gbinv62.seq - Invertebrate sequence entries, part 62.
1521. gbinv63.seq - Invertebrate sequence entries, part 63.
1522. gbinv64.seq - Invertebrate sequence entries, part 64.
1523. gbinv65.seq - Invertebrate sequence entries, part 65.
1524. gbinv66.seq - Invertebrate sequence entries, part 66.
1525. gbinv67.seq - Invertebrate sequence entries, part 67.
1526. gbinv68.seq - Invertebrate sequence entries, part 68.
1527. gbinv69.seq - Invertebrate sequence entries, part 69.
1528. gbinv7.seq - Invertebrate sequence entries, part 7.
1529. gbinv70.seq - Invertebrate sequence entries, part 70.
1530. gbinv71.seq - Invertebrate sequence entries, part 71.
1531. gbinv72.seq - Invertebrate sequence entries, part 72.
1532. gbinv73.seq - Invertebrate sequence entries, part 73.
1533. gbinv74.seq - Invertebrate sequence entries, part 74.
1534. gbinv75.seq - Invertebrate sequence entries, part 75.
1535. gbinv76.seq - Invertebrate sequence entries, part 76.
1536. gbinv77.seq - Invertebrate sequence entries, part 77.
1537. gbinv78.seq - Invertebrate sequence entries, part 78.
1538. gbinv79.seq - Invertebrate sequence entries, part 79.
1539. gbinv8.seq - Invertebrate sequence entries, part 8.
1540. gbinv80.seq - Invertebrate sequence entries, part 80.
1541. gbinv81.seq - Invertebrate sequence entries, part 81.
1542. gbinv82.seq - Invertebrate sequence entries, part 82.
1543. gbinv83.seq - Invertebrate sequence entries, part 83.
1544. gbinv84.seq - Invertebrate sequence entries, part 84.
1545. gbinv85.seq - Invertebrate sequence entries, part 85.
1546. gbinv86.seq - Invertebrate sequence entries, part 86.
1547. gbinv87.seq - Invertebrate sequence entries, part 87.
1548. gbinv88.seq - Invertebrate sequence entries, part 88.
1549. gbinv89.seq - Invertebrate sequence entries, part 89.
1550. gbinv9.seq - Invertebrate sequence entries, part 9.
1551. gbinv90.seq - Invertebrate sequence entries, part 90.
1552. gbinv91.seq - Invertebrate sequence entries, part 91.
1553. gbinv92.seq - Invertebrate sequence entries, part 92.
1554. gbinv93.seq - Invertebrate sequence entries, part 93.
1555. gbinv94.seq - Invertebrate sequence entries, part 94.
1556. gbinv95.seq - Invertebrate sequence entries, part 95.
1557. gbinv96.seq - Invertebrate sequence entries, part 96.
1558. gbinv97.seq - Invertebrate sequence entries, part 97.
1559. gbinv98.seq - Invertebrate sequence entries, part 98.
1560. gbinv99.seq - Invertebrate sequence entries, part 99.
1561. gbmam1.seq - Other mammalian sequence entries, part 1.
1562. gbmam2.seq - Other mammalian sequence entries, part 2.
1563. gbmam3.seq - Other mammalian sequence entries, part 3.
1564. gbmam4.seq - Other mammalian sequence entries, part 4.
1565. gbmam5.seq - Other mammalian sequence entries, part 5.
1566. gbmam6.seq - Other mammalian sequence entries, part 6.
1567. gbmam7.seq - Other mammalian sequence entries, part 7.
1568. gbmam8.seq - Other mammalian sequence entries, part 8.
1569. gbmam9.seq - Other mammalian sequence entries, part 9.
1570. gbnew.txt - Accession numbers of entries new since the previous release.
1571. gbpat1.seq - Patent sequence entries, part 1.
1572. gbpat10.seq - Patent sequence entries, part 10.
1573. gbpat100.seq - Patent sequence entries, part 100.
1574. gbpat101.seq - Patent sequence entries, part 101.
1575. gbpat102.seq - Patent sequence entries, part 102.
1576. gbpat103.seq - Patent sequence entries, part 103.
1577. gbpat104.seq - Patent sequence entries, part 104.
1578. gbpat105.seq - Patent sequence entries, part 105.
1579. gbpat106.seq - Patent sequence entries, part 106.
1580. gbpat107.seq - Patent sequence entries, part 107.
1581. gbpat108.seq - Patent sequence entries, part 108.
1582. gbpat109.seq - Patent sequence entries, part 109.
1583. gbpat11.seq - Patent sequence entries, part 11.
1584. gbpat110.seq - Patent sequence entries, part 110.
1585. gbpat111.seq - Patent sequence entries, part 111.
1586. gbpat112.seq - Patent sequence entries, part 112.
1587. gbpat113.seq - Patent sequence entries, part 113.
1588. gbpat114.seq - Patent sequence entries, part 114.
1589. gbpat115.seq - Patent sequence entries, part 115.
1590. gbpat116.seq - Patent sequence entries, part 116.
1591. gbpat117.seq - Patent sequence entries, part 117.
1592. gbpat118.seq - Patent sequence entries, part 118.
1593. gbpat119.seq - Patent sequence entries, part 119.
1594. gbpat12.seq - Patent sequence entries, part 12.
1595. gbpat120.seq - Patent sequence entries, part 120.
1596. gbpat121.seq - Patent sequence entries, part 121.
1597. gbpat122.seq - Patent sequence entries, part 122.
1598. gbpat123.seq - Patent sequence entries, part 123.
1599. gbpat124.seq - Patent sequence entries, part 124.
1600. gbpat125.seq - Patent sequence entries, part 125.
1601. gbpat126.seq - Patent sequence entries, part 126.
1602. gbpat127.seq - Patent sequence entries, part 127.
1603. gbpat128.seq - Patent sequence entries, part 128.
1604. gbpat129.seq - Patent sequence entries, part 129.
1605. gbpat13.seq - Patent sequence entries, part 13.
1606. gbpat130.seq - Patent sequence entries, part 130.
1607. gbpat131.seq - Patent sequence entries, part 131.
1608. gbpat132.seq - Patent sequence entries, part 132.
1609. gbpat133.seq - Patent sequence entries, part 133.
1610. gbpat134.seq - Patent sequence entries, part 134.
1611. gbpat135.seq - Patent sequence entries, part 135.
1612. gbpat136.seq - Patent sequence entries, part 136.
1613. gbpat137.seq - Patent sequence entries, part 137.
1614. gbpat138.seq - Patent sequence entries, part 138.
1615. gbpat139.seq - Patent sequence entries, part 139.
1616. gbpat14.seq - Patent sequence entries, part 14.
1617. gbpat140.seq - Patent sequence entries, part 140.
1618. gbpat141.seq - Patent sequence entries, part 141.
1619. gbpat142.seq - Patent sequence entries, part 142.
1620. gbpat143.seq - Patent sequence entries, part 143.
1621. gbpat144.seq - Patent sequence entries, part 144.
1622. gbpat145.seq - Patent sequence entries, part 145.
1623. gbpat146.seq - Patent sequence entries, part 146.
1624. gbpat147.seq - Patent sequence entries, part 147.
1625. gbpat148.seq - Patent sequence entries, part 148.
1626. gbpat149.seq - Patent sequence entries, part 149.
1627. gbpat15.seq - Patent sequence entries, part 15.
1628. gbpat150.seq - Patent sequence entries, part 150.
1629. gbpat151.seq - Patent sequence entries, part 151.
1630. gbpat152.seq - Patent sequence entries, part 152.
1631. gbpat153.seq - Patent sequence entries, part 153.
1632. gbpat154.seq - Patent sequence entries, part 154.
1633. gbpat155.seq - Patent sequence entries, part 155.
1634. gbpat156.seq - Patent sequence entries, part 156.
1635. gbpat157.seq - Patent sequence entries, part 157.
1636. gbpat158.seq - Patent sequence entries, part 158.
1637. gbpat159.seq - Patent sequence entries, part 159.
1638. gbpat16.seq - Patent sequence entries, part 16.
1639. gbpat160.seq - Patent sequence entries, part 160.
1640. gbpat161.seq - Patent sequence entries, part 161.
1641. gbpat162.seq - Patent sequence entries, part 162.
1642. gbpat163.seq - Patent sequence entries, part 163.
1643. gbpat164.seq - Patent sequence entries, part 164.
1644. gbpat165.seq - Patent sequence entries, part 165.
1645. gbpat166.seq - Patent sequence entries, part 166.
1646. gbpat167.seq - Patent sequence entries, part 167.
1647. gbpat168.seq - Patent sequence entries, part 168.
1648. gbpat169.seq - Patent sequence entries, part 169.
1649. gbpat17.seq - Patent sequence entries, part 17.
1650. gbpat170.seq - Patent sequence entries, part 170.
1651. gbpat171.seq - Patent sequence entries, part 171.
1652. gbpat172.seq - Patent sequence entries, part 172.
1653. gbpat173.seq - Patent sequence entries, part 173.
1654. gbpat174.seq - Patent sequence entries, part 174.
1655. gbpat175.seq - Patent sequence entries, part 175.
1656. gbpat176.seq - Patent sequence entries, part 176.
1657. gbpat177.seq - Patent sequence entries, part 177.
1658. gbpat178.seq - Patent sequence entries, part 178.
1659. gbpat179.seq - Patent sequence entries, part 179.
1660. gbpat18.seq - Patent sequence entries, part 18.
1661. gbpat180.seq - Patent sequence entries, part 180.
1662. gbpat181.seq - Patent sequence entries, part 181.
1663. gbpat182.seq - Patent sequence entries, part 182.
1664. gbpat183.seq - Patent sequence entries, part 183.
1665. gbpat184.seq - Patent sequence entries, part 184.
1666. gbpat185.seq - Patent sequence entries, part 185.
1667. gbpat186.seq - Patent sequence entries, part 186.
1668. gbpat187.seq - Patent sequence entries, part 187.
1669. gbpat188.seq - Patent sequence entries, part 188.
1670. gbpat189.seq - Patent sequence entries, part 189.
1671. gbpat19.seq - Patent sequence entries, part 19.
1672. gbpat190.seq - Patent sequence entries, part 190.
1673. gbpat191.seq - Patent sequence entries, part 191.
1674. gbpat192.seq - Patent sequence entries, part 192.
1675. gbpat193.seq - Patent sequence entries, part 193.
1676. gbpat194.seq - Patent sequence entries, part 194.
1677. gbpat195.seq - Patent sequence entries, part 195.
1678. gbpat196.seq - Patent sequence entries, part 196.
1679. gbpat197.seq - Patent sequence entries, part 197.
1680. gbpat198.seq - Patent sequence entries, part 198.
1681. gbpat199.seq - Patent sequence entries, part 199.
1682. gbpat2.seq - Patent sequence entries, part 2.
1683. gbpat20.seq - Patent sequence entries, part 20.
1684. gbpat200.seq - Patent sequence entries, part 200.
1685. gbpat201.seq - Patent sequence entries, part 201.
1686. gbpat202.seq - Patent sequence entries, part 202.
1687. gbpat203.seq - Patent sequence entries, part 203.
1688. gbpat204.seq - Patent sequence entries, part 204.
1689. gbpat205.seq - Patent sequence entries, part 205.
1690. gbpat206.seq - Patent sequence entries, part 206.
1691. gbpat207.seq - Patent sequence entries, part 207.
1692. gbpat208.seq - Patent sequence entries, part 208.
1693. gbpat209.seq - Patent sequence entries, part 209.
1694. gbpat21.seq - Patent sequence entries, part 21.
1695. gbpat210.seq - Patent sequence entries, part 210.
1696. gbpat211.seq - Patent sequence entries, part 211.
1697. gbpat212.seq - Patent sequence entries, part 212.
1698. gbpat213.seq - Patent sequence entries, part 213.
1699. gbpat214.seq - Patent sequence entries, part 214.
1700. gbpat22.seq - Patent sequence entries, part 22.
1701. gbpat23.seq - Patent sequence entries, part 23.
1702. gbpat24.seq - Patent sequence entries, part 24.
1703. gbpat25.seq - Patent sequence entries, part 25.
1704. gbpat26.seq - Patent sequence entries, part 26.
1705. gbpat27.seq - Patent sequence entries, part 27.
1706. gbpat28.seq - Patent sequence entries, part 28.
1707. gbpat29.seq - Patent sequence entries, part 29.
1708. gbpat3.seq - Patent sequence entries, part 3.
1709. gbpat30.seq - Patent sequence entries, part 30.
1710. gbpat31.seq - Patent sequence entries, part 31.
1711. gbpat32.seq - Patent sequence entries, part 32.
1712. gbpat33.seq - Patent sequence entries, part 33.
1713. gbpat34.seq - Patent sequence entries, part 34.
1714. gbpat35.seq - Patent sequence entries, part 35.
1715. gbpat36.seq - Patent sequence entries, part 36.
1716. gbpat37.seq - Patent sequence entries, part 37.
1717. gbpat38.seq - Patent sequence entries, part 38.
1718. gbpat39.seq - Patent sequence entries, part 39.
1719. gbpat4.seq - Patent sequence entries, part 4.
1720. gbpat40.seq - Patent sequence entries, part 40.
1721. gbpat41.seq - Patent sequence entries, part 41.
1722. gbpat42.seq - Patent sequence entries, part 42.
1723. gbpat43.seq - Patent sequence entries, part 43.
1724. gbpat44.seq - Patent sequence entries, part 44.
1725. gbpat45.seq - Patent sequence entries, part 45.
1726. gbpat46.seq - Patent sequence entries, part 46.
1727. gbpat47.seq - Patent sequence entries, part 47.
1728. gbpat48.seq - Patent sequence entries, part 48.
1729. gbpat49.seq - Patent sequence entries, part 49.
1730. gbpat5.seq - Patent sequence entries, part 5.
1731. gbpat50.seq - Patent sequence entries, part 50.
1732. gbpat51.seq - Patent sequence entries, part 51.
1733. gbpat52.seq - Patent sequence entries, part 52.
1734. gbpat53.seq - Patent sequence entries, part 53.
1735. gbpat54.seq - Patent sequence entries, part 54.
1736. gbpat55.seq - Patent sequence entries, part 55.
1737. gbpat56.seq - Patent sequence entries, part 56.
1738. gbpat57.seq - Patent sequence entries, part 57.
1739. gbpat58.seq - Patent sequence entries, part 58.
1740. gbpat59.seq - Patent sequence entries, part 59.
1741. gbpat6.seq - Patent sequence entries, part 6.
1742. gbpat60.seq - Patent sequence entries, part 60.
1743. gbpat61.seq - Patent sequence entries, part 61.
1744. gbpat62.seq - Patent sequence entries, part 62.
1745. gbpat63.seq - Patent sequence entries, part 63.
1746. gbpat64.seq - Patent sequence entries, part 64.
1747. gbpat65.seq - Patent sequence entries, part 65.
1748. gbpat66.seq - Patent sequence entries, part 66.
1749. gbpat67.seq - Patent sequence entries, part 67.
1750. gbpat68.seq - Patent sequence entries, part 68.
1751. gbpat69.seq - Patent sequence entries, part 69.
1752. gbpat7.seq - Patent sequence entries, part 7.
1753. gbpat70.seq - Patent sequence entries, part 70.
1754. gbpat71.seq - Patent sequence entries, part 71.
1755. gbpat72.seq - Patent sequence entries, part 72.
1756. gbpat73.seq - Patent sequence entries, part 73.
1757. gbpat74.seq - Patent sequence entries, part 74.
1758. gbpat75.seq - Patent sequence entries, part 75.
1759. gbpat76.seq - Patent sequence entries, part 76.
1760. gbpat77.seq - Patent sequence entries, part 77.
1761. gbpat78.seq - Patent sequence entries, part 78.
1762. gbpat79.seq - Patent sequence entries, part 79.
1763. gbpat8.seq - Patent sequence entries, part 8.
1764. gbpat80.seq - Patent sequence entries, part 80.
1765. gbpat81.seq - Patent sequence entries, part 81.
1766. gbpat82.seq - Patent sequence entries, part 82.
1767. gbpat83.seq - Patent sequence entries, part 83.
1768. gbpat84.seq - Patent sequence entries, part 84.
1769. gbpat85.seq - Patent sequence entries, part 85.
1770. gbpat86.seq - Patent sequence entries, part 86.
1771. gbpat87.seq - Patent sequence entries, part 87.
1772. gbpat88.seq - Patent sequence entries, part 88.
1773. gbpat89.seq - Patent sequence entries, part 89.
1774. gbpat9.seq - Patent sequence entries, part 9.
1775. gbpat90.seq - Patent sequence entries, part 90.
1776. gbpat91.seq - Patent sequence entries, part 91.
1777. gbpat92.seq - Patent sequence entries, part 92.
1778. gbpat93.seq - Patent sequence entries, part 93.
1779. gbpat94.seq - Patent sequence entries, part 94.
1780. gbpat95.seq - Patent sequence entries, part 95.
1781. gbpat96.seq - Patent sequence entries, part 96.
1782. gbpat97.seq - Patent sequence entries, part 97.
1783. gbpat98.seq - Patent sequence entries, part 98.
1784. gbpat99.seq - Patent sequence entries, part 99.
1785. gbphg1.seq - Phage sequence entries, part 1.
1786. gbphg2.seq - Phage sequence entries, part 2.
1787. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1788. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1789. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1790. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1791. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1792. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1793. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1794. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1795. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1796. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1797. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1798. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1799. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1800. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1801. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1802. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1803. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1804. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1805. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1806. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1807. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1808. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1809. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1810. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1811. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1812. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1813. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1814. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1815. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1816. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1817. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1818. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1819. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1820. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1821. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1822. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1823. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1824. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1825. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1826. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1827. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1828. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1829. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1830. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1831. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1832. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1833. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1834. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1835. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1836. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1837. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1838. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1839. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1840. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1841. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1842. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1843. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
1844. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
1845. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
1846. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
1847. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
1848. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
1849. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
1850. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
1851. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
1852. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
1853. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1854. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
1855. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
1856. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
1857. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
1858. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
1859. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
1860. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
1861. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
1862. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
1863. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
1864. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1865. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
1866. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
1867. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
1868. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
1869. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
1870. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
1871. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
1872. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
1873. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
1874. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
1875. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1876. gbpri1.seq - Primate sequence entries, part 1.
1877. gbpri10.seq - Primate sequence entries, part 10.
1878. gbpri11.seq - Primate sequence entries, part 11.
1879. gbpri12.seq - Primate sequence entries, part 12.
1880. gbpri13.seq - Primate sequence entries, part 13.
1881. gbpri14.seq - Primate sequence entries, part 14.
1882. gbpri15.seq - Primate sequence entries, part 15.
1883. gbpri16.seq - Primate sequence entries, part 16.
1884. gbpri17.seq - Primate sequence entries, part 17.
1885. gbpri18.seq - Primate sequence entries, part 18.
1886. gbpri19.seq - Primate sequence entries, part 19.
1887. gbpri2.seq - Primate sequence entries, part 2.
1888. gbpri20.seq - Primate sequence entries, part 20.
1889. gbpri21.seq - Primate sequence entries, part 21.
1890. gbpri22.seq - Primate sequence entries, part 22.
1891. gbpri23.seq - Primate sequence entries, part 23.
1892. gbpri24.seq - Primate sequence entries, part 24.
1893. gbpri25.seq - Primate sequence entries, part 25.
1894. gbpri26.seq - Primate sequence entries, part 26.
1895. gbpri27.seq - Primate sequence entries, part 27.
1896. gbpri28.seq - Primate sequence entries, part 28.
1897. gbpri29.seq - Primate sequence entries, part 29.
1898. gbpri3.seq - Primate sequence entries, part 3.
1899. gbpri30.seq - Primate sequence entries, part 30.
1900. gbpri31.seq - Primate sequence entries, part 31.
1901. gbpri32.seq - Primate sequence entries, part 32.
1902. gbpri33.seq - Primate sequence entries, part 33.
1903. gbpri34.seq - Primate sequence entries, part 34.
1904. gbpri35.seq - Primate sequence entries, part 35.
1905. gbpri36.seq - Primate sequence entries, part 36.
1906. gbpri37.seq - Primate sequence entries, part 37.
1907. gbpri38.seq - Primate sequence entries, part 38.
1908. gbpri39.seq - Primate sequence entries, part 39.
1909. gbpri4.seq - Primate sequence entries, part 4.
1910. gbpri40.seq - Primate sequence entries, part 40.
1911. gbpri41.seq - Primate sequence entries, part 41.
1912. gbpri42.seq - Primate sequence entries, part 42.
1913. gbpri43.seq - Primate sequence entries, part 43.
1914. gbpri44.seq - Primate sequence entries, part 44.
1915. gbpri45.seq - Primate sequence entries, part 45.
1916. gbpri46.seq - Primate sequence entries, part 46.
1917. gbpri47.seq - Primate sequence entries, part 47.
1918. gbpri48.seq - Primate sequence entries, part 48.
1919. gbpri5.seq - Primate sequence entries, part 5.
1920. gbpri6.seq - Primate sequence entries, part 6.
1921. gbpri7.seq - Primate sequence entries, part 7.
1922. gbpri8.seq - Primate sequence entries, part 8.
1923. gbpri9.seq - Primate sequence entries, part 9.
1924. gbrel.txt - Release notes (this document).
1925. gbrod1.seq - Rodent sequence entries, part 1.
1926. gbrod10.seq - Rodent sequence entries, part 10.
1927. gbrod11.seq - Rodent sequence entries, part 11.
1928. gbrod12.seq - Rodent sequence entries, part 12.
1929. gbrod13.seq - Rodent sequence entries, part 13.
1930. gbrod14.seq - Rodent sequence entries, part 14.
1931. gbrod15.seq - Rodent sequence entries, part 15.
1932. gbrod16.seq - Rodent sequence entries, part 16.
1933. gbrod17.seq - Rodent sequence entries, part 17.
1934. gbrod18.seq - Rodent sequence entries, part 18.
1935. gbrod19.seq - Rodent sequence entries, part 19.
1936. gbrod2.seq - Rodent sequence entries, part 2.
1937. gbrod20.seq - Rodent sequence entries, part 20.
1938. gbrod21.seq - Rodent sequence entries, part 21.
1939. gbrod22.seq - Rodent sequence entries, part 22.
1940. gbrod23.seq - Rodent sequence entries, part 23.
1941. gbrod24.seq - Rodent sequence entries, part 24.
1942. gbrod25.seq - Rodent sequence entries, part 25.
1943. gbrod26.seq - Rodent sequence entries, part 26.
1944. gbrod27.seq - Rodent sequence entries, part 27.
1945. gbrod28.seq - Rodent sequence entries, part 28.
1946. gbrod29.seq - Rodent sequence entries, part 29.
1947. gbrod3.seq - Rodent sequence entries, part 3.
1948. gbrod30.seq - Rodent sequence entries, part 30.
1949. gbrod31.seq - Rodent sequence entries, part 31.
1950. gbrod4.seq - Rodent sequence entries, part 4.
1951. gbrod5.seq - Rodent sequence entries, part 5.
1952. gbrod6.seq - Rodent sequence entries, part 6.
1953. gbrod7.seq - Rodent sequence entries, part 7.
1954. gbrod8.seq - Rodent sequence entries, part 8.
1955. gbrod9.seq - Rodent sequence entries, part 9.
1956. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1957. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1958. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1959. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1960. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1961. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1962. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1963. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1964. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1965. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1966. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1967. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1968. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1969. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1970. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1971. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1972. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1973. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1974. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1975. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1976. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1977. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1978. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1979. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1980. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1981. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1982. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1983. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
1984. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1985. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1986. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
1987. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
1988. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
1989. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
1990. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
1991. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
1992. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
1993. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
1994. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
1995. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
1996. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1997. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
1998. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
1999. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2000. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2001. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2002. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2003. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2004. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2005. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2006. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2007. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2008. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2009. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2010. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2011. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2012. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2013. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2014. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2015. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2016. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2017. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2018. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2019. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2020. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2021. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2022. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2023. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2024. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2025. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2026. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2027. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2028. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2029. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2030. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2031. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2032. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2033. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2034. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2035. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2036. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2037. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2038. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2039. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2040. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2041. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2042. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2043. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2044. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2045. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2046. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2047. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2048. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2049. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2050. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2051. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2052. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2053. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2054. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2055. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2056. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2057. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2058. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2059. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2060. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2061. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2062. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2063. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2064. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2065. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2066. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2067. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2068. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2069. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2070. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2071. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2072. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2073. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2074. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2075. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2076. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2077. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2078. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2079. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2080. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2081. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2082. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2083. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2084. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2085. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2086. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2087. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2088. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2089. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2090. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2091. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2092. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2093. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2094. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2095. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2096. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2097. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2098. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2099. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2100. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2101. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2102. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2103. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2104. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2105. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2106. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2107. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2108. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2109. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2110. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2111. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2112. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2113. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2114. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2115. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2116. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2117. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2118. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2119. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2120. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2121. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2122. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2123. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2124. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2125. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2126. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2127. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2128. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2129. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2130. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2131. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2132. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2133. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2134. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2135. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2136. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2137. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2138. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2139. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2140. gbuna1.seq - Unannotated sequence entries, part 1.
2141. gbvrl1.seq - Viral sequence entries, part 1.
2142. gbvrl10.seq - Viral sequence entries, part 10.
2143. gbvrl11.seq - Viral sequence entries, part 11.
2144. gbvrl12.seq - Viral sequence entries, part 12.
2145. gbvrl13.seq - Viral sequence entries, part 13.
2146. gbvrl14.seq - Viral sequence entries, part 14.
2147. gbvrl15.seq - Viral sequence entries, part 15.
2148. gbvrl16.seq - Viral sequence entries, part 16.
2149. gbvrl17.seq - Viral sequence entries, part 17.
2150. gbvrl18.seq - Viral sequence entries, part 18.
2151. gbvrl19.seq - Viral sequence entries, part 19.
2152. gbvrl2.seq - Viral sequence entries, part 2.
2153. gbvrl20.seq - Viral sequence entries, part 20.
2154. gbvrl21.seq - Viral sequence entries, part 21.
2155. gbvrl22.seq - Viral sequence entries, part 22.
2156. gbvrl23.seq - Viral sequence entries, part 23.
2157. gbvrl24.seq - Viral sequence entries, part 24.
2158. gbvrl25.seq - Viral sequence entries, part 25.
2159. gbvrl26.seq - Viral sequence entries, part 26.
2160. gbvrl27.seq - Viral sequence entries, part 27.
2161. gbvrl28.seq - Viral sequence entries, part 28.
2162. gbvrl29.seq - Viral sequence entries, part 29.
2163. gbvrl3.seq - Viral sequence entries, part 3.
2164. gbvrl30.seq - Viral sequence entries, part 30.
2165. gbvrl31.seq - Viral sequence entries, part 31.
2166. gbvrl32.seq - Viral sequence entries, part 32.
2167. gbvrl4.seq - Viral sequence entries, part 4.
2168. gbvrl5.seq - Viral sequence entries, part 5.
2169. gbvrl6.seq - Viral sequence entries, part 6.
2170. gbvrl7.seq - Viral sequence entries, part 7.
2171. gbvrl8.seq - Viral sequence entries, part 8.
2172. gbvrl9.seq - Viral sequence entries, part 9.
2173. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2174. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2175. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2176. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2177. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2178. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2179. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2180. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2181. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2182. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2183. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2184. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2185. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2186. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2187. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2188. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2189. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2190. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2191. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2192. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2193. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2194. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2195. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2196. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2197. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2198. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2199. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2200. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2201. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2202. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2203. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2204. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2205. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2206. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2207. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2208. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2209. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2210. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2211. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2212. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2213. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2214. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2215. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2216. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 204.0 flatfiles require roughly 680 GB (sequence
files only) or 680 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249998416     gbbct1.seq
 245851426     gbbct10.seq
 249825095     gbbct100.seq
 247991421     gbbct101.seq
 249160506     gbbct102.seq
 247775721     gbbct103.seq
 249024992     gbbct104.seq
 244510996     gbbct105.seq
 245527641     gbbct106.seq
 245896210     gbbct107.seq
 247035349     gbbct108.seq
 237089429     gbbct109.seq
 248280305     gbbct11.seq
 242501059     gbbct110.seq
 248262268     gbbct111.seq
 231297409     gbbct112.seq
 249589372     gbbct113.seq
 245729668     gbbct114.seq
 244414141     gbbct115.seq
 249026952     gbbct116.seq
 245513265     gbbct117.seq
 228104988     gbbct118.seq
 240237112     gbbct119.seq
 239030029     gbbct12.seq
  70390280     gbbct120.seq
   6857172     gbbct121.seq
  14216723     gbbct122.seq
  23073217     gbbct123.seq
  45142453     gbbct124.seq
  87843943     gbbct125.seq
 170613716     gbbct126.seq
 249997239     gbbct127.seq
 249998907     gbbct128.seq
 246963035     gbbct129.seq
 249307423     gbbct13.seq
 240377711     gbbct130.seq
 245711966     gbbct131.seq
 243539339     gbbct132.seq
 247364890     gbbct133.seq
 244126869     gbbct134.seq
 249846228     gbbct135.seq
 206870073     gbbct136.seq
 246526076     gbbct137.seq
 243911309     gbbct138.seq
 247196012     gbbct139.seq
 233150734     gbbct14.seq
 243767664     gbbct140.seq
 248202909     gbbct141.seq
 249998520     gbbct142.seq
 249952456     gbbct143.seq
 123868126     gbbct144.seq
 249998283     gbbct145.seq
 249998375     gbbct146.seq
 249999663     gbbct147.seq
 250000195     gbbct148.seq
 249831470     gbbct149.seq
 248607093     gbbct15.seq
 249843409     gbbct150.seq
 249998858     gbbct151.seq
  87787127     gbbct152.seq
 249983333     gbbct16.seq
  38573630     gbbct17.seq
 243373896     gbbct18.seq
 249805318     gbbct19.seq
 248280072     gbbct2.seq
 248179158     gbbct20.seq
 249687477     gbbct21.seq
 244053543     gbbct22.seq
 245379639     gbbct23.seq
 242877215     gbbct24.seq
 239679042     gbbct25.seq
 217808916     gbbct26.seq
 242805532     gbbct27.seq
 245839152     gbbct28.seq
 248681194     gbbct29.seq
 241611501     gbbct3.seq
 247877670     gbbct30.seq
 249390875     gbbct31.seq
 244189795     gbbct32.seq
 247339454     gbbct33.seq
 249984621     gbbct34.seq
 249765495     gbbct35.seq
 240948954     gbbct36.seq
 244795547     gbbct37.seq
 249622093     gbbct38.seq
 165336566     gbbct39.seq
 247577782     gbbct4.seq
 247451396     gbbct40.seq
 246942323     gbbct41.seq
 248190526     gbbct42.seq
 246579110     gbbct43.seq
 241884975     gbbct44.seq
 246673305     gbbct45.seq
 249205760     gbbct46.seq
 248558986     gbbct47.seq
 246965565     gbbct48.seq
 241585305     gbbct49.seq
 249954729     gbbct5.seq
 244262699     gbbct50.seq
 244110441     gbbct51.seq
  49416928     gbbct52.seq
 244557955     gbbct53.seq
 245263873     gbbct54.seq
 239704300     gbbct55.seq
 247755718     gbbct56.seq
 246180752     gbbct57.seq
 248412149     gbbct58.seq
 249740778     gbbct59.seq
  43046304     gbbct6.seq
 245870589     gbbct60.seq
 243727856     gbbct61.seq
 248372668     gbbct62.seq
 241768304     gbbct63.seq
 247581027     gbbct64.seq
 249503295     gbbct65.seq
  63783016     gbbct66.seq
 248766382     gbbct67.seq
 248625265     gbbct68.seq
 249954114     gbbct69.seq
 249482812     gbbct7.seq
 246141890     gbbct70.seq
 242884155     gbbct71.seq
 248837366     gbbct72.seq
 246313810     gbbct73.seq
 237679931     gbbct74.seq
 245855526     gbbct75.seq
 245592095     gbbct76.seq
 249681583     gbbct77.seq
 239324835     gbbct78.seq
 249917649     gbbct79.seq
 249604525     gbbct8.seq
  39567047     gbbct80.seq
 249376496     gbbct81.seq
 248978923     gbbct82.seq
 241433662     gbbct83.seq
 249241818     gbbct84.seq
 241358169     gbbct85.seq
 249631496     gbbct86.seq
 239414913     gbbct87.seq
 249223722     gbbct88.seq
 208919245     gbbct89.seq
 227663050     gbbct9.seq
 249395348     gbbct90.seq
 247645724     gbbct91.seq
 249277941     gbbct92.seq
 249702594     gbbct93.seq
 239130725     gbbct94.seq
 229846487     gbbct95.seq
 247905273     gbbct96.seq
 242112590     gbbct97.seq
 242496339     gbbct98.seq
 245856501     gbbct99.seq
   8227171     gbchg.txt
 249999182     gbcon1.seq
 249996065     gbcon10.seq
 249998566     gbcon100.seq
 249998527     gbcon101.seq
 249996033     gbcon102.seq
 249999285     gbcon103.seq
 135141019     gbcon104.seq
 249999018     gbcon105.seq
 249995506     gbcon106.seq
 249999938     gbcon107.seq
 249996196     gbcon108.seq
 249994668     gbcon109.seq
 248990840     gbcon11.seq
 158184767     gbcon110.seq
 249997662     gbcon111.seq
 249996981     gbcon112.seq
 249998026     gbcon113.seq
 236167379     gbcon114.seq
 212024720     gbcon115.seq
 249999151     gbcon116.seq
 249991357     gbcon117.seq
 249995392     gbcon118.seq
 249992414     gbcon119.seq
 247445060     gbcon12.seq
  78868706     gbcon120.seq
 249996287     gbcon121.seq
 250000069     gbcon122.seq
 249999668     gbcon123.seq
  26960219     gbcon124.seq
 204215159     gbcon125.seq
 249462020     gbcon126.seq
 249929266     gbcon127.seq
 249999222     gbcon128.seq
 249994754     gbcon129.seq
 239943468     gbcon13.seq
 249996326     gbcon130.seq
 201291001     gbcon131.seq
 249998604     gbcon132.seq
 249664036     gbcon133.seq
 248606553     gbcon134.seq
 249867670     gbcon135.seq
 249997253     gbcon136.seq
 249864807     gbcon137.seq
 249996495     gbcon138.seq
 140500269     gbcon139.seq
 246296079     gbcon14.seq
 249999239     gbcon140.seq
 249952816     gbcon141.seq
 249997108     gbcon142.seq
 249999017     gbcon143.seq
 249999983     gbcon144.seq
 249999802     gbcon145.seq
 249999966     gbcon146.seq
 249998614     gbcon147.seq
 236469340     gbcon148.seq
 249999817     gbcon149.seq
 246150253     gbcon15.seq
 249999198     gbcon150.seq
 249999434     gbcon151.seq
 249976250     gbcon152.seq
 249544964     gbcon153.seq
 249999860     gbcon154.seq
 249987355     gbcon155.seq
 250000100     gbcon156.seq
 249998133     gbcon157.seq
 249999266     gbcon158.seq
 249907168     gbcon159.seq
 249998119     gbcon16.seq
 249970119     gbcon160.seq
 249935378     gbcon161.seq
  53261293     gbcon162.seq
 249999135     gbcon163.seq
 249994297     gbcon164.seq
 249999781     gbcon165.seq
 249998032     gbcon166.seq
 249851804     gbcon167.seq
 191624945     gbcon168.seq
 249996408     gbcon169.seq
  84098709     gbcon17.seq
 249995596     gbcon170.seq
 249999106     gbcon171.seq
 250000234     gbcon172.seq
 249899962     gbcon173.seq
 249999614     gbcon174.seq
 249791178     gbcon175.seq
 249959454     gbcon176.seq
 249918303     gbcon177.seq
 250000230     gbcon178.seq
  69062775     gbcon179.seq
 249993313     gbcon18.seq
 248961058     gbcon180.seq
 249974453     gbcon181.seq
 249996571     gbcon182.seq
 249966213     gbcon183.seq
 249999682     gbcon184.seq
 249996735     gbcon185.seq
 166248185     gbcon186.seq
 249803138     gbcon187.seq
 249999617     gbcon188.seq
 249998001     gbcon189.seq
 249998710     gbcon19.seq
 249999505     gbcon190.seq
 246898533     gbcon191.seq
 249962598     gbcon192.seq
 249996665     gbcon193.seq
 249917862     gbcon194.seq
 249817953     gbcon195.seq
 249995418     gbcon196.seq
 249990737     gbcon197.seq
 249934058     gbcon198.seq
 249999797     gbcon199.seq
 247068110     gbcon2.seq
 249998215     gbcon20.seq
  96493198     gbcon200.seq
 249998885     gbcon201.seq
 249999422     gbcon202.seq
 249999751     gbcon203.seq
 249998203     gbcon204.seq
 178583557     gbcon205.seq
 250000110     gbcon206.seq
 249999468     gbcon207.seq
 249999605     gbcon208.seq
 249999663     gbcon209.seq
 249996792     gbcon21.seq
 138364205     gbcon210.seq
 249998205     gbcon211.seq
 249977818     gbcon212.seq
 249934091     gbcon213.seq
 249999094     gbcon214.seq
 249998675     gbcon215.seq
 148490004     gbcon216.seq
 249998051     gbcon217.seq
 250000153     gbcon218.seq
 249998940     gbcon219.seq
 247468667     gbcon22.seq
 249991480     gbcon220.seq
 249975179     gbcon221.seq
 249991469     gbcon222.seq
 144645043     gbcon223.seq
 249998257     gbcon224.seq
 249994642     gbcon225.seq
 249999210     gbcon226.seq
 249998808     gbcon227.seq
 219065861     gbcon228.seq
 249998544     gbcon229.seq
 249998820     gbcon23.seq
 249990146     gbcon230.seq
 250000040     gbcon231.seq
 249999767     gbcon232.seq
 179469134     gbcon233.seq
 249968401     gbcon234.seq
 249998577     gbcon235.seq
 249997241     gbcon236.seq
 249998899     gbcon237.seq
 249999609     gbcon238.seq
 249896078     gbcon239.seq
 161393281     gbcon24.seq
  21914257     gbcon240.seq
 249996911     gbcon241.seq
 249348437     gbcon242.seq
 249998977     gbcon243.seq
 249999733     gbcon244.seq
 250000249     gbcon245.seq
 249752769     gbcon246.seq
 249983180     gbcon247.seq
 249997556     gbcon248.seq
 115657596     gbcon249.seq
 249996485     gbcon25.seq
 249997695     gbcon250.seq
 250000013     gbcon251.seq
 249762527     gbcon252.seq
 249999967     gbcon253.seq
 249998801     gbcon254.seq
 134417802     gbcon255.seq
 249999438     gbcon256.seq
 249850771     gbcon257.seq
 249915758     gbcon258.seq
 249999930     gbcon259.seq
 249150042     gbcon26.seq
 249902994     gbcon260.seq
 249999730     gbcon261.seq
 187534816     gbcon262.seq
 249999962     gbcon263.seq
 249996982     gbcon264.seq
 249987927     gbcon265.seq
 249999373     gbcon266.seq
 249997672     gbcon267.seq
 249998498     gbcon268.seq
 249997474     gbcon269.seq
  98910480     gbcon27.seq
  28572248     gbcon270.seq
 249999022     gbcon271.seq
 249842444     gbcon272.seq
 249999349     gbcon273.seq
 249985583     gbcon274.seq
 249999832     gbcon275.seq
 150631860     gbcon276.seq
 249999610     gbcon277.seq
 249995401     gbcon278.seq
 249999562     gbcon279.seq
 249999898     gbcon28.seq
 249941354     gbcon280.seq
 249995345     gbcon281.seq
 249999123     gbcon282.seq
 249969830     gbcon283.seq
 249999890     gbcon284.seq
   3865460     gbcon285.seq
  18874846     gbcon286.seq
  79021519     gbcon29.seq
 249684570     gbcon3.seq
 249993709     gbcon30.seq
 249999604     gbcon31.seq
 249998520     gbcon32.seq
 249998223     gbcon33.seq
 152436386     gbcon34.seq
 249998917     gbcon35.seq
 249996531     gbcon36.seq
 249997326     gbcon37.seq
 249998915     gbcon38.seq
 249999856     gbcon39.seq
 249994143     gbcon4.seq
 212311652     gbcon40.seq
 249997270     gbcon41.seq
 249999221     gbcon42.seq
 249994732     gbcon43.seq
 249996897     gbcon44.seq
 249997078     gbcon45.seq
 249997414     gbcon46.seq
  63412389     gbcon47.seq
 249995423     gbcon48.seq
 249997315     gbcon49.seq
 249996941     gbcon5.seq
 249997250     gbcon50.seq
 249997590     gbcon51.seq
 249996159     gbcon52.seq
  44928861     gbcon53.seq
 249994872     gbcon54.seq
 249995799     gbcon55.seq
 249997684     gbcon56.seq
 249996690     gbcon57.seq
 249997782     gbcon58.seq
  38241897     gbcon59.seq
 249994471     gbcon6.seq
 249998302     gbcon60.seq
 249999150     gbcon61.seq
 249998346     gbcon62.seq
 249994564     gbcon63.seq
 249999492     gbcon64.seq
 154672375     gbcon65.seq
 249999016     gbcon66.seq
 249996777     gbcon67.seq
 249999159     gbcon68.seq
 249995190     gbcon69.seq
  95900919     gbcon7.seq
 185611272     gbcon70.seq
 249996810     gbcon71.seq
 249998700     gbcon72.seq
 249997155     gbcon73.seq
 249997874     gbcon74.seq
 247616447     gbcon75.seq
 249998269     gbcon76.seq
 249995941     gbcon77.seq
 249998068     gbcon78.seq
 249999277     gbcon79.seq
 249993190     gbcon8.seq
 249999797     gbcon80.seq
  98773033     gbcon81.seq
 249997150     gbcon82.seq
 249997442     gbcon83.seq
 249995516     gbcon84.seq
 249996111     gbcon85.seq
 249995971     gbcon86.seq
  64633499     gbcon87.seq
 249998451     gbcon88.seq
 249995859     gbcon89.seq
 249997980     gbcon9.seq
 249994386     gbcon90.seq
 249994858     gbcon91.seq
 249998199     gbcon92.seq
  23638323     gbcon93.seq
 249997115     gbcon94.seq
 249995538     gbcon95.seq
 249998987     gbcon96.seq
 249999150     gbcon97.seq
 199759401     gbcon98.seq
 249994089     gbcon99.seq
   3864945     gbdel.txt
 249998379     gbenv1.seq
 249999048     gbenv10.seq
 249997364     gbenv11.seq
  60943774     gbenv12.seq
 249998958     gbenv13.seq
 250000051     gbenv14.seq
 249998521     gbenv15.seq
 249999719     gbenv16.seq
 249999434     gbenv17.seq
 249999659     gbenv18.seq
 249997958     gbenv19.seq
 249999772     gbenv2.seq
 237492933     gbenv20.seq
 249997353     gbenv21.seq
 250000228     gbenv22.seq
 249999858     gbenv23.seq
 249999882     gbenv24.seq
 165974454     gbenv25.seq
 249998562     gbenv26.seq
 249943002     gbenv27.seq
 249999813     gbenv28.seq
 249999809     gbenv29.seq
 249999481     gbenv3.seq
 249938894     gbenv30.seq
 249999285     gbenv31.seq
  49570614     gbenv32.seq
 249999624     gbenv33.seq
 249998423     gbenv34.seq
 249998389     gbenv35.seq
 249997960     gbenv36.seq
 187650019     gbenv37.seq
 249998788     gbenv38.seq
 249999446     gbenv39.seq
 250000191     gbenv4.seq
 249997834     gbenv40.seq
 249998412     gbenv41.seq
 249999431     gbenv42.seq
 249996509     gbenv43.seq
  52807773     gbenv44.seq
 249998807     gbenv45.seq
 250000167     gbenv46.seq
 250000173     gbenv47.seq
 249997721     gbenv48.seq
 198527762     gbenv49.seq
 249998637     gbenv5.seq
 249997816     gbenv50.seq
 249996549     gbenv51.seq
 250000183     gbenv52.seq
 249998392     gbenv53.seq
 249999526     gbenv54.seq
  88533554     gbenv55.seq
 249997555     gbenv56.seq
 249997298     gbenv57.seq
 249997575     gbenv58.seq
 249997682     gbenv59.seq
 249998861     gbenv6.seq
 249999924     gbenv60.seq
 110899537     gbenv61.seq
 249999721     gbenv62.seq
 249999243     gbenv63.seq
 249999644     gbenv64.seq
 249999714     gbenv65.seq
 249999770     gbenv66.seq
  73248907     gbenv67.seq
 249999079     gbenv68.seq
 249998306     gbenv69.seq
 193011518     gbenv7.seq
 249999454     gbenv70.seq
 249999198     gbenv71.seq
 249999352     gbenv72.seq
 249998223     gbenv73.seq
 249998410     gbenv74.seq
 249999756     gbenv75.seq
   2609116     gbenv76.seq
 249998942     gbenv8.seq
 249999461     gbenv9.seq
 524289247     gbest1.seq
 524289440     gbest10.seq
 524291200     gbest100.seq
 524289166     gbest101.seq
 524289673     gbest102.seq
 524291282     gbest103.seq
 356683071     gbest104.seq
 524290437     gbest105.seq
 524289339     gbest106.seq
 524289091     gbest107.seq
 382495623     gbest108.seq
 386199317     gbest109.seq
 524292170     gbest11.seq
 380000377     gbest110.seq
 380752638     gbest111.seq
 377684575     gbest112.seq
 381798873     gbest113.seq
 385867030     gbest114.seq
 385245866     gbest115.seq
 384104737     gbest116.seq
 380304263     gbest117.seq
 403271343     gbest118.seq
 478950522     gbest119.seq
 524289958     gbest12.seq
 524289473     gbest120.seq
 524289184     gbest121.seq
 524291210     gbest122.seq
 524288958     gbest123.seq
 471063028     gbest124.seq
 524289237     gbest125.seq
 524291852     gbest126.seq
 524291582     gbest127.seq
 524288906     gbest128.seq
 524291058     gbest129.seq
 144741510     gbest13.seq
 524290655     gbest130.seq
 524290261     gbest131.seq
 524290645     gbest132.seq
 524290389     gbest133.seq
 524291391     gbest134.seq
 524291543     gbest135.seq
 524290512     gbest136.seq
 281016472     gbest137.seq
 524290711     gbest138.seq
 524288980     gbest139.seq
 524290352     gbest14.seq
 524291777     gbest140.seq
 524289081     gbest141.seq
 524293539     gbest142.seq
 524290094     gbest143.seq
 524290845     gbest144.seq
 524289723     gbest145.seq
 524292676     gbest146.seq
 524289743     gbest147.seq
 524292214     gbest148.seq
 524288936     gbest149.seq
 524289327     gbest15.seq
 524290130     gbest150.seq
 458618511     gbest151.seq
 524289814     gbest152.seq
 524291743     gbest153.seq
 524291197     gbest154.seq
 524291300     gbest155.seq
 524289714     gbest156.seq
 524290826     gbest157.seq
 524289654     gbest158.seq
 524290570     gbest159.seq
 524290349     gbest16.seq
 524291970     gbest160.seq
 524288801     gbest161.seq
 524289788     gbest162.seq
 524289876     gbest163.seq
 227685855     gbest164.seq
 524291206     gbest165.seq
 524290499     gbest166.seq
 524289083     gbest167.seq
 524292518     gbest168.seq
 524289982     gbest169.seq
 524289043     gbest17.seq
 524289625     gbest170.seq
 524290891     gbest171.seq
 524292552     gbest172.seq
 524289802     gbest173.seq
 524289598     gbest174.seq
 524289237     gbest175.seq
 524289629     gbest176.seq
 524288989     gbest177.seq
  92781268     gbest178.seq
 524289937     gbest179.seq
 524289999     gbest18.seq
 524288884     gbest180.seq
 524289563     gbest181.seq
 524290237     gbest182.seq
 524289505     gbest183.seq
 524291086     gbest184.seq
 524289928     gbest185.seq
 524291239     gbest186.seq
 524290868     gbest187.seq
 524289010     gbest188.seq
 524288834     gbest189.seq
 524291952     gbest19.seq
 524289233     gbest190.seq
 455901876     gbest191.seq
 524292321     gbest192.seq
 524289721     gbest193.seq
 524290141     gbest194.seq
 524292269     gbest195.seq
 524288725     gbest196.seq
 524289224     gbest197.seq
 524289120     gbest198.seq
 524289669     gbest199.seq
 524289009     gbest2.seq
 524289348     gbest20.seq
 524291385     gbest200.seq
 524291290     gbest201.seq
 524288891     gbest202.seq
 524291393     gbest203.seq
 524290215     gbest204.seq
  53968888     gbest205.seq
 524290496     gbest206.seq
 524288928     gbest207.seq
 524291218     gbest208.seq
 524289398     gbest209.seq
 524288866     gbest21.seq
 524289227     gbest210.seq
 524290269     gbest211.seq
 524291410     gbest212.seq
 524293295     gbest213.seq
 524288897     gbest214.seq
 524290211     gbest215.seq
 483968376     gbest216.seq
 524291175     gbest217.seq
 524289746     gbest218.seq
 524289760     gbest219.seq
 494291034     gbest22.seq
 524290492     gbest220.seq
 524289606     gbest221.seq
 524294737     gbest222.seq
 524290083     gbest223.seq
 524290603     gbest224.seq
 524289981     gbest225.seq
 524290260     gbest226.seq
 524291974     gbest227.seq
 524289901     gbest228.seq
 458837841     gbest229.seq
 491090997     gbest23.seq
 524291308     gbest230.seq
 524289057     gbest231.seq
 524292249     gbest232.seq
 524289329     gbest233.seq
 524290119     gbest234.seq
 524290200     gbest235.seq
 524292095     gbest236.seq
 524289882     gbest237.seq
 524289938     gbest238.seq
 524291919     gbest239.seq
 502295410     gbest24.seq
 524289439     gbest240.seq
 524291550     gbest241.seq
 524291055     gbest242.seq
 524289923     gbest243.seq
 237407001     gbest244.seq
 524290467     gbest245.seq
 524291717     gbest246.seq
 524291357     gbest247.seq
 524289024     gbest248.seq
 524292593     gbest249.seq
 329610793     gbest25.seq
 524290485     gbest250.seq
 524290142     gbest251.seq
 510467931     gbest252.seq
 524289420     gbest253.seq
 524288978     gbest254.seq
 524290983     gbest255.seq
 332558079     gbest256.seq
 524291611     gbest257.seq
 524290305     gbest258.seq
 524289342     gbest259.seq
 524290540     gbest26.seq
 524289873     gbest260.seq
 524290659     gbest261.seq
 524289145     gbest262.seq
 524289776     gbest263.seq
 524289656     gbest264.seq
 524288887     gbest265.seq
 524289990     gbest266.seq
 217781309     gbest267.seq
 524291504     gbest268.seq
 524288946     gbest269.seq
 524289854     gbest27.seq
 524288992     gbest270.seq
 524290938     gbest271.seq
 524289242     gbest272.seq
 524291101     gbest273.seq
 524289169     gbest274.seq
 524292695     gbest275.seq
 524290869     gbest276.seq
 524289313     gbest277.seq
 524291725     gbest278.seq
 356897027     gbest279.seq
 524291759     gbest28.seq
 524290512     gbest280.seq
 524289425     gbest281.seq
 524292080     gbest282.seq
 524289142     gbest283.seq
 524288821     gbest284.seq
 524289777     gbest285.seq
 524289983     gbest286.seq
 524289326     gbest287.seq
 524290332     gbest288.seq
 524292337     gbest289.seq
 524293816     gbest29.seq
 524290188     gbest290.seq
 280335066     gbest291.seq
 524291969     gbest292.seq
 524291047     gbest293.seq
 524288821     gbest294.seq
 524290708     gbest295.seq
 524290440     gbest296.seq
 524289242     gbest297.seq
 524289147     gbest298.seq
 524290824     gbest299.seq
 488098562     gbest3.seq
 524290529     gbest30.seq
 524290797     gbest300.seq
 524290944     gbest301.seq
 469535310     gbest302.seq
 329459886     gbest303.seq
 475762885     gbest304.seq
 472164000     gbest305.seq
 524289677     gbest306.seq
 524291449     gbest307.seq
 524289991     gbest308.seq
 524291830     gbest309.seq
 524291112     gbest31.seq
 524289529     gbest310.seq
 524290669     gbest311.seq
 524290754     gbest312.seq
 524289442     gbest313.seq
 524288828     gbest314.seq
 524290574     gbest315.seq
 387683543     gbest316.seq
 524290934     gbest317.seq
 524291143     gbest318.seq
 524290719     gbest319.seq
 524292160     gbest32.seq
 524290889     gbest320.seq
 524291480     gbest321.seq
 524291469     gbest322.seq
 524288749     gbest323.seq
 524290957     gbest324.seq
 524291508     gbest325.seq
 524289534     gbest326.seq
 524291107     gbest327.seq
 517359530     gbest328.seq
 516149609     gbest329.seq
 524288735     gbest33.seq
 222955497     gbest330.seq
 524290167     gbest331.seq
 524289017     gbest332.seq
 524288794     gbest333.seq
 524288871     gbest334.seq
 524289757     gbest335.seq
 524289880     gbest336.seq
 495799246     gbest337.seq
 524291330     gbest338.seq
 524291762     gbest339.seq
 508783936     gbest34.seq
 524292414     gbest340.seq
 524289999     gbest341.seq
 524289934     gbest342.seq
 524292735     gbest343.seq
 323865798     gbest344.seq
 524290648     gbest345.seq
 524291967     gbest346.seq
 524289268     gbest347.seq
 524288758     gbest348.seq
 524289881     gbest349.seq
 486379361     gbest35.seq
 524290173     gbest350.seq
 510461827     gbest351.seq
 524290385     gbest352.seq
 524294030     gbest353.seq
 524293117     gbest354.seq
 524290642     gbest355.seq
 524292596     gbest356.seq
 524290469     gbest357.seq
 524291668     gbest358.seq
 150708146     gbest359.seq
 488137814     gbest36.seq
 524291159     gbest360.seq
 524292806     gbest361.seq
 524290540     gbest362.seq
 524288818     gbest363.seq
 524288993     gbest364.seq
 524289249     gbest365.seq
 524291389     gbest366.seq
 524289018     gbest367.seq
 524290332     gbest368.seq
 524289101     gbest369.seq
 486980107     gbest37.seq
 524289772     gbest370.seq
  24302028     gbest371.seq
 524289303     gbest372.seq
 524291156     gbest373.seq
 524293772     gbest374.seq
 524289689     gbest375.seq
 524289710     gbest376.seq
 524289554     gbest377.seq
 465186382     gbest378.seq
 524289239     gbest379.seq
 481669828     gbest38.seq
 524289310     gbest380.seq
 524289434     gbest381.seq
 524290648     gbest382.seq
 293308036     gbest383.seq
 524289458     gbest384.seq
 524290405     gbest385.seq
 524289780     gbest386.seq
 524291094     gbest387.seq
 524289867     gbest388.seq
 524291076     gbest389.seq
 485732866     gbest39.seq
 524288744     gbest390.seq
 524290269     gbest391.seq
 524290193     gbest392.seq
 524289505     gbest393.seq
 195792879     gbest394.seq
 524291252     gbest395.seq
 524288728     gbest396.seq
 524291979     gbest397.seq
 524289726     gbest398.seq
 524289588     gbest399.seq
 524290960     gbest4.seq
 132392056     gbest40.seq
 524291809     gbest400.seq
 524290896     gbest401.seq
 524290745     gbest402.seq
 524290622     gbest403.seq
 524290069     gbest404.seq
 524290971     gbest405.seq
 524289317     gbest406.seq
 509160383     gbest407.seq
 524290834     gbest408.seq
 524288781     gbest409.seq
 524288883     gbest41.seq
 524289962     gbest410.seq
 524289667     gbest411.seq
 524291148     gbest412.seq
 524291587     gbest413.seq
 524289118     gbest414.seq
 524292611     gbest415.seq
 524291017     gbest416.seq
 524289640     gbest417.seq
 524292070     gbest418.seq
 524289912     gbest419.seq
 524162079     gbest42.seq
 492698594     gbest420.seq
 524289704     gbest421.seq
 524289301     gbest422.seq
 524291087     gbest423.seq
 524288970     gbest424.seq
 524292194     gbest425.seq
 524290620     gbest426.seq
 524292343     gbest427.seq
 524292528     gbest428.seq
 524290247     gbest429.seq
 524290579     gbest43.seq
 524289514     gbest430.seq
 524289994     gbest431.seq
 524289166     gbest432.seq
 524289648     gbest433.seq
 524290119     gbest434.seq
 127560511     gbest435.seq
 524291316     gbest436.seq
 524293105     gbest437.seq
 524289317     gbest438.seq
 524289559     gbest439.seq
 524289401     gbest44.seq
 524291073     gbest440.seq
 524291131     gbest441.seq
 524289122     gbest442.seq
 524291389     gbest443.seq
 524289488     gbest444.seq
 524289256     gbest445.seq
 524290541     gbest446.seq
 524289594     gbest447.seq
 193964026     gbest448.seq
 524290626     gbest449.seq
 524288862     gbest45.seq
 524290088     gbest450.seq
 524289058     gbest451.seq
 524290485     gbest452.seq
 524291138     gbest453.seq
 524290288     gbest454.seq
 524289386     gbest455.seq
 524289287     gbest456.seq
 524289281     gbest457.seq
 524290140     gbest458.seq
 382519201     gbest459.seq
 524289103     gbest46.seq
 524289288     gbest460.seq
 524289060     gbest461.seq
 524289125     gbest462.seq
 524290248     gbest463.seq
 524292370     gbest464.seq
 524291370     gbest465.seq
 524292368     gbest466.seq
 524290714     gbest467.seq
 524289148     gbest468.seq
 524290983     gbest469.seq
 524289066     gbest47.seq
 524289128     gbest470.seq
 459756455     gbest471.seq
 524290897     gbest472.seq
 524291697     gbest473.seq
 524290397     gbest474.seq
 524289658     gbest475.seq
 524290768     gbest476.seq
  22046901     gbest477.seq
 524291772     gbest48.seq
 524291712     gbest49.seq
 524289238     gbest5.seq
 524291366     gbest50.seq
 524291637     gbest51.seq
 524288961     gbest52.seq
 524290221     gbest53.seq
 232014070     gbest54.seq
 524290313     gbest55.seq
 524288798     gbest56.seq
 524290179     gbest57.seq
 524291688     gbest58.seq
 524290794     gbest59.seq
 524290797     gbest6.seq
 524290812     gbest60.seq
 524289973     gbest61.seq
 524291497     gbest62.seq
 524288834     gbest63.seq
 524289929     gbest64.seq
 524289948     gbest65.seq
 524288919     gbest66.seq
 443314988     gbest67.seq
 524291549     gbest68.seq
 524290445     gbest69.seq
 524289370     gbest7.seq
 524289692     gbest70.seq
 524289689     gbest71.seq
 524290418     gbest72.seq
 524291530     gbest73.seq
 524290852     gbest74.seq
 524291679     gbest75.seq
 524293992     gbest76.seq
 524289047     gbest77.seq
 524288816     gbest78.seq
 524288774     gbest79.seq
 524289573     gbest8.seq
 159225979     gbest80.seq
 524289959     gbest81.seq
 524288935     gbest82.seq
 524289536     gbest83.seq
 524290949     gbest84.seq
 524289962     gbest85.seq
 524290073     gbest86.seq
 524291144     gbest87.seq
 524288971     gbest88.seq
 524290253     gbest89.seq
 524289277     gbest9.seq
 524290116     gbest90.seq
 524291524     gbest91.seq
 444656708     gbest92.seq
 524288864     gbest93.seq
 524290543     gbest94.seq
 524289045     gbest95.seq
 524292799     gbest96.seq
 524290428     gbest97.seq
 524289993     gbest98.seq
 524290471     gbest99.seq
 524289359     gbgss1.seq
 524291395     gbgss10.seq
 524291969     gbgss100.seq
 524291063     gbgss101.seq
 524290739     gbgss102.seq
 524290507     gbgss103.seq
 410689889     gbgss104.seq
 524291589     gbgss105.seq
 524289563     gbgss106.seq
 524290284     gbgss107.seq
 524290764     gbgss108.seq
 524289068     gbgss109.seq
 524290026     gbgss11.seq
 524289872     gbgss110.seq
 524291106     gbgss111.seq
 524290265     gbgss112.seq
 524289340     gbgss113.seq
 524290530     gbgss114.seq
 524289109     gbgss115.seq
  53779860     gbgss116.seq
 524291352     gbgss117.seq
 524290169     gbgss118.seq
 524291590     gbgss119.seq
 524289031     gbgss12.seq
 524291253     gbgss120.seq
 524289472     gbgss121.seq
 524289302     gbgss122.seq
 524291411     gbgss123.seq
 524290367     gbgss124.seq
 524289383     gbgss125.seq
 524291490     gbgss126.seq
 524291434     gbgss127.seq
 524289809     gbgss128.seq
 195802577     gbgss129.seq
 524291863     gbgss13.seq
 524289379     gbgss130.seq
 524291778     gbgss131.seq
 524290292     gbgss132.seq
 524291495     gbgss133.seq
 524289499     gbgss134.seq
 524290965     gbgss135.seq
 524288803     gbgss136.seq
 524289960     gbgss137.seq
 524289352     gbgss138.seq
 498459753     gbgss139.seq
 524290957     gbgss14.seq
 498423703     gbgss140.seq
 181263902     gbgss141.seq
 524290476     gbgss142.seq
 524290347     gbgss143.seq
 524289874     gbgss144.seq
 524290507     gbgss145.seq
 524289998     gbgss146.seq
 524291768     gbgss147.seq
 524288890     gbgss148.seq
 524288787     gbgss149.seq
 524289694     gbgss15.seq
 524289307     gbgss150.seq
 524290143     gbgss151.seq
 312983605     gbgss152.seq
 524289805     gbgss153.seq
 524290869     gbgss154.seq
 524290428     gbgss155.seq
 524291382     gbgss156.seq
 524289339     gbgss157.seq
 524291208     gbgss158.seq
 524291428     gbgss159.seq
 524289307     gbgss16.seq
 524289136     gbgss160.seq
 524290154     gbgss161.seq
 524289539     gbgss162.seq
 524289723     gbgss163.seq
 137860427     gbgss164.seq
 249998132     gbgss165.seq
 249999225     gbgss166.seq
 249998330     gbgss167.seq
 249999261     gbgss168.seq
  31118462     gbgss169.seq
 524291107     gbgss17.seq
 249997137     gbgss170.seq
 250000033     gbgss171.seq
 249998542     gbgss172.seq
 249998333     gbgss173.seq
 224919493     gbgss174.seq
 249998415     gbgss175.seq
 249998695     gbgss176.seq
 249998511     gbgss177.seq
 249998191     gbgss178.seq
 192856297     gbgss179.seq
 524289024     gbgss18.seq
 249997950     gbgss180.seq
 249998694     gbgss181.seq
 249998786     gbgss182.seq
 249997755     gbgss183.seq
 249999439     gbgss184.seq
  71125973     gbgss185.seq
 249999835     gbgss186.seq
   2112081     gbgss187.seq
  80345119     gbgss188.seq
 249999264     gbgss189.seq
 297814638     gbgss19.seq
 249998538     gbgss190.seq
  87602941     gbgss191.seq
 249999685     gbgss192.seq
 249998355     gbgss193.seq
 249998971     gbgss194.seq
 203257936     gbgss195.seq
 249999232     gbgss196.seq
 249998813     gbgss197.seq
 249999964     gbgss198.seq
 246326993     gbgss199.seq
 524288869     gbgss2.seq
 524291455     gbgss20.seq
 249997836     gbgss200.seq
 249999647     gbgss201.seq
 249998223     gbgss202.seq
 244710946     gbgss203.seq
 249999336     gbgss204.seq
 250000173     gbgss205.seq
 249997063     gbgss206.seq
 249999769     gbgss207.seq
 126496662     gbgss208.seq
 249997387     gbgss209.seq
 524290129     gbgss21.seq
 249997998     gbgss210.seq
 249999931     gbgss211.seq
 249998615     gbgss212.seq
  92409107     gbgss213.seq
 249999742     gbgss214.seq
 249999443     gbgss215.seq
 249998678     gbgss216.seq
 249998232     gbgss217.seq
 249999410     gbgss218.seq
 143856146     gbgss219.seq
 524289541     gbgss22.seq
 249997846     gbgss220.seq
 249999124     gbgss221.seq
 249997821     gbgss222.seq
 249997789     gbgss223.seq
  84917634     gbgss224.seq
 249999461     gbgss225.seq
 249999350     gbgss226.seq
 249998406     gbgss227.seq
 249998619     gbgss228.seq
 249999398     gbgss229.seq
 524291219     gbgss23.seq
 249998013     gbgss230.seq
 100149165     gbgss231.seq
 249999424     gbgss232.seq
 249999963     gbgss233.seq
 249997369     gbgss234.seq
  43648880     gbgss235.seq
  52925443     gbgss236.seq
 249999254     gbgss237.seq
 249999370     gbgss238.seq
 249998576     gbgss239.seq
 524290959     gbgss24.seq
 249999790     gbgss240.seq
 249997993     gbgss241.seq
 249999453     gbgss242.seq
 100320910     gbgss243.seq
 249999617     gbgss244.seq
 250000113     gbgss245.seq
 249997380     gbgss246.seq
 249999823     gbgss247.seq
  27507329     gbgss248.seq
 249997661     gbgss249.seq
 524289143     gbgss25.seq
 249999221     gbgss250.seq
 249996423     gbgss251.seq
 249997687     gbgss252.seq
 249999776     gbgss253.seq
 249999649     gbgss254.seq
 191301715     gbgss255.seq
 249998299     gbgss256.seq
 249998824     gbgss257.seq
 249998817     gbgss258.seq
 225684315     gbgss259.seq
 524290804     gbgss26.seq
 250000034     gbgss260.seq
 249999411     gbgss261.seq
 249998949     gbgss262.seq
 249998290     gbgss263.seq
 249997496     gbgss264.seq
  66032843     gbgss265.seq
 249999961     gbgss266.seq
 249999246     gbgss267.seq
 249997183     gbgss268.seq
 249998878     gbgss269.seq
 524289932     gbgss27.seq
 249998009     gbgss270.seq
 249998219     gbgss271.seq
 249997997     gbgss272.seq
 249999647     gbgss273.seq
  42500771     gbgss274.seq
 249999562     gbgss275.seq
 249998752     gbgss276.seq
 249999600     gbgss277.seq
 249999029     gbgss278.seq
 221982324     gbgss279.seq
 524291255     gbgss28.seq
 249999329     gbgss280.seq
 249998347     gbgss281.seq
 249998273     gbgss282.seq
 249999290     gbgss283.seq
 249998381     gbgss284.seq
 250000063     gbgss285.seq
 249998596     gbgss286.seq
 225734403     gbgss287.seq
 524290914     gbgss29.seq
 524291421     gbgss3.seq
 524289346     gbgss30.seq
  28991103     gbgss31.seq
 524291144     gbgss32.seq
 524289799     gbgss33.seq
 524290542     gbgss34.seq
 524289125     gbgss35.seq
 524290210     gbgss36.seq
 524290379     gbgss37.seq
 524290748     gbgss38.seq
 490815577     gbgss39.seq
 524290271     gbgss4.seq
 524291147     gbgss40.seq
 524291165     gbgss41.seq
 524288864     gbgss42.seq
  20496839     gbgss43.seq
 524290629     gbgss44.seq
 524291192     gbgss45.seq
 524290947     gbgss46.seq
 524289464     gbgss47.seq
 216853835     gbgss48.seq
 524290958     gbgss49.seq
 159850274     gbgss5.seq
 524290909     gbgss50.seq
 524289412     gbgss51.seq
 524290528     gbgss52.seq
 524289530     gbgss53.seq
 524289625     gbgss54.seq
 524290060     gbgss55.seq
 524289474     gbgss56.seq
 524288877     gbgss57.seq
 524289519     gbgss58.seq
 524291622     gbgss59.seq
 524291244     gbgss6.seq
  16631429     gbgss60.seq
 524290898     gbgss61.seq
 524290087     gbgss62.seq
 524291264     gbgss63.seq
 454607847     gbgss64.seq
 524291099     gbgss65.seq
 524288859     gbgss66.seq
 524289978     gbgss67.seq
 524290979     gbgss68.seq
 524291254     gbgss69.seq
 524289679     gbgss7.seq
 524290531     gbgss70.seq
 524292960     gbgss71.seq
 524289505     gbgss72.seq
 524288813     gbgss73.seq
 524290184     gbgss74.seq
 524290161     gbgss75.seq
 524289124     gbgss76.seq
  33504267     gbgss77.seq
 524290959     gbgss78.seq
 524289172     gbgss79.seq
 524289368     gbgss8.seq
 524289507     gbgss80.seq
 524288729     gbgss81.seq
 524291277     gbgss82.seq
 524293493     gbgss83.seq
 524291707     gbgss84.seq
 524289357     gbgss85.seq
 524290152     gbgss86.seq
 524291439     gbgss87.seq
 524291938     gbgss88.seq
 379881935     gbgss89.seq
 524291677     gbgss9.seq
 524291919     gbgss90.seq
 524289553     gbgss91.seq
 524292535     gbgss92.seq
 524291749     gbgss93.seq
 524291967     gbgss94.seq
 524289937     gbgss95.seq
 524291779     gbgss96.seq
 524292054     gbgss97.seq
 524288810     gbgss98.seq
 524290782     gbgss99.seq
 249990596     gbhtc1.seq
 249999825     gbhtc10.seq
 249997690     gbhtc11.seq
 108182494     gbhtc12.seq
 250000093     gbhtc13.seq
 249999918     gbhtc14.seq
 109932220     gbhtc15.seq
 249983694     gbhtc2.seq
 249998329     gbhtc3.seq
 249996058     gbhtc4.seq
 249990326     gbhtc5.seq
 249999266     gbhtc6.seq
 249998445     gbhtc7.seq
  84327601     gbhtc8.seq
 249999161     gbhtc9.seq
 249909505     gbhtg1.seq
 249953472     gbhtg10.seq
 249912145     gbhtg100.seq
 249866447     gbhtg101.seq
 249548804     gbhtg102.seq
 249887765     gbhtg103.seq
   3687904     gbhtg104.seq
 249803908     gbhtg105.seq
 249881914     gbhtg106.seq
 249836330     gbhtg107.seq
 249896889     gbhtg108.seq
 249974938     gbhtg109.seq
    799345     gbhtg11.seq
 249774498     gbhtg110.seq
 167855877     gbhtg111.seq
 249987701     gbhtg112.seq
 249873304     gbhtg113.seq
 249946277     gbhtg114.seq
 249972635     gbhtg115.seq
 249835838     gbhtg116.seq
 249604007     gbhtg117.seq
 249928579     gbhtg118.seq
 220893412     gbhtg119.seq
 249888187     gbhtg12.seq
 249814763     gbhtg120.seq
 249946366     gbhtg121.seq
 249982363     gbhtg122.seq
 249886589     gbhtg123.seq
 249929559     gbhtg124.seq
 118673506     gbhtg125.seq
 249860737     gbhtg126.seq
 249838185     gbhtg127.seq
 249821150     gbhtg128.seq
 249911176     gbhtg129.seq
 249968078     gbhtg13.seq
 249980071     gbhtg130.seq
 134314079     gbhtg131.seq
 249758419     gbhtg132.seq
 249798662     gbhtg133.seq
 249841930     gbhtg134.seq
 249821708     gbhtg135.seq
 249789670     gbhtg136.seq
 249833227     gbhtg137.seq
 249880039     gbhtg138.seq
 249783359     gbhtg139.seq
 249584228     gbhtg14.seq
 249863615     gbhtg140.seq
 220292368     gbhtg141.seq
 249771919     gbhtg15.seq
 249739055     gbhtg16.seq
 249165958     gbhtg17.seq
 249979906     gbhtg18.seq
 249677324     gbhtg19.seq
 249996486     gbhtg2.seq
 249986017     gbhtg20.seq
 237141712     gbhtg21.seq
 249756771     gbhtg22.seq
 249864520     gbhtg23.seq
 249983387     gbhtg24.seq
 249918011     gbhtg25.seq
 249757014     gbhtg26.seq
 249887703     gbhtg27.seq
 249957955     gbhtg28.seq
 249838339     gbhtg29.seq
 249996436     gbhtg3.seq
 249989581     gbhtg30.seq
 225321900     gbhtg31.seq
 249823614     gbhtg32.seq
 249917463     gbhtg33.seq
 249925866     gbhtg34.seq
 249914652     gbhtg35.seq
 249854015     gbhtg36.seq
 249811770     gbhtg37.seq
 249764989     gbhtg38.seq
 249624028     gbhtg39.seq
 249972999     gbhtg4.seq
 249836318     gbhtg40.seq
 224361424     gbhtg41.seq
 249887463     gbhtg42.seq
 249786771     gbhtg43.seq
 249974469     gbhtg44.seq
 249775813     gbhtg45.seq
 249971175     gbhtg46.seq
 249706362     gbhtg47.seq
 249865871     gbhtg48.seq
 249890680     gbhtg49.seq
 249908886     gbhtg5.seq
 249899909     gbhtg50.seq
 234810659     gbhtg51.seq
 249734856     gbhtg52.seq
 249975040     gbhtg53.seq
 249785164     gbhtg54.seq
 249720641     gbhtg55.seq
 249959671     gbhtg56.seq
  18795824     gbhtg57.seq
 249859967     gbhtg58.seq
 249826451     gbhtg59.seq
 249993239     gbhtg6.seq
 249998076     gbhtg60.seq
 249924538     gbhtg61.seq
 225131070     gbhtg62.seq
 249886269     gbhtg63.seq
 249907389     gbhtg64.seq
 249800911     gbhtg65.seq
 249764876     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249978568     gbhtg69.seq
 249808932     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249764397     gbhtg72.seq
 223417416     gbhtg73.seq
 249931059     gbhtg74.seq
 249860470     gbhtg75.seq
 249999388     gbhtg76.seq
 249942534     gbhtg77.seq
 234936749     gbhtg78.seq
 249847814     gbhtg79.seq
 249827069     gbhtg8.seq
 249936987     gbhtg80.seq
 249826384     gbhtg81.seq
 249853469     gbhtg82.seq
 202267292     gbhtg83.seq
 249837350     gbhtg84.seq
 249926497     gbhtg85.seq
 249824544     gbhtg86.seq
 249844614     gbhtg87.seq
 205982550     gbhtg88.seq
 249844885     gbhtg89.seq
 249952731     gbhtg9.seq
 249834821     gbhtg90.seq
 249734686     gbhtg91.seq
 249850756     gbhtg92.seq
 194386492     gbhtg93.seq
 249945099     gbhtg94.seq
 249957847     gbhtg95.seq
 249864947     gbhtg96.seq
 249788458     gbhtg97.seq
 161658952     gbhtg98.seq
 249871130     gbhtg99.seq
 249999899     gbinv1.seq
 249651970     gbinv10.seq
 249793122     gbinv100.seq
 249981535     gbinv101.seq
 249997903     gbinv102.seq
 243824572     gbinv103.seq
  52925611     gbinv104.seq
 249977977     gbinv105.seq
 249961528     gbinv106.seq
 249999855     gbinv107.seq
 249998658     gbinv108.seq
 249996199     gbinv109.seq
 250000199     gbinv11.seq
 249999433     gbinv110.seq
  17844947     gbinv111.seq
 249998579     gbinv112.seq
 249987951     gbinv113.seq
 249996177     gbinv114.seq
 249993466     gbinv115.seq
 146644633     gbinv116.seq
 249994719     gbinv117.seq
 249999045     gbinv118.seq
 249998773     gbinv119.seq
 249999513     gbinv12.seq
 249999114     gbinv120.seq
 249998443     gbinv121.seq
 249999508     gbinv122.seq
 249939940     gbinv123.seq
  21620287     gbinv124.seq
  33978323     gbinv13.seq
 249999645     gbinv14.seq
 250000236     gbinv15.seq
 250000092     gbinv16.seq
 163831338     gbinv17.seq
 249996893     gbinv18.seq
 249678810     gbinv19.seq
 249881494     gbinv2.seq
 249997412     gbinv20.seq
 249999952     gbinv21.seq
 249998719     gbinv22.seq
  31973006     gbinv23.seq
 229930928     gbinv24.seq
 175506967     gbinv25.seq
 249998398     gbinv26.seq
 249997923     gbinv27.seq
 210467392     gbinv28.seq
 249997359     gbinv29.seq
 249956737     gbinv3.seq
 249997718     gbinv30.seq
 249999137     gbinv31.seq
 249998710     gbinv32.seq
 157832567     gbinv33.seq
 249997814     gbinv34.seq
 249999309     gbinv35.seq
 250000056     gbinv36.seq
 249998468     gbinv37.seq
 141998387     gbinv38.seq
 250000199     gbinv39.seq
 197272834     gbinv4.seq
 249997162     gbinv40.seq
 249998826     gbinv41.seq
 249999251     gbinv42.seq
 249999493     gbinv43.seq
 249998141     gbinv44.seq
 250000199     gbinv45.seq
 148810389     gbinv46.seq
 249949092     gbinv47.seq
 249993012     gbinv48.seq
 247536839     gbinv49.seq
 249998557     gbinv5.seq
 249908893     gbinv50.seq
 249932741     gbinv51.seq
 249796765     gbinv52.seq
 249979032     gbinv53.seq
 220225741     gbinv54.seq
 249997947     gbinv55.seq
 249993437     gbinv56.seq
 249995495     gbinv57.seq
 249997709     gbinv58.seq
  51747128     gbinv59.seq
 249998865     gbinv6.seq
 249996142     gbinv60.seq
 249961763     gbinv61.seq
 249996526     gbinv62.seq
 249990785     gbinv63.seq
 249983105     gbinv64.seq
 249977710     gbinv65.seq
 249994985     gbinv66.seq
 249998590     gbinv67.seq
 249999068     gbinv68.seq
 224842193     gbinv69.seq
 249998143     gbinv7.seq
 249989083     gbinv70.seq
 249979519     gbinv71.seq
 249994236     gbinv72.seq
 249996734     gbinv73.seq
 250000084     gbinv74.seq
 249999397     gbinv75.seq
 249994988     gbinv76.seq
 249998647     gbinv77.seq
  30318265     gbinv78.seq
 249955084     gbinv79.seq
 233103046     gbinv8.seq
 249996848     gbinv80.seq
 249991951     gbinv81.seq
 249976129     gbinv82.seq
 249999979     gbinv83.seq
 249983497     gbinv84.seq
 249996597     gbinv85.seq
  89129685     gbinv86.seq
 249973474     gbinv87.seq
 249899692     gbinv88.seq
 249979395     gbinv89.seq
 249996980     gbinv9.seq
 249998794     gbinv90.seq
 249994231     gbinv91.seq
 249966581     gbinv92.seq
 249983746     gbinv93.seq
 249995960     gbinv94.seq
 249994416     gbinv95.seq
 151414968     gbinv96.seq
 249999544     gbinv97.seq
 249995663     gbinv98.seq
 249998337     gbinv99.seq
 249726297     gbmam1.seq
 249998858     gbmam2.seq
 249995449     gbmam3.seq
 250000110     gbmam4.seq
 249997623     gbmam5.seq
 249997095     gbmam6.seq
 249999533     gbmam7.seq
 249999299     gbmam8.seq
  90221749     gbmam9.seq
  69200098     gbnew.txt
 249992549     gbpat1.seq
 249999234     gbpat10.seq
 249998996     gbpat100.seq
 249999065     gbpat101.seq
 249999793     gbpat102.seq
 149112469     gbpat103.seq
 249999880     gbpat104.seq
 249999565     gbpat105.seq
 249929731     gbpat106.seq
 249824879     gbpat107.seq
 249998856     gbpat108.seq
 192960437     gbpat109.seq
 180043377     gbpat11.seq
 249999737     gbpat110.seq
 249999649     gbpat111.seq
 249998225     gbpat112.seq
  80213671     gbpat113.seq
 249999520     gbpat114.seq
 249999617     gbpat115.seq
 249603009     gbpat116.seq
 249999544     gbpat117.seq
 250000164     gbpat118.seq
  67190995     gbpat119.seq
 249995098     gbpat12.seq
 249999441     gbpat120.seq
 249999845     gbpat121.seq
 249999888     gbpat122.seq
 249999095     gbpat123.seq
 160256390     gbpat124.seq
 249999974     gbpat125.seq
 249999633     gbpat126.seq
 234784218     gbpat127.seq
 249991591     gbpat128.seq
 249970935     gbpat129.seq
 249999929     gbpat13.seq
 249999681     gbpat130.seq
 249997397     gbpat131.seq
 249997452     gbpat132.seq
  66832984     gbpat133.seq
 249992315     gbpat134.seq
 249999867     gbpat135.seq
 250000197     gbpat136.seq
 249999821     gbpat137.seq
 249998337     gbpat138.seq
  18437114     gbpat139.seq
 250000154     gbpat14.seq
 249999655     gbpat140.seq
 249998828     gbpat141.seq
 249999803     gbpat142.seq
 249999630     gbpat143.seq
  46945969     gbpat144.seq
 249999271     gbpat145.seq
 249999873     gbpat146.seq
 249999008     gbpat147.seq
 234349056     gbpat148.seq
 249999644     gbpat149.seq
 249993124     gbpat15.seq
 249999868     gbpat150.seq
 249999723     gbpat151.seq
  86184716     gbpat152.seq
 249999922     gbpat153.seq
 250000090     gbpat154.seq
 249999908     gbpat155.seq
  63657567     gbpat156.seq
 249993781     gbpat157.seq
 249998996     gbpat158.seq
 250000188     gbpat159.seq
 249999774     gbpat16.seq
 249999404     gbpat160.seq
 249999615     gbpat161.seq
 249997144     gbpat162.seq
 223313892     gbpat163.seq
 250000249     gbpat164.seq
 249999893     gbpat165.seq
 249999893     gbpat166.seq
 220539897     gbpat167.seq
 249999753     gbpat168.seq
 249999696     gbpat169.seq
  75562269     gbpat17.seq
 250000202     gbpat170.seq
  12463087     gbpat171.seq
 249993337     gbpat172.seq
 249996916     gbpat173.seq
 249999998     gbpat174.seq
 249995205     gbpat175.seq
  90661140     gbpat176.seq
 249999464     gbpat177.seq
 249999105     gbpat178.seq
 249997208     gbpat179.seq
 250000027     gbpat18.seq
 245678306     gbpat180.seq
 249999945     gbpat181.seq
 249998353     gbpat182.seq
 250000247     gbpat183.seq
 249999710     gbpat184.seq
 214725207     gbpat185.seq
 249993897     gbpat186.seq
 249199714     gbpat187.seq
 250000053     gbpat188.seq
 249999282     gbpat189.seq
 249999801     gbpat19.seq
 181177116     gbpat190.seq
 249548891     gbpat191.seq
 248494396     gbpat192.seq
 249998573     gbpat193.seq
 250000238     gbpat194.seq
 249986815     gbpat195.seq
 249998897     gbpat196.seq
 177443139     gbpat197.seq
 250000142     gbpat198.seq
 249999371     gbpat199.seq
 249999989     gbpat2.seq
 249999814     gbpat20.seq
 250000146     gbpat200.seq
 249999091     gbpat201.seq
  66619634     gbpat202.seq
 249998790     gbpat203.seq
 249997497     gbpat204.seq
 249997892     gbpat205.seq
 249985131     gbpat206.seq
 249995535     gbpat207.seq
 243873564     gbpat208.seq
 249999998     gbpat209.seq
 249999147     gbpat21.seq
 249999752     gbpat210.seq
 250000084     gbpat211.seq
 249999762     gbpat212.seq
 249998747     gbpat213.seq
 193775537     gbpat214.seq
 186231949     gbpat22.seq
 250000169     gbpat23.seq
 249795439     gbpat24.seq
 249999467     gbpat25.seq
 249999934     gbpat26.seq
  71637006     gbpat27.seq
 249999153     gbpat28.seq
 249999039     gbpat29.seq
 249998811     gbpat3.seq
 249999754     gbpat30.seq
 249999798     gbpat31.seq
 249999898     gbpat32.seq
 179961346     gbpat33.seq
 249999455     gbpat34.seq
 249995721     gbpat35.seq
 249999499     gbpat36.seq
 249999533     gbpat37.seq
 250000055     gbpat38.seq
 249998422     gbpat39.seq
 249999974     gbpat4.seq
  59076908     gbpat40.seq
 249998621     gbpat41.seq
 249965559     gbpat42.seq
 249999899     gbpat43.seq
 250000163     gbpat44.seq
 249999678     gbpat45.seq
 249913676     gbpat46.seq
 249999213     gbpat47.seq
 249996376     gbpat48.seq
 171736721     gbpat49.seq
  71727149     gbpat5.seq
 249998596     gbpat50.seq
 249999175     gbpat51.seq
 249997974     gbpat52.seq
 249999732     gbpat53.seq
 222942647     gbpat54.seq
 249999057     gbpat55.seq
 249999815     gbpat56.seq
 250000246     gbpat57.seq
 165007673     gbpat58.seq
 249906098     gbpat59.seq
 249999527     gbpat6.seq
 249996201     gbpat60.seq
 249999263     gbpat61.seq
 249999178     gbpat62.seq
 135437256     gbpat63.seq
 249999198     gbpat64.seq
 249998801     gbpat65.seq
 249997619     gbpat66.seq
 249998578     gbpat67.seq
 249999274     gbpat68.seq
 249999540     gbpat69.seq
 249999847     gbpat7.seq
 144894652     gbpat70.seq
 249999757     gbpat71.seq
 249999899     gbpat72.seq
 249998837     gbpat73.seq
 244408172     gbpat74.seq
 248969297     gbpat75.seq
 244459306     gbpat76.seq
 247876384     gbpat77.seq
 249998774     gbpat78.seq
 160626113     gbpat79.seq
 249990415     gbpat8.seq
 250000121     gbpat80.seq
 249999657     gbpat81.seq
 249999470     gbpat82.seq
 249999644     gbpat83.seq
 249995691     gbpat84.seq
 249999026     gbpat85.seq
  99336818     gbpat86.seq
 249159569     gbpat87.seq
 249999065     gbpat88.seq
 249998905     gbpat89.seq
 249999842     gbpat9.seq
 249999384     gbpat90.seq
 249999113     gbpat91.seq
 249999495     gbpat92.seq
 145308021     gbpat93.seq
 249999532     gbpat94.seq
 249998964     gbpat95.seq
 249999939     gbpat96.seq
 250000257     gbpat97.seq
 196970502     gbpat98.seq
 249999051     gbpat99.seq
 249980723     gbphg1.seq
 116447469     gbphg2.seq
 249999406     gbpln1.seq
 112198591     gbpln10.seq
 249998168     gbpln11.seq
 249996823     gbpln12.seq
 249996831     gbpln13.seq
 249961545     gbpln14.seq
 215739386     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
 249728105     gbpln19.seq
 249997446     gbpln2.seq
 249776877     gbpln20.seq
 249151418     gbpln21.seq
 249675702     gbpln22.seq
  94102129     gbpln23.seq
 249998569     gbpln24.seq
 100104074     gbpln25.seq
 249999963     gbpln26.seq
 249999280     gbpln27.seq
 249780806     gbpln28.seq
 221032726     gbpln29.seq
 249798172     gbpln3.seq
 180429645     gbpln30.seq
 246949840     gbpln31.seq
 249897718     gbpln32.seq
 248863047     gbpln33.seq
 249997868     gbpln34.seq
 249997050     gbpln35.seq
 249998020     gbpln36.seq
  17857551     gbpln37.seq
 249999198     gbpln38.seq
 249997592     gbpln39.seq
 249969427     gbpln4.seq
 249999230     gbpln40.seq
 249996850     gbpln41.seq
 146483354     gbpln42.seq
 249998775     gbpln43.seq
 249999861     gbpln44.seq
 249998568     gbpln45.seq
 247784374     gbpln46.seq
 249989137     gbpln47.seq
 249998493     gbpln48.seq
  47624582     gbpln49.seq
 249966379     gbpln5.seq
 249997739     gbpln50.seq
  49153896     gbpln51.seq
 211962331     gbpln52.seq
 247770221     gbpln53.seq
 160804284     gbpln54.seq
 996342174     gbpln55.seq
  48382005     gbpln56.seq
 215249878     gbpln57.seq
 193947185     gbpln58.seq
 176289209     gbpln59.seq
 249875313     gbpln6.seq
 190421706     gbpln60.seq
 211681186     gbpln61.seq
 190240059     gbpln62.seq
 178103506     gbpln63.seq
 246426110     gbpln64.seq
 221444578     gbpln65.seq
 236171399     gbpln66.seq
 120596706     gbpln67.seq
 249997871     gbpln68.seq
 249998101     gbpln69.seq
 249979262     gbpln7.seq
  58718658     gbpln70.seq
 249999986     gbpln71.seq
 249998730     gbpln72.seq
 249998300     gbpln73.seq
 249998964     gbpln74.seq
 249998423     gbpln75.seq
   9841405     gbpln76.seq
 249997456     gbpln77.seq
 249982608     gbpln78.seq
 249998979     gbpln79.seq
 249531383     gbpln8.seq
 249828383     gbpln80.seq
  62347071     gbpln81.seq
 249993734     gbpln82.seq
 249999121     gbpln83.seq
 249798097     gbpln84.seq
 249998284     gbpln85.seq
 249999162     gbpln86.seq
 249259271     gbpln87.seq
 249999722     gbpln88.seq
   2165864     gbpln89.seq
 249997202     gbpln9.seq
 149042890     gbpri1.seq
 249954001     gbpri10.seq
 138695002     gbpri11.seq
 249962747     gbpri12.seq
 249896480     gbpri13.seq
 249896770     gbpri14.seq
 249947119     gbpri15.seq
 249865833     gbpri16.seq
 249867629     gbpri17.seq
 249758014     gbpri18.seq
 249922775     gbpri19.seq
 249914626     gbpri2.seq
 249959135     gbpri20.seq
 249969488     gbpri21.seq
 249966038     gbpri22.seq
 113697037     gbpri23.seq
 177310636     gbpri24.seq
 249997438     gbpri25.seq
 211364479     gbpri26.seq
 249927211     gbpri27.seq
 249920767     gbpri28.seq
 249824803     gbpri29.seq
 249799524     gbpri3.seq
 249831011     gbpri30.seq
 249802883     gbpri31.seq
 249991664     gbpri32.seq
 249977695     gbpri33.seq
 249985188     gbpri34.seq
  27864467     gbpri35.seq
 249995919     gbpri36.seq
 249990761     gbpri37.seq
 249425862     gbpri38.seq
 249993655     gbpri39.seq
 249927732     gbpri4.seq
 249999384     gbpri40.seq
 195183748     gbpri41.seq
 249998729     gbpri42.seq
 249995269     gbpri43.seq
 249995953     gbpri44.seq
 249996484     gbpri45.seq
 249958841     gbpri46.seq
 249998760     gbpri47.seq
 119038661     gbpri48.seq
 249806839     gbpri5.seq
 249828133     gbpri6.seq
 249901287     gbpri7.seq
 249907506     gbpri8.seq
 249949516     gbpri9.seq
    374178     gbrel.txt
 249773935     gbrod1.seq
 249995694     gbrod10.seq
  71787772     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249943446     gbrod18.seq
 249997165     gbrod19.seq
 249848544     gbrod2.seq
   6129252     gbrod20.seq
 249872996     gbrod21.seq
 249768058     gbrod22.seq
 191021074     gbrod23.seq
 249999307     gbrod24.seq
 249995227     gbrod25.seq
 249794483     gbrod26.seq
 249848141     gbrod27.seq
 249999599     gbrod28.seq
 249999520     gbrod29.seq
 249824766     gbrod3.seq
 249991339     gbrod30.seq
  94867772     gbrod31.seq
 249784866     gbrod4.seq
 249854376     gbrod5.seq
 249755893     gbrod6.seq
 249700772     gbrod7.seq
 249972098     gbrod8.seq
 249900061     gbrod9.seq
 249998027     gbsts1.seq
 249997655     gbsts10.seq
 210923828     gbsts11.seq
 249996524     gbsts12.seq
 249998724     gbsts13.seq
 249998299     gbsts14.seq
 249998514     gbsts15.seq
  24549356     gbsts16.seq
 250000234     gbsts17.seq
 249999882     gbsts18.seq
 250000069     gbsts19.seq
 249998746     gbsts2.seq
 186778345     gbsts20.seq
 249999005     gbsts3.seq
 249996035     gbsts4.seq
  39726361     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249999435     gbsts9.seq
 239685162     gbsyn1.seq
 249996866     gbsyn2.seq
 249964673     gbsyn3.seq
 249956193     gbsyn4.seq
 249978422     gbsyn5.seq
 249962873     gbsyn6.seq
 249996297     gbsyn7.seq
  43977410     gbsyn8.seq
 249998403     gbtsa1.seq
  56875503     gbtsa10.seq
 249999743     gbtsa100.seq
 249999340     gbtsa101.seq
 249999346     gbtsa102.seq
 249997672     gbtsa103.seq
 249999551     gbtsa104.seq
 249999779     gbtsa105.seq
 227289492     gbtsa106.seq
 249998448     gbtsa107.seq
 249999616     gbtsa108.seq
 250000101     gbtsa109.seq
 249999071     gbtsa11.seq
 249999428     gbtsa110.seq
 249799917     gbtsa111.seq
 249998403     gbtsa112.seq
 249999879     gbtsa113.seq
 249998407     gbtsa114.seq
 220794559     gbtsa115.seq
 250000135     gbtsa116.seq
 249998071     gbtsa117.seq
 249997885     gbtsa118.seq
 249998171     gbtsa119.seq
 249997105     gbtsa12.seq
 249998929     gbtsa120.seq
 249999234     gbtsa121.seq
 145146114     gbtsa122.seq
 249999536     gbtsa123.seq
 249998915     gbtsa124.seq
 250000174     gbtsa125.seq
 249999584     gbtsa126.seq
 249997105     gbtsa127.seq
 196200322     gbtsa128.seq
 249999600     gbtsa129.seq
 249999445     gbtsa13.seq
 249996475     gbtsa130.seq
 249999082     gbtsa131.seq
 249996441     gbtsa132.seq
 133581626     gbtsa133.seq
 249995766     gbtsa134.seq
 249998592     gbtsa135.seq
 249999280     gbtsa136.seq
 249997940     gbtsa137.seq
  36107534     gbtsa138.seq
 249998956     gbtsa139.seq
 250000126     gbtsa14.seq
 249999594     gbtsa140.seq
 249997728     gbtsa141.seq
 249999490     gbtsa142.seq
 249998415     gbtsa143.seq
 249999441     gbtsa144.seq
 249999497     gbtsa145.seq
 249998320     gbtsa146.seq
  53889829     gbtsa147.seq
 249998344     gbtsa148.seq
 249998929     gbtsa149.seq
 209212004     gbtsa15.seq
 249999098     gbtsa150.seq
 249998969     gbtsa151.seq
 249998410     gbtsa152.seq
 249998335     gbtsa153.seq
 249999425     gbtsa154.seq
 250000053     gbtsa155.seq
 165010636     gbtsa156.seq
 249997341     gbtsa16.seq
 250000027     gbtsa17.seq
 249998493     gbtsa18.seq
 249999319     gbtsa19.seq
 249998557     gbtsa2.seq
 234177439     gbtsa20.seq
 249998989     gbtsa21.seq
 249996697     gbtsa22.seq
 250000178     gbtsa23.seq
 249996363     gbtsa24.seq
 249996354     gbtsa25.seq
  14680057     gbtsa26.seq
 249999463     gbtsa27.seq
 249999328     gbtsa28.seq
 249999843     gbtsa29.seq
 249999903     gbtsa3.seq
 249999306     gbtsa30.seq
 249999161     gbtsa31.seq
 249996845     gbtsa32.seq
  77066999     gbtsa33.seq
 249998838     gbtsa34.seq
 250000120     gbtsa35.seq
 249997735     gbtsa36.seq
 249997498     gbtsa37.seq
 249998198     gbtsa38.seq
 249998877     gbtsa39.seq
 249999323     gbtsa4.seq
 249998290     gbtsa40.seq
  34398944     gbtsa41.seq
 249999415     gbtsa42.seq
 249998692     gbtsa43.seq
 249999756     gbtsa44.seq
 249999818     gbtsa45.seq
  77518171     gbtsa46.seq
 249999788     gbtsa47.seq
 249999066     gbtsa48.seq
 249996389     gbtsa49.seq
 151717879     gbtsa5.seq
 249998945     gbtsa50.seq
 141892200     gbtsa51.seq
 250000009     gbtsa52.seq
 249999189     gbtsa53.seq
 249999159     gbtsa54.seq
 249999078     gbtsa55.seq
 249996922     gbtsa56.seq
 249997972     gbtsa57.seq
 249999445     gbtsa58.seq
 245793553     gbtsa59.seq
 249997875     gbtsa6.seq
 249999221     gbtsa60.seq
 249998419     gbtsa61.seq
 249998283     gbtsa62.seq
 249998268     gbtsa63.seq
 250000204     gbtsa64.seq
 249999005     gbtsa65.seq
 232171452     gbtsa66.seq
 249999409     gbtsa67.seq
 249999138     gbtsa68.seq
 249998170     gbtsa69.seq
 249998005     gbtsa7.seq
 249998697     gbtsa70.seq
 249995875     gbtsa71.seq
 249998691     gbtsa72.seq
 185136198     gbtsa73.seq
 249999580     gbtsa74.seq
 249997881     gbtsa75.seq
 249999346     gbtsa76.seq
 249997691     gbtsa77.seq
 249991851     gbtsa78.seq
 108251130     gbtsa79.seq
 249999806     gbtsa8.seq
 249998427     gbtsa80.seq
 249999836     gbtsa81.seq
 249999619     gbtsa82.seq
 249999916     gbtsa83.seq
 250000249     gbtsa84.seq
  45206606     gbtsa85.seq
 249998632     gbtsa86.seq
 249998586     gbtsa87.seq
 249999659     gbtsa88.seq
 249999906     gbtsa89.seq
 249999617     gbtsa9.seq
 250000069     gbtsa90.seq
 149125795     gbtsa91.seq
 249994299     gbtsa92.seq
 249999674     gbtsa93.seq
 249997982     gbtsa94.seq
 249999245     gbtsa95.seq
 249997038     gbtsa96.seq
 249999884     gbtsa97.seq
 249999225     gbtsa98.seq
 106366042     gbtsa99.seq
    738752     gbuna1.seq
 249999725     gbvrl1.seq
 249998266     gbvrl10.seq
 249998204     gbvrl11.seq
 249997497     gbvrl12.seq
 249997280     gbvrl13.seq
 106171743     gbvrl14.seq
 250000259     gbvrl15.seq
 249998145     gbvrl16.seq
 249998475     gbvrl17.seq
 249995251     gbvrl18.seq
 217144270     gbvrl19.seq
 249989873     gbvrl2.seq
 249998002     gbvrl20.seq
 249998912     gbvrl21.seq
 249996165     gbvrl22.seq
 249996503     gbvrl23.seq
 138186746     gbvrl24.seq
 249997881     gbvrl25.seq
 249997908     gbvrl26.seq
 249999529     gbvrl27.seq
 249996633     gbvrl28.seq
 249999105     gbvrl29.seq
 249998330     gbvrl3.seq
 249981675     gbvrl30.seq
 249996964     gbvrl31.seq
 209034848     gbvrl32.seq
 249990044     gbvrl4.seq
 249999355     gbvrl5.seq
  56834035     gbvrl6.seq
 249996706     gbvrl7.seq
 249993854     gbvrl8.seq
 249999328     gbvrl9.seq
 249841329     gbvrt1.seq
 249982516     gbvrt10.seq
 249970864     gbvrt11.seq
 142382882     gbvrt12.seq
 249921009     gbvrt13.seq
 249982307     gbvrt14.seq
 249948398     gbvrt15.seq
 249999583     gbvrt16.seq
 249999817     gbvrt17.seq
 249996874     gbvrt18.seq
  64079276     gbvrt19.seq
 249814832     gbvrt2.seq
 249967924     gbvrt20.seq
 249999310     gbvrt21.seq
 249999812     gbvrt22.seq
 249997348     gbvrt23.seq
 249997388     gbvrt24.seq
  99231953     gbvrt25.seq
 249999243     gbvrt26.seq
 249997466     gbvrt27.seq
 249997246     gbvrt28.seq
 191923149     gbvrt29.seq
 249997740     gbvrt3.seq
 249998925     gbvrt30.seq
 250000127     gbvrt31.seq
   2291113     gbvrt32.seq
 249998887     gbvrt33.seq
 249997984     gbvrt34.seq
 236916441     gbvrt35.seq
 241177285     gbvrt36.seq
 246581287     gbvrt37.seq
 232615814     gbvrt38.seq
 249952524     gbvrt39.seq
 249994078     gbvrt4.seq
 249705669     gbvrt40.seq
 249954985     gbvrt41.seq
 249915633     gbvrt42.seq
 249999227     gbvrt43.seq
  41173598     gbvrt44.seq
 179553549     gbvrt5.seq
 249996456     gbvrt6.seq
 249999128     gbvrt7.seq
 249930222     gbvrt8.seq
 249988839     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63778      86221705
BCT10        6838       96100195
BCT100       23         107940870
BCT101       23         107770597
BCT102       22         104487143
BCT103       23         109265582
BCT104       35         110393607
BCT105       38         105287515
BCT106       56         109530412
BCT107       54         112002912
BCT108       62         113138512
BCT109       45         109843473
BCT11        66         116730258
BCT110       38         113109205
BCT111       55         110795500
BCT112       52         108372072
BCT113       30         115504897
BCT114       35         108005796
BCT115       45         111332513
BCT116       24         112923929
BCT117       30         107528848
BCT118       90         96543620
BCT119       213        95163922
BCT12        74         112572581
BCT120       325        25743984
BCT121       1589       2511877
BCT122       3180       5275358
BCT123       6346       7804593
BCT124       12648      15077034
BCT125       25619      27729952
BCT126       50573      54086396
BCT127       75985      77693191
BCT128       71350      76859173
BCT129       10190      95035481
BCT13        110        115172505
BCT130       5443       100113517
BCT131       3165       107650334
BCT132       136        102930481
BCT133       65         115712583
BCT134       3240       103815321
BCT135       5526       104646634
BCT136       40774      71319157
BCT137       71143      76251312
BCT138       4002       110123140
BCT139       4450       110801955
BCT14        65         108986169
BCT140       6277       106572564
BCT141       3631       106844438
BCT142       51186      89611845
BCT143       75122      78879825
BCT144       35100      39750240
BCT145       75929      78450649
BCT146       71873      77601619
BCT147       71562      76139309
BCT148       74446      75223231
BCT149       18606      107335023
BCT15        61         117014035
BCT150       1897       185652704
BCT151       14427      138618283
BCT152       16513      31030360
BCT16        5894       121365401
BCT17        10248      12940974
BCT18        53932      85413620
BCT19        93         110189094
BCT2         27238      101103484
BCT20        143        97370347
BCT21        58         112869568
BCT22        52         109549606
BCT23        46         112848421
BCT24        57         112994744
BCT25        66         108817610
BCT26        36         96325907
BCT27        40         106881287
BCT28        59         107430269
BCT29        74         111675186
BCT3         47         108521659
BCT30        55         110045255
BCT31        63         106845575
BCT32        55         109391288
BCT33        53         108650404
BCT34        46         110496749
BCT35        95         109522868
BCT36        58         106383536
BCT37        67         109486091
BCT38        125        110095720
BCT39        37         71643089
BCT4         57         110804618
BCT40        200        111474100
BCT41        54         111189650
BCT42        35         108859141
BCT43        59         107860764
BCT44        56         105257887
BCT45        45         109560296
BCT46        74         109517239
BCT47        64         110904710
BCT48        45         108836596
BCT49        59         106741684
BCT5         27765      102431629
BCT50        69         107012469
BCT51        77         109262802
BCT52        22         22714378
BCT53        67         109336234
BCT54        60         104664634
BCT55        53         102829098
BCT56        56         108908758
BCT57        58         107145869
BCT58        57         111394309
BCT59        69         108480601
BCT6         10553      15037773
BCT60        63         106023069
BCT61        68         109676809
BCT62        37         115703457
BCT63        77         107678786
BCT64        50         110061582
BCT65        62         113995020
BCT66        25         28242590
BCT67        43         109822487
BCT68        50         116699480
BCT69        66         111693041
BCT7         39032      85140211
BCT70        50         111462164
BCT71        52         110768449
BCT72        101        115661680
BCT73        72         109607915
BCT74        77         103079244
BCT75        63         114250996
BCT76        69         114803403
BCT77        45         117172892
BCT78        60         109393972
BCT79        56         115052115
BCT8         5504       96546226
BCT80        8          18417639
BCT81        51         118678324
BCT82        259        116137065
BCT83        53         113500759
BCT84        62         110414229
BCT85        297        110874676
BCT86        74         108873821
BCT87        35         107913685
BCT88        54         108742201
BCT89        54         92477529
BCT9         13772      81354333
BCT90        66         113041084
BCT91        42         111987755
BCT92        54         111858220
BCT93        46         108629748
BCT94        60         105754779
BCT95        47         102494923
BCT96        26         104794980
BCT97        23         102384016
BCT98        22         103088409
BCT99        22         103958901
ENV1         92489      71799018
ENV10        93118      72867909
ENV11        82324      86592746
ENV12        21810      18681581
ENV13        84732      80837201
ENV14        118357     43039665
ENV15        89267      77188772
ENV16        96455      67723242
ENV17        96074      63283761
ENV18        109786     66814566
ENV19        121950     64611032
ENV2         98844      65400449
ENV20        61146      82554131
ENV21        70040      85924755
ENV22        90489      74779090
ENV23        126922     36737994
ENV24        122961     29000723
ENV25        82471      18956603
ENV26        123098     49754846
ENV27        97824      67149552
ENV28        114989     56528159
ENV29        135983     52751640
ENV3         79931      76877192
ENV30        108644     61016153
ENV31        94995      65446579
ENV32        14628      15657115
ENV33        62536      84995133
ENV34        88879      73350067
ENV35        102579     44149622
ENV36        96876      56126090
ENV37        70824      54860339
ENV38        111203     47238533
ENV39        100853     61087617
ENV4         92077      75704921
ENV40        106922     61770156
ENV41        63573      90690291
ENV42        72564      78889693
ENV43        62025      84269805
ENV44        13098      17821072
ENV45        70520      78321332
ENV46        107964     49612451
ENV47        112474     56239816
ENV48        104714     61471537
ENV49        80315      42383994
ENV5         71352      85924093
ENV50        100592     44026936
ENV51        42868      53350045
ENV52        41971      54595815
ENV53        57525      57099270
ENV54        96548      61577413
ENV55        34749      19351640
ENV56        95519      62347813
ENV57        77437      77250757
ENV58        88096      63503165
ENV59        86015      69415034
ENV6         89446      85595868
ENV60        103932     51292207
ENV61        38649      30834485
ENV62        109742     46065818
ENV63        90271      60826275
ENV64        101191     51605044
ENV65        94847      55460390
ENV66        78941      75739283
ENV67        26044      18692614
ENV68        79764      88158710
ENV69        84688      50186410
ENV7         81471      46642747
ENV70        84790      61830183
ENV71        61256      70472100
ENV72        108425     27381127
ENV73        91339      52810009
ENV74        90050      64683624
ENV75        95203      66660361
ENV76        1087       656996
ENV8         131425     31030486
ENV9         86241      70376740
EST1         159501     61802328
EST10        168134     72498533
EST100       234283     142207260
EST101       238416     125357643
EST102       190471     104524037
EST103       185405     102512021
EST104       102358     71151529
EST105       160793     120288276
EST106       172954     105839715
EST107       135195     84889899
EST108       63932      23808557
EST109       63338      22261354
EST11        169718     73902257
EST110       63851      23133136
EST111       63869      26850061
EST112       64350      23029356
EST113       64591      24539320
EST114       63594      26973296
EST115       63768      26213249
EST116       64045      27336000
EST117       63900      25168254
EST118       61272      33468948
EST119       120110     61654700
EST12        168171     70562476
EST120       160918     86030403
EST121       189573     92905024
EST122       149897     96429678
EST123       158964     93625481
EST124       131060     85292792
EST125       189731     90977142
EST126       156616     83256963
EST127       157606     84626488
EST128       157474     85058061
EST129       151469     85012025
EST13        68159      33128262
EST130       174360     93566480
EST131       183212     117004626
EST132       202734     102489563
EST133       160168     87329055
EST134       162723     82802419
EST135       142905     84071240
EST136       145152     91020923
EST137       95724      49779939
EST138       172650     97579590
EST139       246363     113921242
EST14        217521     109010297
EST140       155035     83724426
EST141       167476     92405508
EST142       150817     88087364
EST143       134567     82612779
EST144       154942     96512981
EST145       155663     85624347
EST146       124337     63552959
EST147       121379     65181915
EST148       127977     57789189
EST149       127278     51197745
EST15        169520     105890090
EST150       128607     51243662
EST151       112903     42077662
EST152       164083     82760221
EST153       176886     74093862
EST154       162695     110605072
EST155       201399     123493991
EST156       214798     122042152
EST157       175919     97141713
EST158       155519     108273923
EST159       140824     95500875
EST16        180150     112975551
EST160       155955     96062162
EST161       156878     82298794
EST162       138814     78221717
EST163       170100     94526013
EST164       66063      41392475
EST165       150537     92143835
EST166       192149     110457660
EST167       146218     84162790
EST168       143069     72546322
EST169       150241     87641155
EST17        195803     114265185
EST170       191316     104918234
EST171       156733     96077080
EST172       168081     82956066
EST173       127405     86848458
EST174       171524     100633913
EST175       173465     100373676
EST176       121166     67839530
EST177       157589     90755122
EST178       30450      17686529
EST179       170568     103118509
EST18        193392     121985081
EST180       181352     119524326
EST181       143933     116908484
EST182       194620     99430200
EST183       153365     103466307
EST184       155078     101588022
EST185       141146     81740929
EST186       176878     71875801
EST187       151084     84476316
EST188       157644     100342725
EST189       157072     96363131
EST19        158030     113128381
EST190       141299     84387034
EST191       157859     95261325
EST192       146219     93549248
EST193       129684     90614026
EST194       144281     88248903
EST195       136450     88924950
EST196       130162     93068057
EST197       163899     87140779
EST198       174664     96032797
EST199       174066     96943949
EST2         162336     61672462
EST20        190149     100202726
EST200       172165     96145828
EST201       169388     95510459
EST202       172287     95601673
EST203       174059     95360363
EST204       174613     96170706
EST205       18056      9729277
EST206       189439     105532431
EST207       206003     105139262
EST208       172523     102457315
EST209       180704     102079826
EST21        218416     107498844
EST210       201584     122977156
EST211       195409     112757013
EST212       192683     124220365
EST213       137495     92135436
EST214       219170     139800755
EST215       236134     119264223
EST216       161693     109365098
EST217       185708     100025668
EST218       205925     102642354
EST219       128176     93544718
EST22        191660     62905958
EST220       146820     85152276
EST221       209055     116581915
EST222       156434     101494956
EST223       107253     114180442
EST224       156403     101740224
EST225       161097     96967385
EST226       144774     102062981
EST227       220122     107819788
EST228       136748     97167081
EST229       121485     87294312
EST23        139279     39637472
EST230       136399     96087894
EST231       123149     88113611
EST232       144980     90830851
EST233       128961     88151255
EST234       140360     105277659
EST235       130899     91748673
EST236       124987     84442667
EST237       142948     89005962
EST238       162042     122032164
EST239       121458     117293874
EST24        102649     27798035
EST240       139574     103355216
EST241       178795     108158703
EST242       163193     101486512
EST243       160388     100748201
EST244       81857      48659913
EST245       165743     126106096
EST246       142529     105081001
EST247       158995     101000542
EST248       216815     95587075
EST249       178513     113609441
EST25        123140     51181925
EST250       159168     82288607
EST251       221637     34113142
EST252       215791     85695921
EST253       163406     123041183
EST254       172948     101636274
EST255       163626     108388587
EST256       113443     70048446
EST257       155705     114714805
EST258       185147     110486464
EST259       188020     98617474
EST26        214445     97482243
EST260       176893     111538403
EST261       165038     110055538
EST262       233516     110569572
EST263       278554     120545431
EST264       185464     112646961
EST265       188050     37111567
EST266       260184     124618859
EST267       63400      41680107
EST268       154798     99451947
EST269       168224     103084646
EST27        219635     110423077
EST270       167904     114485202
EST271       193310     101409496
EST272       162398     109152028
EST273       191545     111904332
EST274       201994     44437150
EST275       201834     48618488
EST276       184658     102906121
EST277       183097     119496766
EST278       175365     114356195
EST279       119484     67947308
EST28        190737     88630916
EST280       175268     113882661
EST281       175996     76711712
EST282       126864     80330566
EST283       135220     86671951
EST284       159480     98490681
EST285       260824     27489978
EST286       262143     26297272
EST287       144413     107417618
EST288       168987     110998808
EST289       159372     99749103
EST29        158216     69019364
EST290       161377     89114984
EST291       148499     13599783
EST292       204628     77303284
EST293       168845     106771665
EST294       175841     106211607
EST295       154349     101130559
EST296       201494     107856317
EST297       151936     110033981
EST298       167541     101405946
EST299       187043     114832813
EST3         151288     53609752
EST30        171901     69747746
EST300       179926     103642742
EST301       186906     97817894
EST302       184122     64376534
EST303       128682     45847397
EST304       183844     71393362
EST305       184790     69452325
EST306       184704     98970283
EST307       181703     130658116
EST308       144368     83149602
EST309       151788     93000325
EST31        150454     63756573
EST310       132019     100192520
EST311       161412     96189042
EST312       173306     99532094
EST313       149459     96692744
EST314       166722     94115748
EST315       160560     107552324
EST316       104896     74380426
EST317       164410     107656067
EST318       158156     110561183
EST319       181440     154123311
EST32        168409     76229915
EST320       170420     106825628
EST321       141561     79041683
EST322       142457     96859823
EST323       146268     99790933
EST324       135597     91080735
EST325       149441     100299769
EST326       150295     101304007
EST327       178767     108268816
EST328       148787     85614244
EST329       149549     85019483
EST33        176082     68240376
EST330       62852      39774128
EST331       151277     107728811
EST332       160928     97928885
EST333       143279     90734374
EST334       142770     89352999
EST335       208889     112249139
EST336       130151     71628576
EST337       91160      55043930
EST338       132653     87770148
EST339       138410     87820288
EST34        118262     40610189
EST340       124093     78887612
EST341       169662     85574267
EST342       211830     85034922
EST343       166518     88647883
EST344       107633     62457665
EST345       165319     103827306
EST346       143817     88514067
EST347       133279     88818911
EST348       136603     89303477
EST349       189701     121823912
EST35        96372      29580925
EST350       157231     96240649
EST351       156530     77982146
EST352       185861     129579649
EST353       113683     78214953
EST354       73463      43904051
EST355       139555     77266008
EST356       130652     78072726
EST357       149032     56110107
EST358       158620     32560137
EST359       45761      8960555
EST36        96776      30249543
EST360       154767     46398480
EST361       192001     123654733
EST362       248326     114994880
EST363       252248     115497248
EST364       176094     99679040
EST365       142711     92629900
EST366       138378     86404432
EST367       158379     94507462
EST368       195724     120253387
EST369       222229     58580352
EST37        95687      29024959
EST370       187268     114193190
EST371       10967      6401572
EST372       214500     117711833
EST373       203232     120931053
EST374       195439     105733088
EST375       150403     74493000
EST376       178758     118492954
EST377       180199     112636118
EST378       149767     117889801
EST379       181810     143569034
EST38        97559      29501615
EST380       154394     90427996
EST381       164974     106998500
EST382       191036     108892714
EST383       111689     59098014
EST384       205595     113531395
EST385       181247     107049326
EST386       206581     127862464
EST387       182851     119524898
EST388       205844     138126499
EST389       226658     130509311
EST39        97733      30979590
EST390       201229     139507287
EST391       209654     169373482
EST392       215383     131618681
EST393       160859     101029700
EST394       82671      36871748
EST395       174477     76829510
EST396       168996     13111626
EST397       154795     14217982
EST398       158542     32730315
EST399       158899     31877467
EST4         171413     67335709
EST40        27732      7103279
EST400       158349     33429040
EST401       147233     95953877
EST402       188373     113845684
EST403       161658     108638816
EST404       166047     102023549
EST405       148245     101920277
EST406       143101     100000048
EST407       143056     90055344
EST408       175723     125454045
EST409       143698     94013045
EST41        101354     52983819
EST410       178127     104257871
EST411       167931     26572462
EST412       167853     70008295
EST413       151767     108404458
EST414       170959     106396689
EST415       149032     92863692
EST416       170938     96405299
EST417       185556     126818505
EST418       139821     92509725
EST419       131690     90197439
EST42        119679     50944607
EST420       146817     90492705
EST421       162024     94873208
EST422       175807     94315739
EST423       153269     94600722
EST424       170275     96058521
EST425       173738     106475512
EST426       130515     85028722
EST427       102099     73342518
EST428       79181      60725311
EST429       113629     73705216
EST43        166411     92035027
EST430       155300     85175320
EST431       128165     77960341
EST432       137539     90949819
EST433       142150     83544436
EST434       167565     97619879
EST435       34532      23411614
EST436       180298     93949892
EST437       163091     105002024
EST438       155753     96645071
EST439       172149     77316804
EST44        170741     72307610
EST440       194623     107909294
EST441       153946     83777045
EST442       170824     99837571
EST443       219820     128445273
EST444       159407     108954471
EST445       167257     103237924
EST446       139980     90341000
EST447       135939     92043306
EST448       51718      29553427
EST449       208722     78109554
EST45        167909     85222351
EST450       187942     84001142
EST451       206223     88384547
EST452       197856     84050225
EST453       183152     113514098
EST454       182293     109285488
EST455       188587     113813612
EST456       199268     121771767
EST457       189851     94327601
EST458       187049     85406898
EST459       148761     89086137
EST46        168981     87083921
EST460       216863     124864934
EST461       162477     100516612
EST462       196788     122630217
EST463       168630     100603798
EST464       142425     106901292
EST465       155053     87692526
EST466       193525     99530589
EST467       140191     76119089
EST468       158028     85306208
EST469       184828     97744956
EST47        163899     88154817
EST470       170882     109578686
EST471       160058     89959221
EST472       172507     118654672
EST473       182557     121739405
EST474       195801     110325076
EST475       170534     59355036
EST476       161473     62768259
EST477       8177       2557485
EST48        162678     83090112
EST49        160165     91354602
EST5         169507     66374636
EST50        162211     88532255
EST51        157797     99194536
EST52        160055     70175772
EST53        147614     82718803
EST54        70506      46819630
EST55        167548     70092286
EST56        165237     74994470
EST57        165114     91162237
EST58        159416     97163031
EST59        156923     102318983
EST6         172145     67172196
EST60        165188     99297338
EST61        160342     108423810
EST62        172138     80382457
EST63        174091     93594472
EST64        155350     84274824
EST65        148814     81570765
EST66        159012     98452849
EST67        130826     74764422
EST68        150125     92006704
EST69        195985     108809274
EST7         170586     73077995
EST70        182679     95704632
EST71        222671     122066626
EST72        186924     112075552
EST73        203427     120494462
EST74        164684     90641415
EST75        132274     60462954
EST76        137545     67731396
EST77        158921     99525881
EST78        157441     96535688
EST79        142897     78852811
EST8         180023     73166733
EST80        44412      20659949
EST81        164121     100517447
EST82        212723     115158654
EST83        224875     124332798
EST84        201013     94600830
EST85        212108     93338952
EST86        161274     92988683
EST87        144313     87638363
EST88        164574     80863685
EST89        159050     80102807
EST9         169002     69438712
EST90        153983     102487388
EST91        151718     89343531
EST92        130193     83995916
EST93        155982     112884793
EST94        140616     102989254
EST95        141429     101168617
EST96        141402     97787871
EST97        146803     81613606
EST98        179817     111148175
EST99        223018     135238001
GSS1         200944     87996853
GSS10        132705     60745240
GSS100       145433     114443307
GSS101       141764     116180696
GSS102       143557     116922653
GSS103       168501     129420855
GSS104       146799     80635635
GSS105       192097     121271500
GSS106       168802     112804754
GSS107       197863     115906703
GSS108       204278     134281832
GSS109       209638     138123111
GSS11        137159     73866503
GSS110       207372     140789668
GSS111       206086     142315560
GSS112       205116     143591809
GSS113       204992     143856390
GSS114       202043     146587402
GSS115       182352     139818502
GSS116       17845      10587110
GSS117       133162     84221146
GSS118       170189     80224521
GSS119       183709     79256210
GSS12        148406     75892516
GSS120       170029     148127390
GSS121       177782     120711553
GSS122       180167     146216097
GSS123       187653     120747902
GSS124       186929     139031318
GSS125       192470     127348853
GSS126       192021     93457990
GSS127       167405     156241510
GSS128       163755     114149855
GSS129       60160      36266723
GSS13        145697     69144434
GSS130       170924     155391140
GSS131       172238     154355826
GSS132       172284     155048214
GSS133       173670     154060692
GSS134       171880     154915342
GSS135       180818     138727359
GSS136       178920     146931888
GSS137       165756     119158151
GSS138       190644     95937589
GSS139       258272     39831531
GSS14        171223     85489549
GSS140       258271     39806094
GSS141       93956      14435894
GSS142       255964     58806066
GSS143       260425     57449147
GSS144       191730     85708160
GSS145       196898     67820685
GSS146       186512     148755687
GSS147       182887     151529765
GSS148       168597     155742158
GSS149       171019     157769882
GSS15        161656     98232070
GSS150       238045     70591905
GSS151       226815     82624596
GSS152       129341     51996947
GSS153       209214     56380289
GSS154       157841     95882122
GSS155       181030     114522149
GSS156       135934     86658000
GSS157       166404     133078418
GSS158       184516     161559473
GSS159       194054     159477525
GSS16        173477     87330139
GSS160       191212     124836337
GSS161       217172     138250007
GSS162       221443     132912352
GSS163       159452     98265046
GSS164       42192      4852722
GSS165       87046      63874704
GSS166       83571      62792185
GSS167       103194     48366673
GSS168       68847      58582398
GSS169       8373       7548378
GSS17        184270     114513921
GSS170       68591      57924394
GSS171       69224      56650935
GSS172       69460      56187403
GSS173       71202      55998401
GSS174       68561      51865315
GSS175       75915      58209304
GSS176       86719      74437329
GSS177       81366      44383585
GSS178       92246      45017480
GSS179       64686      48313503
GSS18        192267     113918440
GSS180       77811      61666620
GSS181       70214      59194054
GSS182       68204      63291319
GSS183       62721      52920889
GSS184       94993      42349942
GSS185       19520      4539000
GSS186       112930     70870954
GSS187       830        565879
GSS188       23226      28867035
GSS189       109084     70678875
GSS19        107975     48381098
GSS190       84403      34582519
GSS191       35904      22282147
GSS192       103304     62490220
GSS193       102329     63761256
GSS194       104196     67611234
GSS195       82171      41322048
GSS196       83102      54651503
GSS197       95552      61239914
GSS198       107362     78589696
GSS199       106457     76738025
GSS2         182784     92562255
GSS20        181810     101786580
GSS200       106101     79982459
GSS201       104001     80014803
GSS202       75801      50678132
GSS203       105097     63619915
GSS204       109868     66415305
GSS205       105995     59196161
GSS206       68060      37226354
GSS207       69100      38526913
GSS208       38147      18321461
GSS209       85817      46213833
GSS21        166509     114370216
GSS210       97756      56282806
GSS211       94838      49467300
GSS212       96276      55952494
GSS213       41313      23149851
GSS214       114055     43442995
GSS215       116422     39251295
GSS216       108546     52732208
GSS217       108722     67128836
GSS218       101583     78242275
GSS219       56990      34054442
GSS22        170128     97970449
GSS220       96897      36918766
GSS221       96399      37676586
GSS222       97739      35452830
GSS223       95145      39751140
GSS224       33820      15967145
GSS225       103939     66277823
GSS226       94551      61190929
GSS227       95128      60357048
GSS228       94773      60868501
GSS229       75675      70017159
GSS23        187498     127408864
GSS230       80658      68522367
GSS231       32685      33693673
GSS232       83736      28233267
GSS233       84219      27346468
GSS234       84926      25909272
GSS235       14851      4422302
GSS236       16547      7508221
GSS237       94142      60608363
GSS238       97374      65482699
GSS239       96141      65699826
GSS24        195135     130446212
GSS240       87647      48537317
GSS241       96960      54078820
GSS242       89387      48759073
GSS243       35861      19580707
GSS244       90839      57016024
GSS245       89674      61866093
GSS246       88534      63668650
GSS247       89290      62493340
GSS248       9699       6996370
GSS249       87995      63795538
GSS25        177578     104708828
GSS250       90590      62742076
GSS251       94937      59925372
GSS252       74696      63777273
GSS253       84391      78676825
GSS254       82881      80793634
GSS255       69452      51663438
GSS256       114900     62956729
GSS257       109229     55656739
GSS258       107532     52126493
GSS259       99054      44380734
GSS26        187090     109211881
GSS260       109801     49060015
GSS261       97917      46046727
GSS262       73058      72226496
GSS263       77174      72621583
GSS264       92147      71194681
GSS265       24563      18498472
GSS266       92250      71055526
GSS267       85869      83025280
GSS268       83675      87061685
GSS269       82362      86366324
GSS27        168765     150895638
GSS270       87240      67099066
GSS271       90053      72027971
GSS272       91485      69770366
GSS273       92047      60724136
GSS274       16062      9801108
GSS275       94787      57200301
GSS276       93517      59081345
GSS277       93900      58510429
GSS278       94714      57307691
GSS279       83843      51265303
GSS28        190303     145368047
GSS280       104594     69753809
GSS281       105287     75065932
GSS282       110489     69020768
GSS283       108020     71887545
GSS284       110248     69302693
GSS285       101007     62842245
GSS286       106737     56950547
GSS287       89255      48313130
GSS29        152415     107509512
GSS3         175722     88078887
GSS30        192507     131687076
GSS31        10793      7107601
GSS32        196657     127651461
GSS33        217776     116759610
GSS34        219644     114213054
GSS35        220777     112664012
GSS36        214622     123365339
GSS37        199352     157077838
GSS38        195922     147426365
GSS39        191244     68588056
GSS4         167454     85331195
GSS40        185344     98001166
GSS41        190662     126767714
GSS42        171525     159218326
GSS43        6466       4247063
GSS44        184408     100513925
GSS45        173349     121932095
GSS46        183645     123777086
GSS47        189157     121128209
GSS48        73129      64254661
GSS49        172209     102210173
GSS5         50998      30384869
GSS50        168276     103464302
GSS51        168453     103104964
GSS52        182977     120640297
GSS53        184862     116613310
GSS54        180879     122036123
GSS55        186104     112852115
GSS56        190251     135469418
GSS57        178487     104480888
GSS58        193552     119354918
GSS59        179867     132156329
GSS6         162011     84658147
GSS60        5389       4914537
GSS61        173080     139097497
GSS62        162251     111940135
GSS63        162287     111957763
GSS64        157141     106504657
GSS65        156916     129183900
GSS66        170503     142796915
GSS67        179240     116632250
GSS68        202718     127006598
GSS69        193507     110487624
GSS7         165849     79606985
GSS70        244856     126494010
GSS71        160935     106885564
GSS72        159278     119591355
GSS73        162713     124578321
GSS74        162678     124640986
GSS75        175218     109076498
GSS76        190382     140117053
GSS77        13398      7917760
GSS78        197142     125263567
GSS79        169736     110844237
GSS8         165859     89017102
GSS80        199335     130669706
GSS81        211104     88692781
GSS82        190300     97184852
GSS83        132489     92556808
GSS84        146857     117960163
GSS85        139728     117087788
GSS86        142924     114044689
GSS87        144172     119953236
GSS88        141878     115747548
GSS89        107735     89811059
GSS9         138220     67303044
GSS90        149553     122345018
GSS91        147788     117792665
GSS92        144115     113155638
GSS93        142979     115531478
GSS94        144339     119769367
GSS95        148217     121718869
GSS96        147793     117902839
GSS97        146200     121153918
GSS98        146261     121035223
GSS99        146701     120155849
HTC1         25066      27061699
HTC10        70247      71350782
HTC11        72088      70025074
HTC12        26039      31623531
HTC13        67517      60542416
HTC14        69016      69665059
HTC15        41802      27314479
HTC2         16081      36236788
HTC3         16025      36618334
HTC4         16247      35550901
HTC5         15976      40340178
HTC6         16064      37464845
HTC7         53803      31435454
HTC8         31178      19512705
HTC9         60735      77635959
HTG1         1318       188778000
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1440       190959407
HTG113       1519       189543650
HTG114       1397       176295718
HTG115       1216       154301500
HTG116       1336       175258470
HTG117       1375       190219547
HTG118       1114       190209102
HTG119       990        162413998
HTG12        1452       184004673
HTG120       1554       186401663
HTG121       1914       189985793
HTG122       1002       187913882
HTG123       1077       193339478
HTG124       1101       193142353
HTG125       497        91954583
HTG126       1031       189469892
HTG127       1055       192678789
HTG128       1163       191852916
HTG129       1080       192395749
HTG13        875        191786413
HTG130       1084       193090210
HTG131       588        103686357
HTG132       1122       192519796
HTG133       1078       192373539
HTG134       1078       192352380
HTG135       1167       191892724
HTG136       2136       191389379
HTG137       1095       192378745
HTG138       1077       192076391
HTG139       1089       192350377
HTG14        753        191921309
HTG140       1037       190263835
HTG141       1360       160579458
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1148       192593691
HTG77        1188       192551497
HTG78        1069       180930974
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93677      48163215
INV10        49196      92651769
INV100       22654      170374262
INV101       4699       190767649
INV102       29376      152389625
INV103       55624      119361124
INV104       566        40635863
INV105       13289      185647176
INV106       46053      157012156
INV107       17685      178053678
INV108       29958      167222494
INV109       43085      157040531
INV11        64862      83242141
INV110       67211      137670443
INV111       6012       8834712
INV112       104664     106635585
INV113       74472      120962462
INV114       12151      167709556
INV115       18313      163694906
INV116       13693      93864118
INV117       29262      155753563
INV118       38610      149060814
INV119       51684      139700572
INV12        77642      62126762
INV120       70877      126444377
INV121       97323      108082698
INV122       125942     86452766
INV123       45538      112069284
INV124       1172       9472142
INV13        10936      10153961
INV14        84563      65946882
INV15        80773      66736807
INV16        78647      66831403
INV17        49209      46422964
INV18        26324      113806698
INV19        10787      140695972
INV2         53505      101210247
INV20        39462      115286072
INV21        77507      57089238
INV22        73465      62908645
INV23        8566       5586157
INV24        23048      127266204
INV25        6          133712559
INV26        56207      101423953
INV27        74913      49954489
INV28        65141      47428194
INV29        76972      54933816
INV3         1387       185692278
INV30        75627      57242266
INV31        77421      59797377
INV32        73144      50796147
INV33        48373      32052601
INV34        78916      56643003
INV35        75259      55983784
INV36        73909      61190088
INV37        77461      57925543
INV38        42056      26847853
INV39        78172      57026697
INV4         758        121577758
INV40        75092      57487842
INV41        47627      107307676
INV42        59108      145603139
INV43        85861      122172880
INV44        104234     106157516
INV45        117997     94139897
INV46        75536      51433827
INV47        35238      166584902
INV48        30754      171611440
INV49        27699      170888034
INV5         26859      110621350
INV50        2597       191028659
INV51        6185       191114217
INV52        17831      180089188
INV53        15380      184775326
INV54        6812       166786253
INV55        8875       189509571
INV56        15662      184182101
INV57        30722      171526293
INV58        65600      142208408
INV59        21638      22670137
INV6         78912      70615705
INV60        50224      153584896
INV61        4095       191102716
INV62        11177      184659675
INV63        29153      168751324
INV64        3317       189349389
INV65        6330       186171285
INV66        12367      180474553
INV67        39596      157268982
INV68        60755      142074593
INV69        67983      110944176
INV7         50756      93606545
INV70        93001      114614617
INV71        56274      146052731
INV72        16688      171579078
INV73        33874      156329130
INV74        82253      117982423
INV75        24999      174542393
INV76        32599      158648520
INV77        60222      139121472
INV78        13267      12603878
INV79        41258      162193552
INV8         44697      89648237
INV80        8649       189035299
INV81        14549      181577331
INV82        5295       188760704
INV83        18509      176900436
INV84        34351      158679406
INV85        14344      172158272
INV86        23577      45955779
INV87        16795      180349459
INV88        21027      172501512
INV89        4891       191046501
INV9         80277      71512786
INV90        26084      174037919
INV91        14547      181030545
INV92        44397      155376448
INV93        27112      171621394
INV94        19370      174154051
INV95        49371      138775955
INV96        29055      84543185
INV97        96245      108547326
INV98        35892      166944993
INV99        23159      177277868
MAM1         20671      155280509
MAM2         14456      164249988
MAM3         62613      79862604
MAM4         3397       188246673
MAM5         79922      74568984
MAM6         45438      132607766
MAM7         76091      61960871
MAM8         67844      72599660
MAM9         24616      27445573
PAT1         222549     70107814
PAT10        124428     102500926
PAT100       178342     3388498
PAT101       178198     3385762
PAT102       178185     3385515
PAT103       132610     2848492
PAT104       342935     8573375
PAT105       188806     88519660
PAT106       111348     132068608
PAT107       3850       194703659
PAT108       131292     110979300
PAT109       158599     54826034
PAT11        98990      64217374
PAT110       224686     34110691
PAT111       250080     15844307
PAT112       180710     63626618
PAT113       51662      26099509
PAT114       114162     110461578
PAT115       137635     83250401
PAT116       164248     98980200
PAT117       158391     103578605
PAT118       137595     115028683
PAT119       42623      28098564
PAT12        141821     62660332
PAT120       193712     81686401
PAT121       150217     108404022
PAT122       356051     11379688
PAT123       257211     57607099
PAT124       138161     48226925
PAT125       322021     22795469
PAT126       155639     102753887
PAT127       132727     110696284
PAT128       128341     121313309
PAT129       21664      184390005
PAT13        103913     59427456
PAT130       144888     112900567
PAT131       171997     96403773
PAT132       44618      171217879
PAT133       9167       47581637
PAT134       33645      178334734
PAT135       153558     109675196
PAT136       178705     90913377
PAT137       136049     115324159
PAT138       120392     123342367
PAT139       8527       8992390
PAT14        102689     49413434
PAT140       155429     101473147
PAT141       184764     88815933
PAT142       182409     85292093
PAT143       174403     93928365
PAT144       28829      20461016
PAT145       147929     108545966
PAT146       160945     101973668
PAT147       185311     90980420
PAT148       231649     49265020
PAT149       203540     47701039
PAT15        120398     52419852
PAT150       277765     9659534
PAT151       220400     46464910
PAT152       106913     2885992
PAT153       270386     21672571
PAT154       186717     61206554
PAT155       109745     106071993
PAT156       47606      9568509
PAT157       87243      88069835
PAT158       78300      95519827
PAT159       144657     77924556
PAT16        108578     62729521
PAT160       167880     71101104
PAT161       121229     93118099
PAT162       103339     85064233
PAT163       165824     46460344
PAT164       270022     5130418
PAT165       269978     5129582
PAT166       269978     5129582
PAT167       237888     4519872
PAT168       269396     5118524
PAT169       235458     25558526
PAT17        47620      17036782
PAT170       203677     47168292
PAT171       12112      425274
PAT172       165316     74866922
PAT173       91680      126651183
PAT174       172436     71668609
PAT175       213537     66908153
PAT176       42479      48674903
PAT177       235138     59544089
PAT178       123750     125093767
PAT179       217500     66593101
PAT18        146771     52594264
PAT180       109061     85077809
PAT181       93072      87231074
PAT182       91814      79965559
PAT183       83779      91675964
PAT184       108702     54187286
PAT185       101031     56670672
PAT186       150189     24631215
PAT187       93817      82459162
PAT188       26010      162900357
PAT189       113945     65760402
PAT19        153705     78039102
PAT190       81612      28134170
PAT191       3631       191518875
PAT192       84408      78157905
PAT193       145070     26290630
PAT194       76957      99954295
PAT195       95301      71301981
PAT196       129710     31538759
PAT197       102730     55692600
PAT198       86789      129976514
PAT199       158943     78754622
PAT2         194512     84659689
PAT20        104712     118084998
PAT200       213428     47116400
PAT201       169395     66576733
PAT202       59674      8565524
PAT203       161907     78478468
PAT204       120049     100582858
PAT205       86563      129136442
PAT206       37994      167166650
PAT207       35971      168657367
PAT208       75246      137662390
PAT209       252342     29172458
PAT21        133771     95335685
PAT210       137370     91937920
PAT211       148393     82273217
PAT212       141920     75236084
PAT213       139425     87026770
PAT214       120863     69668731
PAT22        84660      79577049
PAT23        123520     103391176
PAT24        119457     105503971
PAT25        145180     86775077
PAT26        175026     64349553
PAT27        71817      1795425
PAT28        102159     77384755
PAT29        93962      87602065
PAT3         171980     95897348
PAT30        119896     61652493
PAT31        96713      78968816
PAT32        128327     55026425
PAT33        92078      51061056
PAT34        117817     69178922
PAT35        120074     35731074
PAT36        105217     64605942
PAT37        160331     21522893
PAT38        135726     41793820
PAT39        102902     65253751
PAT4         153750     106057444
PAT40        26087      19300328
PAT41        95720      83164078
PAT42        100235     70852545
PAT43        136071     39459525
PAT44        143788     35448269
PAT45        123821     64575799
PAT46        104398     81176714
PAT47        93299      74375876
PAT48        113234     66602624
PAT49        65388      54850684
PAT5         57146      23927792
PAT50        135190     107997552
PAT51        167081     97032794
PAT52        116397     127554608
PAT53        196336     76726384
PAT54        80312      127991532
PAT55        27631      180872621
PAT56        185408     93066629
PAT57        274259     6856475
PAT58        129447     31627433
PAT59        161320     77719729
PAT6         170642     91909261
PAT60        92713      89265037
PAT61        106333     74864097
PAT62        122365     64031899
PAT63        67704      30353662
PAT64        70749      109767380
PAT65        87947      82758205
PAT66        92970      78936927
PAT67        93166      72442104
PAT68        93383      75086630
PAT69        115772     60531684
PAT7         154738     88213615
PAT70        102742     9941933
PAT71        175930     10547617
PAT72        171510     10872561
PAT73        171496     10866737
PAT74        99862      86225235
PAT75        99         196466297
PAT76        67         192869889
PAT77        103        195600591
PAT78        1136       196318666
PAT79        97600      5772327
PAT8         131237     96851718
PAT80        151009     9636510
PAT81        151022     9621259
PAT82        151024     9622125
PAT83        151021     9620837
PAT84        94629      88051226
PAT85        92263      94524908
PAT86        37554      34674771
PAT87        83459      93185861
PAT88        15566      180450125
PAT89        164892     19209750
PAT9         129050     101178982
PAT90        178944     3399936
PAT91        177434     3371246
PAT92        175305     3330795
PAT93        101401     1926619
PAT94        169167     12412170
PAT95        178699     3395281
PAT96        178691     3395129
PAT97        178677     3394863
PAT98        140784     2674896
PAT99        178683     3394977
PHG1         5926       104252441
PHG2         2820       47823312
PLN1         59840      93477626
PLN10        34362      32335600
PLN11        72961      75782099
PLN12        37380      49244028
PLN13        40169      65477126
PLN14        22688      123589497
PLN15        21110      100271020
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        24729      127753568
PLN2         74531      77802011
PLN20        5972       146407780
PLN21        1288       168147499
PLN22        1448       166987774
PLN23        19861      31784626
PLN24        66950      69783372
PLN25        30121      32284575
PLN26        76764      76393835
PLN27        64712      80274615
PLN28        61719      100469289
PLN29        76         95744252
PLN3         23864      120267500
PLN30        3          61743175
PLN31        54         123504479
PLN32        1024       148315095
PLN33        26316      132447821
PLN34        46390      104833707
PLN35        74947      77532929
PLN36        98092      54851102
PLN37        5091       5201764
PLN38        80241      71535919
PLN39        77624      75761242
PLN4         1398       182075938
PLN40        80130      70327849
PLN41        81887      75372134
PLN42        59040      32868591
PLN43        98835      55164078
PLN44        82314      68391756
PLN45        45177      99055350
PLN46        14523      131122179
PLN47        29486      121082048
PLN48        54425      103665237
PLN49        16638      12380968
PLN5         1925       187878745
PLN50        80920      72374721
PLN51        17271      12728877
PLN52        49276      72547363
PLN53        24834      110297149
PLN54        8677       81952811
PLN55        1          774434471
PLN56        5715       25970922
PLN57        118        169233481
PLN58        2          152611319
PLN59        2          138722045
PLN6         1790       194428323
PLN60        2          149838828
PLN61        2          166587449
PLN62        3          149684797
PLN63        2          140233034
PLN64        3          193941464
PLN65        3          174353790
PLN66        3          185895354
PLN67        12231      75939632
PLN68        82224      65216579
PLN69        93239      57624575
PLN7         1715       194044842
PLN70        21004      14879055
PLN71        77358      71128525
PLN72        70360      84171759
PLN73        77182      67587803
PLN74        70632      76334046
PLN75        80033      66531373
PLN76        2771       2910705
PLN77        78184      63261166
PLN78        74991      69899088
PLN79        85493      53406880
PLN8         1843       186226446
PLN80        77855      62223072
PLN81        17868      17003159
PLN82        73386      63347656
PLN83        63094      85282213
PLN84        71014      71090560
PLN85        68829      74520654
PLN86        67887      73483505
PLN87        42525      93798059
PLN88        43531      98348742
PLN89        462        771904
PLN9         64011      89942212
PRI1         23015      59713048
PRI10        1257       179241810
PRI11        833        100318747
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         20371      146784391
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2081       192786782
PRI23        19249      53355697
PRI24        31503      84573688
PRI25        61947      78196699
PRI26        31351      70630978
PRI27        8758       172032991
PRI28        2266       191526296
PRI29        1665       190822059
PRI3         1437       174787355
PRI30        2074       192136957
PRI31        2195       191096868
PRI32        13058      162285387
PRI33        2069       170706451
PRI34        58141      87769110
PRI35        5440       11201834
PRI36        32168      63556677
PRI37        20521      119079375
PRI38        18997      150394788
PRI39        67644      85452001
PRI4         1279       185781200
PRI40        50079      89398719
PRI41        41724      80792719
PRI42        47295      95802799
PRI43        26856      101025387
PRI44        28740      109040505
PRI45        24058      104490491
PRI46        24404      109271538
PRI47        55107      101596038
PRI48        26487      53647763
PRI5         1330       184387932
PRI6         1181       179836578
PRI7         1230       180381409
PRI8         1224       178923163
PRI9         1368       174994470
ROD1         35469      135698584
ROD10        989        181785330
ROD11        274        51819052
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15471      159009698
ROD2         911        175679240
ROD20        1345       2479415
ROD21        20403      157183388
ROD22        1220       193673930
ROD23        937        147781632
ROD24        15483      168704201
ROD25        37934      68967788
ROD26        20939      110592136
ROD27        1537       193206645
ROD28        146098     23768480
ROD29        77907      76152032
ROD3         908        173297323
ROD30        84294      55022841
ROD31        25686      30488992
ROD4         901        173510973
ROD5         918        174544273
ROD6         964        177696357
ROD7         973        179433962
ROD8         974        181270850
ROD9         996        181755035
STS1         85196      36722081
STS10        57907      44420216
STS11        48911      37504044
STS12        57924      43637361
STS13        64252      42835959
STS14        93605      34191669
STS15        104286     26516216
STS16        10149      2749278
STS17        103700     27504029
STS18        97685      33626536
STS19        96674      34551817
STS2         84232      49870847
STS20        70895      25046211
STS3         66815      26313217
STS4         77160      36965654
STS5         8578       5032880
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55715      37766563
SYN1         37852      77659932
SYN2         48035      69615204
SYN3         18853      140932854
SYN4         4596       176589214
SYN5         4592       176497773
SYN6         4601       176505918
SYN7         18112      145775765
SYN8         8792       14885454
TSA1         120229     38175118
TSA10        18501      20932212
TSA100       74245      86358066
TSA101       80229      75622518
TSA102       84814      72313292
TSA103       77875      83688591
TSA104       94381      51984420
TSA105       99491      69631030
TSA106       58883      96679889
TSA107       109175     49378845
TSA108       67235      70100321
TSA109       80973      89066314
TSA11        134181     34620238
TSA110       71986      75798561
TSA111       57381      120398744
TSA112       106689     67779914
TSA113       93410      83369889
TSA114       98615      76609458
TSA115       88033      68056906
TSA116       85151      59462891
TSA117       81070      64429989
TSA118       80698      77547215
TSA119       99858      58424981
TSA12        60167      20022990
TSA120       94376      41918451
TSA121       77601      56951333
TSA122       38151      36214597
TSA123       64087      65481741
TSA124       62776      67314514
TSA125       62796      68082050
TSA126       83597      81259826
TSA127       77368      53642425
TSA128       52890      45157231
TSA129       78372      34800123
TSA13        64386      59430252
TSA130       74749      67769223
TSA131       81134      78516520
TSA132       74738      64368149
TSA133       41094      34067132
TSA134       87573      70203780
TSA135       88950      68200532
TSA136       84674      76995574
TSA137       76777      81340708
TSA138       12114      10094014
TSA139       104187     53670971
TSA14        92644      61562171
TSA140       81024      61412061
TSA141       69807      78230935
TSA142       73068      68063462
TSA143       87167      75197912
TSA144       89965      70421878
TSA145       62321      102799580
TSA146       95551      74305126
TSA147       20005      13967517
TSA148       83185      63773173
TSA149       83474      63810105
TSA15        86754      43106045
TSA150       78951      73455247
TSA151       76902      76048404
TSA152       93312      58446350
TSA153       101619     67459481
TSA154       101353     67250639
TSA155       98496      71013164
TSA156       64447      47791535
TSA16        76033      85960467
TSA17        91374      65685049
TSA18        101188     63895895
TSA19        99199      71603379
TSA2         112872     41354278
TSA20        96495      30215491
TSA21        85797      70106183
TSA22        120080     38852195
TSA23        135073     34045322
TSA24        52641      68389460
TSA25        47693      62712879
TSA26        2567       4355759
TSA27        60987      81840924
TSA28        93007      67047844
TSA29        109158     50156094
TSA3         109738     40819744
TSA30        105985     49608229
TSA31        101802     53927291
TSA32        104196     47869725
TSA33        25155      16078008
TSA34        66195      59263498
TSA35        92595      67984800
TSA36        92725      62222647
TSA37        79900      85994127
TSA38        99632      49714517
TSA39        113604     34184810
TSA4         110871     47429155
TSA40        95081      67746092
TSA41        13342      8212550
TSA42        94353      35365815
TSA43        77391      35904179
TSA44        106332     43403178
TSA45        113806     45488371
TSA46        29846      20501254
TSA47        105735     50140224
TSA48        100655     54491793
TSA49        94817      63356575
TSA5         76764      23186803
TSA50        83277      83596257
TSA51        63297      25469672
TSA52        90365      71288560
TSA53        97490      54396288
TSA54        60102      105473410
TSA55        87072      65322428
TSA56        78659      70601613
TSA57        83093      72167197
TSA58        82780      72071571
TSA59        68825      90745962
TSA6         111583     58975350
TSA60        90777      66753345
TSA61        75897      84474971
TSA62        71863      73184540
TSA63        68804      60806651
TSA64        84938      78092730
TSA65        85242      78226283
TSA66        70135      97561426
TSA67        85540      69665112
TSA68        84998      51586540
TSA69        102325     68656057
TSA7         87421      57901423
TSA70        87168      58768010
TSA71        103817     56958943
TSA72        73541      73023551
TSA73        78857      44745962
TSA74        87334      79220475
TSA75        91715      69203605
TSA76        78648      53425286
TSA77        79096      57205952
TSA78        97059      60761749
TSA79        38217      34954526
TSA8         104450     72517643
TSA80        89257      76980939
TSA81        95080      55375897
TSA82        110846     44819766
TSA83        97242      58062900
TSA84        65163      96953256
TSA85        15112      14609211
TSA86        101771     55749724
TSA87        91255      53861952
TSA88        93762      43609024
TSA89        85674      74282228
TSA9         109298     60842426
TSA90        73021      72120161
TSA91        39594      46201075
TSA92        77437      80992651
TSA93        77545      54883790
TSA94        84159      38595329
TSA95        76607      52796861
TSA96        66522      67080686
TSA97        64005      75825743
TSA98        87314      55376103
TSA99        51068      27412276
UNA1         321        187345
VRL1         65151      70950950
VRL10        45394      73279699
VRL11        63020      71819892
VRL12        68630      66510392
VRL13        61473      72660038
VRL14        21511      31475164
VRL15        62817      70987390
VRL16        57376      72695530
VRL17        63063      64438902
VRL18        56322      73614536
VRL19        49957      63620664
VRL2         68682      63539672
VRL20        54774      72380832
VRL21        58649      71301246
VRL22        55810      73818112
VRL23        55711      73381665
VRL24        27378      44882247
VRL25        52734      75165858
VRL26        37956      81954577
VRL27        47872      75025153
VRL28        48660      73753086
VRL29        47357      78137104
VRL3         72204      61300043
VRL30        52460      78536628
VRL31        43106      81305823
VRL32        52311      62299782
VRL4         69598      66342354
VRL5         69185      67501528
VRL6         11044      17312651
VRL7         48105      77431957
VRL8         46613      71842787
VRL9         43897      71389922
VRT1         61313      88185267
VRT10        1315       193425979
VRT11        8959       180746809
VRT12        3172       106288468
VRT13        13368      172113838
VRT14        5824       185111232
VRT15        3792       188758191
VRT16        49297      115685140
VRT17        79222      69240559
VRT18        77129      66214368
VRT19        20651      15335218
VRT2         1210       194253248
VRT20        71481      76164397
VRT21        44683      123197872
VRT22        77220      63113270
VRT23        78854      62003429
VRT24        81707      57848110
VRT25        32204      22372141
VRT26        102759     66000781
VRT27        81129      56103795
VRT28        85557      58035263
VRT29        60214      45248102
VRT3         57770      105881470
VRT30        90814      53415498
VRT31        74864      58197531
VRT32        725        488896
VRT33        74155      57572791
VRT34        82705      53940472
VRT35        4304       180704918
VRT36        8          189842922
VRT37        11         194097899
VRT38        10         183095788
VRT39        141        196691825
VRT4         16114      163638300
VRT40        358        196367729
VRT41        2023       195132441
VRT42        2494       194688682
VRT43        7265       188681002
VRT44        12422      11796716
VRT5         39110      67554295
VRT6         72899      66620175
VRT7         31774      63578618
VRT8         30887      112591732
VRT9         1264       193552177

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 204.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

20675585 17651170272   Homo sapiens
9725981   9994728442   Mus musculus
2193513   6525666528   Rattus norvegicus
2203199   5391740663   Bos taurus
4176651   5200861481   Zea mays
3296640   4894536270   Sus scrofa
1727352   3128079359   Danio rerio
1796314   1925803360   Triticum aestivum
204734    1835755282   Cyprinus carpio
744416    1743233122   Solanum lycopersicum
1332169   1617554059   Hordeum vulgare subsp. vulgare
257615    1435263769   Strongylocentrotus purpuratus
456854    1297394029   Macaca mulatta
1376364   1265495507   Oryza sativa Japonica Group
489700    1263739301   Spirometra erinaceieuropaei
1588343   1249792499   Xenopus (Silurana) tropicalis
1778623   1200304730   Nicotiana tabacum
2434122   1186095503   Arabidopsis thaliana
1267620   1156320489   Drosophila melanogaster
814723    1075162087   Vitis vinifera

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2014

                NCBI-GenBank Flat File Release 204.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         October 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ02).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


   Benson DA, Clark K, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW.
   GenBank. Nucleic Acids Res. 42(Database issue):D32-7 (2014)

   DOI:  10.1093/nar/gkt1030
   PMID: 24217914

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 42(Database issue), D32-7 (2014)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 204.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Brenda Chow, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Irene Fang, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, J. Bradley Holmes,
	Jonathan Kans, Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh,
	Jim Ostell, Vasuki Palanigobu, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov,
	Elena Starchenko, Hanzhen Sun, Tatiana Tatusova, Kamen Todorov,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center