Release Notes For GenBank Release 206

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2015

               NCBI-GenBank Flat File Release 206.0

                    Distribution Release Notes

 181336445 loci, 187893826750 bases, from 181336445 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 206.0
1.2 Cutoff Date
1.3 Important Changes in Release 206.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 206.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 206.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 206.0, incorporates data processed by the INSDC databases
as of Friday February 13, 2015 at approximately 1:33am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 206.0

1.3.1 Organizational changes

The total number of sequence data files increased by 46 with this release:

  - the BCT division is now composed of 169 files (+10)
  - the CON division is now composed of 303 files (+11)
  - the ENV division is now composed of  80 files (+2)
  - the GSS division is now composed of 293 files (+4)
  - the INV division is now composed of 133 files (+1)
  - the PAT division is now composed of 217 files (+3)
  - the PLN division is now composed of  96 files (+1)
  - the TSA division is now composed of 172 files (+13)
  - the VRT division is now composed of  45 files (+1)

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 125
of the GSS flatfiles in Release 206.0. Consider gbgss169.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2015

                NCBI-GenBank Flat File Release 206.0

                           GSS Sequences (Part 1)

   87049 loci,    63866074 bases, from    87049 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "169" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be phased out (slowly!) at NCBI

  The numeric GI sequence identifier that NCBI assigns to all nucleotide
and protein sequences was first introduced for GenBank Release products
as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for nearly 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who utilize
GIs in their own information systems and analysis pipelines, so it will not be
introduced quickly. You can expect that a great deal of additional detail will
be made available via NCBI's various announcement mechanisms.

  *This* particular announcement is chiefly intended to provide some advance
warning to our users. There _will_ be classes of GenBank sequences that
are not assigned GIs in the not-too-distant future. If GIs are central to
your operations, then it might be appropriate to begin planning a switch to
the use of Accession.Version identifiers instead.

  And in fact, NCBI now has several WGS submissions for which GIs have
not been assigned, for both the contigs and the scaffolds.

  For example: Here are excerpts of the flatfile representation for the
first ALWZ02 (second assembly-version of the ALWZ project) contig, and the
'singleton' scaffold which is constructed from it:

LOCUS       ALWZ020000001            701 bp    DNA     linear   PLN 28-MAY-2013
DEFINITION  Picea glauca contig316_0, whole genome shotgun sequence.
ACCESSION   ALWZ020000001 ALWZ020000000
VERSION     ALWZ020000001.1
DBLINK      BioProject: PRJNA83435
....
ORIGIN      
        1 cgttgtgttg gggcacccaa ccttggtgag gccgtattaa aaagtctacc tccaagccaa
       61 aatttgttct tatccatcct ccaactcgtc tttttgccta gtgctcccct atgtggacgt
      121 tttcgttgtg gaggagtttt tcgtttgggc gcccatcttg cgaactcacc ttgcattgcg
      181 tttggtcgcc caacttgtga acgtgccttg gattgcgttg gggcgcccaa gttgcggacg
      241 tgcggacgtg cctttctttg ccgacatgcc ttgcgtttgc gttgcggacg tgcaatgggg
      301 cccccagctt gctgacgtgc cttgcgttgc gttggggtgc ccaacttgcc gacgtgcctt
      361 gcgttgcgtt ggggcaccca accttggtga ggccgtatta aaaagtctac ctccaagata
      421 aaatttgttc ttatccatcc tctagctctt cttttagcct agtgctccct tgtgtggaca
      481 ttttcgttgt ggatcatttt ttcgtttagg tgcccatctt gcagacaagc cttgcgttgc
      541 gtttgggcac ccatcttgcg gacgcgcctt tcattgcgtt ggggcgccca acgttggtga
      601 ggccgtatta aaaagtctac ctccaagaca aaatttgttc ttatccatcc tccatctcgt
      661 ctttttgcct agtgctccct tgtgtggacg ttttcgttgc g
//

LOCUS       ALWZ02S0000001           701 bp    DNA     linear   CON 14-JUN-2013
DEFINITION  Picea glauca scaffold316, whole genome shotgun sequence.
ACCESSION   ALWZ02S0000001 ALWZ000000000
VERSION     ALWZ02S0000001.1
DBLINK      BioProject: PRJNA83435
....
CONTIG      join(ALWZ020000001.1:1..701)
//


**Note the absence of a GI value on the VERSION line of these two records**

Sample URLs from which ALWZ02 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ02#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ02S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.1.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.1.gbff.gz

Unannotated WGS projects consisting of many millions of contigs and 
scaffolds represent the first class of records for which GIs are no
longer being assigned. But the practice will ultimately expand to
include other classes of records.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2297 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct18.seq - Bacterial sequence entries, part 18.
81. gbbct19.seq - Bacterial sequence entries, part 19.
82. gbbct2.seq - Bacterial sequence entries, part 2.
83. gbbct20.seq - Bacterial sequence entries, part 20.
84. gbbct21.seq - Bacterial sequence entries, part 21.
85. gbbct22.seq - Bacterial sequence entries, part 22.
86. gbbct23.seq - Bacterial sequence entries, part 23.
87. gbbct24.seq - Bacterial sequence entries, part 24.
88. gbbct25.seq - Bacterial sequence entries, part 25.
89. gbbct26.seq - Bacterial sequence entries, part 26.
90. gbbct27.seq - Bacterial sequence entries, part 27.
91. gbbct28.seq - Bacterial sequence entries, part 28.
92. gbbct29.seq - Bacterial sequence entries, part 29.
93. gbbct3.seq - Bacterial sequence entries, part 3.
94. gbbct30.seq - Bacterial sequence entries, part 30.
95. gbbct31.seq - Bacterial sequence entries, part 31.
96. gbbct32.seq - Bacterial sequence entries, part 32.
97. gbbct33.seq - Bacterial sequence entries, part 33.
98. gbbct34.seq - Bacterial sequence entries, part 34.
99. gbbct35.seq - Bacterial sequence entries, part 35.
100. gbbct36.seq - Bacterial sequence entries, part 36.
101. gbbct37.seq - Bacterial sequence entries, part 37.
102. gbbct38.seq - Bacterial sequence entries, part 38.
103. gbbct39.seq - Bacterial sequence entries, part 39.
104. gbbct4.seq - Bacterial sequence entries, part 4.
105. gbbct40.seq - Bacterial sequence entries, part 40.
106. gbbct41.seq - Bacterial sequence entries, part 41.
107. gbbct42.seq - Bacterial sequence entries, part 42.
108. gbbct43.seq - Bacterial sequence entries, part 43.
109. gbbct44.seq - Bacterial sequence entries, part 44.
110. gbbct45.seq - Bacterial sequence entries, part 45.
111. gbbct46.seq - Bacterial sequence entries, part 46.
112. gbbct47.seq - Bacterial sequence entries, part 47.
113. gbbct48.seq - Bacterial sequence entries, part 48.
114. gbbct49.seq - Bacterial sequence entries, part 49.
115. gbbct5.seq - Bacterial sequence entries, part 5.
116. gbbct50.seq - Bacterial sequence entries, part 50.
117. gbbct51.seq - Bacterial sequence entries, part 51.
118. gbbct52.seq - Bacterial sequence entries, part 52.
119. gbbct53.seq - Bacterial sequence entries, part 53.
120. gbbct54.seq - Bacterial sequence entries, part 54.
121. gbbct55.seq - Bacterial sequence entries, part 55.
122. gbbct56.seq - Bacterial sequence entries, part 56.
123. gbbct57.seq - Bacterial sequence entries, part 57.
124. gbbct58.seq - Bacterial sequence entries, part 58.
125. gbbct59.seq - Bacterial sequence entries, part 59.
126. gbbct6.seq - Bacterial sequence entries, part 6.
127. gbbct60.seq - Bacterial sequence entries, part 60.
128. gbbct61.seq - Bacterial sequence entries, part 61.
129. gbbct62.seq - Bacterial sequence entries, part 62.
130. gbbct63.seq - Bacterial sequence entries, part 63.
131. gbbct64.seq - Bacterial sequence entries, part 64.
132. gbbct65.seq - Bacterial sequence entries, part 65.
133. gbbct66.seq - Bacterial sequence entries, part 66.
134. gbbct67.seq - Bacterial sequence entries, part 67.
135. gbbct68.seq - Bacterial sequence entries, part 68.
136. gbbct69.seq - Bacterial sequence entries, part 69.
137. gbbct7.seq - Bacterial sequence entries, part 7.
138. gbbct70.seq - Bacterial sequence entries, part 70.
139. gbbct71.seq - Bacterial sequence entries, part 71.
140. gbbct72.seq - Bacterial sequence entries, part 72.
141. gbbct73.seq - Bacterial sequence entries, part 73.
142. gbbct74.seq - Bacterial sequence entries, part 74.
143. gbbct75.seq - Bacterial sequence entries, part 75.
144. gbbct76.seq - Bacterial sequence entries, part 76.
145. gbbct77.seq - Bacterial sequence entries, part 77.
146. gbbct78.seq - Bacterial sequence entries, part 78.
147. gbbct79.seq - Bacterial sequence entries, part 79.
148. gbbct8.seq - Bacterial sequence entries, part 8.
149. gbbct80.seq - Bacterial sequence entries, part 80.
150. gbbct81.seq - Bacterial sequence entries, part 81.
151. gbbct82.seq - Bacterial sequence entries, part 82.
152. gbbct83.seq - Bacterial sequence entries, part 83.
153. gbbct84.seq - Bacterial sequence entries, part 84.
154. gbbct85.seq - Bacterial sequence entries, part 85.
155. gbbct86.seq - Bacterial sequence entries, part 86.
156. gbbct87.seq - Bacterial sequence entries, part 87.
157. gbbct88.seq - Bacterial sequence entries, part 88.
158. gbbct89.seq - Bacterial sequence entries, part 89.
159. gbbct9.seq - Bacterial sequence entries, part 9.
160. gbbct90.seq - Bacterial sequence entries, part 90.
161. gbbct91.seq - Bacterial sequence entries, part 91.
162. gbbct92.seq - Bacterial sequence entries, part 92.
163. gbbct93.seq - Bacterial sequence entries, part 93.
164. gbbct94.seq - Bacterial sequence entries, part 94.
165. gbbct95.seq - Bacterial sequence entries, part 95.
166. gbbct96.seq - Bacterial sequence entries, part 96.
167. gbbct97.seq - Bacterial sequence entries, part 97.
168. gbbct98.seq - Bacterial sequence entries, part 98.
169. gbbct99.seq - Bacterial sequence entries, part 99.
170. gbchg.txt - Accession numbers of entries updated since the previous release.
171. gbcon1.seq - Constructed sequence entries, part 1.
172. gbcon10.seq - Constructed sequence entries, part 10.
173. gbcon100.seq - Constructed sequence entries, part 100.
174. gbcon101.seq - Constructed sequence entries, part 101.
175. gbcon102.seq - Constructed sequence entries, part 102.
176. gbcon103.seq - Constructed sequence entries, part 103.
177. gbcon104.seq - Constructed sequence entries, part 104.
178. gbcon105.seq - Constructed sequence entries, part 105.
179. gbcon106.seq - Constructed sequence entries, part 106.
180. gbcon107.seq - Constructed sequence entries, part 107.
181. gbcon108.seq - Constructed sequence entries, part 108.
182. gbcon109.seq - Constructed sequence entries, part 109.
183. gbcon11.seq - Constructed sequence entries, part 11.
184. gbcon110.seq - Constructed sequence entries, part 110.
185. gbcon111.seq - Constructed sequence entries, part 111.
186. gbcon112.seq - Constructed sequence entries, part 112.
187. gbcon113.seq - Constructed sequence entries, part 113.
188. gbcon114.seq - Constructed sequence entries, part 114.
189. gbcon115.seq - Constructed sequence entries, part 115.
190. gbcon116.seq - Constructed sequence entries, part 116.
191. gbcon117.seq - Constructed sequence entries, part 117.
192. gbcon118.seq - Constructed sequence entries, part 118.
193. gbcon119.seq - Constructed sequence entries, part 119.
194. gbcon12.seq - Constructed sequence entries, part 12.
195. gbcon120.seq - Constructed sequence entries, part 120.
196. gbcon121.seq - Constructed sequence entries, part 121.
197. gbcon122.seq - Constructed sequence entries, part 122.
198. gbcon123.seq - Constructed sequence entries, part 123.
199. gbcon124.seq - Constructed sequence entries, part 124.
200. gbcon125.seq - Constructed sequence entries, part 125.
201. gbcon126.seq - Constructed sequence entries, part 126.
202. gbcon127.seq - Constructed sequence entries, part 127.
203. gbcon128.seq - Constructed sequence entries, part 128.
204. gbcon129.seq - Constructed sequence entries, part 129.
205. gbcon13.seq - Constructed sequence entries, part 13.
206. gbcon130.seq - Constructed sequence entries, part 130.
207. gbcon131.seq - Constructed sequence entries, part 131.
208. gbcon132.seq - Constructed sequence entries, part 132.
209. gbcon133.seq - Constructed sequence entries, part 133.
210. gbcon134.seq - Constructed sequence entries, part 134.
211. gbcon135.seq - Constructed sequence entries, part 135.
212. gbcon136.seq - Constructed sequence entries, part 136.
213. gbcon137.seq - Constructed sequence entries, part 137.
214. gbcon138.seq - Constructed sequence entries, part 138.
215. gbcon139.seq - Constructed sequence entries, part 139.
216. gbcon14.seq - Constructed sequence entries, part 14.
217. gbcon140.seq - Constructed sequence entries, part 140.
218. gbcon141.seq - Constructed sequence entries, part 141.
219. gbcon142.seq - Constructed sequence entries, part 142.
220. gbcon143.seq - Constructed sequence entries, part 143.
221. gbcon144.seq - Constructed sequence entries, part 144.
222. gbcon145.seq - Constructed sequence entries, part 145.
223. gbcon146.seq - Constructed sequence entries, part 146.
224. gbcon147.seq - Constructed sequence entries, part 147.
225. gbcon148.seq - Constructed sequence entries, part 148.
226. gbcon149.seq - Constructed sequence entries, part 149.
227. gbcon15.seq - Constructed sequence entries, part 15.
228. gbcon150.seq - Constructed sequence entries, part 150.
229. gbcon151.seq - Constructed sequence entries, part 151.
230. gbcon152.seq - Constructed sequence entries, part 152.
231. gbcon153.seq - Constructed sequence entries, part 153.
232. gbcon154.seq - Constructed sequence entries, part 154.
233. gbcon155.seq - Constructed sequence entries, part 155.
234. gbcon156.seq - Constructed sequence entries, part 156.
235. gbcon157.seq - Constructed sequence entries, part 157.
236. gbcon158.seq - Constructed sequence entries, part 158.
237. gbcon159.seq - Constructed sequence entries, part 159.
238. gbcon16.seq - Constructed sequence entries, part 16.
239. gbcon160.seq - Constructed sequence entries, part 160.
240. gbcon161.seq - Constructed sequence entries, part 161.
241. gbcon162.seq - Constructed sequence entries, part 162.
242. gbcon163.seq - Constructed sequence entries, part 163.
243. gbcon164.seq - Constructed sequence entries, part 164.
244. gbcon165.seq - Constructed sequence entries, part 165.
245. gbcon166.seq - Constructed sequence entries, part 166.
246. gbcon167.seq - Constructed sequence entries, part 167.
247. gbcon168.seq - Constructed sequence entries, part 168.
248. gbcon169.seq - Constructed sequence entries, part 169.
249. gbcon17.seq - Constructed sequence entries, part 17.
250. gbcon170.seq - Constructed sequence entries, part 170.
251. gbcon171.seq - Constructed sequence entries, part 171.
252. gbcon172.seq - Constructed sequence entries, part 172.
253. gbcon173.seq - Constructed sequence entries, part 173.
254. gbcon174.seq - Constructed sequence entries, part 174.
255. gbcon175.seq - Constructed sequence entries, part 175.
256. gbcon176.seq - Constructed sequence entries, part 176.
257. gbcon177.seq - Constructed sequence entries, part 177.
258. gbcon178.seq - Constructed sequence entries, part 178.
259. gbcon179.seq - Constructed sequence entries, part 179.
260. gbcon18.seq - Constructed sequence entries, part 18.
261. gbcon180.seq - Constructed sequence entries, part 180.
262. gbcon181.seq - Constructed sequence entries, part 181.
263. gbcon182.seq - Constructed sequence entries, part 182.
264. gbcon183.seq - Constructed sequence entries, part 183.
265. gbcon184.seq - Constructed sequence entries, part 184.
266. gbcon185.seq - Constructed sequence entries, part 185.
267. gbcon186.seq - Constructed sequence entries, part 186.
268. gbcon187.seq - Constructed sequence entries, part 187.
269. gbcon188.seq - Constructed sequence entries, part 188.
270. gbcon189.seq - Constructed sequence entries, part 189.
271. gbcon19.seq - Constructed sequence entries, part 19.
272. gbcon190.seq - Constructed sequence entries, part 190.
273. gbcon191.seq - Constructed sequence entries, part 191.
274. gbcon192.seq - Constructed sequence entries, part 192.
275. gbcon193.seq - Constructed sequence entries, part 193.
276. gbcon194.seq - Constructed sequence entries, part 194.
277. gbcon195.seq - Constructed sequence entries, part 195.
278. gbcon196.seq - Constructed sequence entries, part 196.
279. gbcon197.seq - Constructed sequence entries, part 197.
280. gbcon198.seq - Constructed sequence entries, part 198.
281. gbcon199.seq - Constructed sequence entries, part 199.
282. gbcon2.seq - Constructed sequence entries, part 2.
283. gbcon20.seq - Constructed sequence entries, part 20.
284. gbcon200.seq - Constructed sequence entries, part 200.
285. gbcon201.seq - Constructed sequence entries, part 201.
286. gbcon202.seq - Constructed sequence entries, part 202.
287. gbcon203.seq - Constructed sequence entries, part 203.
288. gbcon204.seq - Constructed sequence entries, part 204.
289. gbcon205.seq - Constructed sequence entries, part 205.
290. gbcon206.seq - Constructed sequence entries, part 206.
291. gbcon207.seq - Constructed sequence entries, part 207.
292. gbcon208.seq - Constructed sequence entries, part 208.
293. gbcon209.seq - Constructed sequence entries, part 209.
294. gbcon21.seq - Constructed sequence entries, part 21.
295. gbcon210.seq - Constructed sequence entries, part 210.
296. gbcon211.seq - Constructed sequence entries, part 211.
297. gbcon212.seq - Constructed sequence entries, part 212.
298. gbcon213.seq - Constructed sequence entries, part 213.
299. gbcon214.seq - Constructed sequence entries, part 214.
300. gbcon215.seq - Constructed sequence entries, part 215.
301. gbcon216.seq - Constructed sequence entries, part 216.
302. gbcon217.seq - Constructed sequence entries, part 217.
303. gbcon218.seq - Constructed sequence entries, part 218.
304. gbcon219.seq - Constructed sequence entries, part 219.
305. gbcon22.seq - Constructed sequence entries, part 22.
306. gbcon220.seq - Constructed sequence entries, part 220.
307. gbcon221.seq - Constructed sequence entries, part 221.
308. gbcon222.seq - Constructed sequence entries, part 222.
309. gbcon223.seq - Constructed sequence entries, part 223.
310. gbcon224.seq - Constructed sequence entries, part 224.
311. gbcon225.seq - Constructed sequence entries, part 225.
312. gbcon226.seq - Constructed sequence entries, part 226.
313. gbcon227.seq - Constructed sequence entries, part 227.
314. gbcon228.seq - Constructed sequence entries, part 228.
315. gbcon229.seq - Constructed sequence entries, part 229.
316. gbcon23.seq - Constructed sequence entries, part 23.
317. gbcon230.seq - Constructed sequence entries, part 230.
318. gbcon231.seq - Constructed sequence entries, part 231.
319. gbcon232.seq - Constructed sequence entries, part 232.
320. gbcon233.seq - Constructed sequence entries, part 233.
321. gbcon234.seq - Constructed sequence entries, part 234.
322. gbcon235.seq - Constructed sequence entries, part 235.
323. gbcon236.seq - Constructed sequence entries, part 236.
324. gbcon237.seq - Constructed sequence entries, part 237.
325. gbcon238.seq - Constructed sequence entries, part 238.
326. gbcon239.seq - Constructed sequence entries, part 239.
327. gbcon24.seq - Constructed sequence entries, part 24.
328. gbcon240.seq - Constructed sequence entries, part 240.
329. gbcon241.seq - Constructed sequence entries, part 241.
330. gbcon242.seq - Constructed sequence entries, part 242.
331. gbcon243.seq - Constructed sequence entries, part 243.
332. gbcon244.seq - Constructed sequence entries, part 244.
333. gbcon245.seq - Constructed sequence entries, part 245.
334. gbcon246.seq - Constructed sequence entries, part 246.
335. gbcon247.seq - Constructed sequence entries, part 247.
336. gbcon248.seq - Constructed sequence entries, part 248.
337. gbcon249.seq - Constructed sequence entries, part 249.
338. gbcon25.seq - Constructed sequence entries, part 25.
339. gbcon250.seq - Constructed sequence entries, part 250.
340. gbcon251.seq - Constructed sequence entries, part 251.
341. gbcon252.seq - Constructed sequence entries, part 252.
342. gbcon253.seq - Constructed sequence entries, part 253.
343. gbcon254.seq - Constructed sequence entries, part 254.
344. gbcon255.seq - Constructed sequence entries, part 255.
345. gbcon256.seq - Constructed sequence entries, part 256.
346. gbcon257.seq - Constructed sequence entries, part 257.
347. gbcon258.seq - Constructed sequence entries, part 258.
348. gbcon259.seq - Constructed sequence entries, part 259.
349. gbcon26.seq - Constructed sequence entries, part 26.
350. gbcon260.seq - Constructed sequence entries, part 260.
351. gbcon261.seq - Constructed sequence entries, part 261.
352. gbcon262.seq - Constructed sequence entries, part 262.
353. gbcon263.seq - Constructed sequence entries, part 263.
354. gbcon264.seq - Constructed sequence entries, part 264.
355. gbcon265.seq - Constructed sequence entries, part 265.
356. gbcon266.seq - Constructed sequence entries, part 266.
357. gbcon267.seq - Constructed sequence entries, part 267.
358. gbcon268.seq - Constructed sequence entries, part 268.
359. gbcon269.seq - Constructed sequence entries, part 269.
360. gbcon27.seq - Constructed sequence entries, part 27.
361. gbcon270.seq - Constructed sequence entries, part 270.
362. gbcon271.seq - Constructed sequence entries, part 271.
363. gbcon272.seq - Constructed sequence entries, part 272.
364. gbcon273.seq - Constructed sequence entries, part 273.
365. gbcon274.seq - Constructed sequence entries, part 274.
366. gbcon275.seq - Constructed sequence entries, part 275.
367. gbcon276.seq - Constructed sequence entries, part 276.
368. gbcon277.seq - Constructed sequence entries, part 277.
369. gbcon278.seq - Constructed sequence entries, part 278.
370. gbcon279.seq - Constructed sequence entries, part 279.
371. gbcon28.seq - Constructed sequence entries, part 28.
372. gbcon280.seq - Constructed sequence entries, part 280.
373. gbcon281.seq - Constructed sequence entries, part 281.
374. gbcon282.seq - Constructed sequence entries, part 282.
375. gbcon283.seq - Constructed sequence entries, part 283.
376. gbcon284.seq - Constructed sequence entries, part 284.
377. gbcon285.seq - Constructed sequence entries, part 285.
378. gbcon286.seq - Constructed sequence entries, part 286.
379. gbcon287.seq - Constructed sequence entries, part 287.
380. gbcon288.seq - Constructed sequence entries, part 288.
381. gbcon289.seq - Constructed sequence entries, part 289.
382. gbcon29.seq - Constructed sequence entries, part 29.
383. gbcon290.seq - Constructed sequence entries, part 290.
384. gbcon291.seq - Constructed sequence entries, part 291.
385. gbcon292.seq - Constructed sequence entries, part 292.
386. gbcon293.seq - Constructed sequence entries, part 293.
387. gbcon294.seq - Constructed sequence entries, part 294.
388. gbcon295.seq - Constructed sequence entries, part 295.
389. gbcon296.seq - Constructed sequence entries, part 296.
390. gbcon297.seq - Constructed sequence entries, part 297.
391. gbcon298.seq - Constructed sequence entries, part 298.
392. gbcon299.seq - Constructed sequence entries, part 299.
393. gbcon3.seq - Constructed sequence entries, part 3.
394. gbcon30.seq - Constructed sequence entries, part 30.
395. gbcon300.seq - Constructed sequence entries, part 300.
396. gbcon301.seq - Constructed sequence entries, part 301.
397. gbcon302.seq - Constructed sequence entries, part 302.
398. gbcon303.seq - Constructed sequence entries, part 303.
399. gbcon31.seq - Constructed sequence entries, part 31.
400. gbcon32.seq - Constructed sequence entries, part 32.
401. gbcon33.seq - Constructed sequence entries, part 33.
402. gbcon34.seq - Constructed sequence entries, part 34.
403. gbcon35.seq - Constructed sequence entries, part 35.
404. gbcon36.seq - Constructed sequence entries, part 36.
405. gbcon37.seq - Constructed sequence entries, part 37.
406. gbcon38.seq - Constructed sequence entries, part 38.
407. gbcon39.seq - Constructed sequence entries, part 39.
408. gbcon4.seq - Constructed sequence entries, part 4.
409. gbcon40.seq - Constructed sequence entries, part 40.
410. gbcon41.seq - Constructed sequence entries, part 41.
411. gbcon42.seq - Constructed sequence entries, part 42.
412. gbcon43.seq - Constructed sequence entries, part 43.
413. gbcon44.seq - Constructed sequence entries, part 44.
414. gbcon45.seq - Constructed sequence entries, part 45.
415. gbcon46.seq - Constructed sequence entries, part 46.
416. gbcon47.seq - Constructed sequence entries, part 47.
417. gbcon48.seq - Constructed sequence entries, part 48.
418. gbcon49.seq - Constructed sequence entries, part 49.
419. gbcon5.seq - Constructed sequence entries, part 5.
420. gbcon50.seq - Constructed sequence entries, part 50.
421. gbcon51.seq - Constructed sequence entries, part 51.
422. gbcon52.seq - Constructed sequence entries, part 52.
423. gbcon53.seq - Constructed sequence entries, part 53.
424. gbcon54.seq - Constructed sequence entries, part 54.
425. gbcon55.seq - Constructed sequence entries, part 55.
426. gbcon56.seq - Constructed sequence entries, part 56.
427. gbcon57.seq - Constructed sequence entries, part 57.
428. gbcon58.seq - Constructed sequence entries, part 58.
429. gbcon59.seq - Constructed sequence entries, part 59.
430. gbcon6.seq - Constructed sequence entries, part 6.
431. gbcon60.seq - Constructed sequence entries, part 60.
432. gbcon61.seq - Constructed sequence entries, part 61.
433. gbcon62.seq - Constructed sequence entries, part 62.
434. gbcon63.seq - Constructed sequence entries, part 63.
435. gbcon64.seq - Constructed sequence entries, part 64.
436. gbcon65.seq - Constructed sequence entries, part 65.
437. gbcon66.seq - Constructed sequence entries, part 66.
438. gbcon67.seq - Constructed sequence entries, part 67.
439. gbcon68.seq - Constructed sequence entries, part 68.
440. gbcon69.seq - Constructed sequence entries, part 69.
441. gbcon7.seq - Constructed sequence entries, part 7.
442. gbcon70.seq - Constructed sequence entries, part 70.
443. gbcon71.seq - Constructed sequence entries, part 71.
444. gbcon72.seq - Constructed sequence entries, part 72.
445. gbcon73.seq - Constructed sequence entries, part 73.
446. gbcon74.seq - Constructed sequence entries, part 74.
447. gbcon75.seq - Constructed sequence entries, part 75.
448. gbcon76.seq - Constructed sequence entries, part 76.
449. gbcon77.seq - Constructed sequence entries, part 77.
450. gbcon78.seq - Constructed sequence entries, part 78.
451. gbcon79.seq - Constructed sequence entries, part 79.
452. gbcon8.seq - Constructed sequence entries, part 8.
453. gbcon80.seq - Constructed sequence entries, part 80.
454. gbcon81.seq - Constructed sequence entries, part 81.
455. gbcon82.seq - Constructed sequence entries, part 82.
456. gbcon83.seq - Constructed sequence entries, part 83.
457. gbcon84.seq - Constructed sequence entries, part 84.
458. gbcon85.seq - Constructed sequence entries, part 85.
459. gbcon86.seq - Constructed sequence entries, part 86.
460. gbcon87.seq - Constructed sequence entries, part 87.
461. gbcon88.seq - Constructed sequence entries, part 88.
462. gbcon89.seq - Constructed sequence entries, part 89.
463. gbcon9.seq - Constructed sequence entries, part 9.
464. gbcon90.seq - Constructed sequence entries, part 90.
465. gbcon91.seq - Constructed sequence entries, part 91.
466. gbcon92.seq - Constructed sequence entries, part 92.
467. gbcon93.seq - Constructed sequence entries, part 93.
468. gbcon94.seq - Constructed sequence entries, part 94.
469. gbcon95.seq - Constructed sequence entries, part 95.
470. gbcon96.seq - Constructed sequence entries, part 96.
471. gbcon97.seq - Constructed sequence entries, part 97.
472. gbcon98.seq - Constructed sequence entries, part 98.
473. gbcon99.seq - Constructed sequence entries, part 99.
474. gbdel.txt - Accession numbers of entries deleted since the previous release.
475. gbenv1.seq - Environmental sampling sequence entries, part 1.
476. gbenv10.seq - Environmental sampling sequence entries, part 10.
477. gbenv11.seq - Environmental sampling sequence entries, part 11.
478. gbenv12.seq - Environmental sampling sequence entries, part 12.
479. gbenv13.seq - Environmental sampling sequence entries, part 13.
480. gbenv14.seq - Environmental sampling sequence entries, part 14.
481. gbenv15.seq - Environmental sampling sequence entries, part 15.
482. gbenv16.seq - Environmental sampling sequence entries, part 16.
483. gbenv17.seq - Environmental sampling sequence entries, part 17.
484. gbenv18.seq - Environmental sampling sequence entries, part 18.
485. gbenv19.seq - Environmental sampling sequence entries, part 19.
486. gbenv2.seq - Environmental sampling sequence entries, part 2.
487. gbenv20.seq - Environmental sampling sequence entries, part 20.
488. gbenv21.seq - Environmental sampling sequence entries, part 21.
489. gbenv22.seq - Environmental sampling sequence entries, part 22.
490. gbenv23.seq - Environmental sampling sequence entries, part 23.
491. gbenv24.seq - Environmental sampling sequence entries, part 24.
492. gbenv25.seq - Environmental sampling sequence entries, part 25.
493. gbenv26.seq - Environmental sampling sequence entries, part 26.
494. gbenv27.seq - Environmental sampling sequence entries, part 27.
495. gbenv28.seq - Environmental sampling sequence entries, part 28.
496. gbenv29.seq - Environmental sampling sequence entries, part 29.
497. gbenv3.seq - Environmental sampling sequence entries, part 3.
498. gbenv30.seq - Environmental sampling sequence entries, part 30.
499. gbenv31.seq - Environmental sampling sequence entries, part 31.
500. gbenv32.seq - Environmental sampling sequence entries, part 32.
501. gbenv33.seq - Environmental sampling sequence entries, part 33.
502. gbenv34.seq - Environmental sampling sequence entries, part 34.
503. gbenv35.seq - Environmental sampling sequence entries, part 35.
504. gbenv36.seq - Environmental sampling sequence entries, part 36.
505. gbenv37.seq - Environmental sampling sequence entries, part 37.
506. gbenv38.seq - Environmental sampling sequence entries, part 38.
507. gbenv39.seq - Environmental sampling sequence entries, part 39.
508. gbenv4.seq - Environmental sampling sequence entries, part 4.
509. gbenv40.seq - Environmental sampling sequence entries, part 40.
510. gbenv41.seq - Environmental sampling sequence entries, part 41.
511. gbenv42.seq - Environmental sampling sequence entries, part 42.
512. gbenv43.seq - Environmental sampling sequence entries, part 43.
513. gbenv44.seq - Environmental sampling sequence entries, part 44.
514. gbenv45.seq - Environmental sampling sequence entries, part 45.
515. gbenv46.seq - Environmental sampling sequence entries, part 46.
516. gbenv47.seq - Environmental sampling sequence entries, part 47.
517. gbenv48.seq - Environmental sampling sequence entries, part 48.
518. gbenv49.seq - Environmental sampling sequence entries, part 49.
519. gbenv5.seq - Environmental sampling sequence entries, part 5.
520. gbenv50.seq - Environmental sampling sequence entries, part 50.
521. gbenv51.seq - Environmental sampling sequence entries, part 51.
522. gbenv52.seq - Environmental sampling sequence entries, part 52.
523. gbenv53.seq - Environmental sampling sequence entries, part 53.
524. gbenv54.seq - Environmental sampling sequence entries, part 54.
525. gbenv55.seq - Environmental sampling sequence entries, part 55.
526. gbenv56.seq - Environmental sampling sequence entries, part 56.
527. gbenv57.seq - Environmental sampling sequence entries, part 57.
528. gbenv58.seq - Environmental sampling sequence entries, part 58.
529. gbenv59.seq - Environmental sampling sequence entries, part 59.
530. gbenv6.seq - Environmental sampling sequence entries, part 6.
531. gbenv60.seq - Environmental sampling sequence entries, part 60.
532. gbenv61.seq - Environmental sampling sequence entries, part 61.
533. gbenv62.seq - Environmental sampling sequence entries, part 62.
534. gbenv63.seq - Environmental sampling sequence entries, part 63.
535. gbenv64.seq - Environmental sampling sequence entries, part 64.
536. gbenv65.seq - Environmental sampling sequence entries, part 65.
537. gbenv66.seq - Environmental sampling sequence entries, part 66.
538. gbenv67.seq - Environmental sampling sequence entries, part 67.
539. gbenv68.seq - Environmental sampling sequence entries, part 68.
540. gbenv69.seq - Environmental sampling sequence entries, part 69.
541. gbenv7.seq - Environmental sampling sequence entries, part 7.
542. gbenv70.seq - Environmental sampling sequence entries, part 70.
543. gbenv71.seq - Environmental sampling sequence entries, part 71.
544. gbenv72.seq - Environmental sampling sequence entries, part 72.
545. gbenv73.seq - Environmental sampling sequence entries, part 73.
546. gbenv74.seq - Environmental sampling sequence entries, part 74.
547. gbenv75.seq - Environmental sampling sequence entries, part 75.
548. gbenv76.seq - Environmental sampling sequence entries, part 76.
549. gbenv77.seq - Environmental sampling sequence entries, part 77.
550. gbenv78.seq - Environmental sampling sequence entries, part 78.
551. gbenv79.seq - Environmental sampling sequence entries, part 79.
552. gbenv8.seq - Environmental sampling sequence entries, part 8.
553. gbenv80.seq - Environmental sampling sequence entries, part 80.
554. gbenv9.seq - Environmental sampling sequence entries, part 9.
555. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
556. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
557. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
558. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
559. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
560. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
561. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
562. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
563. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
564. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
565. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
566. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
567. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
568. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
569. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
570. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
571. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
572. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
573. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
574. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
575. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
576. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
577. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
578. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
579. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
580. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
581. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
582. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
583. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
584. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
585. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
586. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
587. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
588. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
589. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
590. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
591. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
592. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
593. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
594. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
595. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
596. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
597. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
598. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
599. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
600. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
601. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
602. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
603. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
604. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
605. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
606. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
607. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
608. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
609. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
610. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
611. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
612. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
613. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
614. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
615. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
616. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
617. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
618. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
619. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
620. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
621. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
622. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
623. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
624. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
625. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
626. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
627. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
628. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
629. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
630. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
631. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
632. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
633. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
634. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
635. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
636. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
637. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
638. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
639. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
640. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
641. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
642. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
643. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
644. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
645. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
646. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
647. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
648. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
649. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
650. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
651. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
652. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
653. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
654. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
655. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
656. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
657. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
658. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
659. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
660. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
661. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
662. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
663. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
664. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
665. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
666. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
667. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
668. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
669. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
670. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
671. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
672. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
673. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
674. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
675. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
676. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
677. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
678. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
679. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
680. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
681. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
682. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
683. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
684. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
685. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
686. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
687. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
688. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
689. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
690. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
691. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
692. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
693. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
694. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
695. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
696. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
697. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
698. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
699. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
700. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
701. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
702. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
703. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
704. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
705. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
706. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
707. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
708. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
709. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
710. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
711. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
712. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
713. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
714. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
715. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
716. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
717. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
718. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
719. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
720. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
721. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
722. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
723. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
724. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
725. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
726. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
727. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
728. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
729. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
730. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
731. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
732. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
733. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
734. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
735. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
736. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
737. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
738. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
739. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
740. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
741. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
742. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
743. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
744. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
745. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
746. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
747. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
748. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
749. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
750. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
751. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
752. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
753. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
754. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
755. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
756. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
757. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
758. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
759. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
760. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
761. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
762. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
763. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
764. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
765. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
766. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
767. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
768. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
769. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
770. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
771. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
772. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
773. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
774. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
775. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
776. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
777. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
778. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
779. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
780. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
781. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
782. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
783. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
784. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
785. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
786. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
787. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
788. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
789. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
790. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
791. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
792. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
793. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
794. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
795. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
796. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
797. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
798. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
799. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
800. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
801. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
802. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
803. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
804. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
805. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
806. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
807. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
808. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
809. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
810. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
811. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
812. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
813. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
814. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
815. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
816. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
817. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
818. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
819. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
820. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
821. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
822. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
823. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
824. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
825. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
826. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
827. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
828. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
829. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
830. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
831. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
832. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
833. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
834. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
835. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
836. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
837. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
838. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
839. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
840. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
841. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
842. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
843. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
844. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
845. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
846. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
847. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
848. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
849. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
850. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
851. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
852. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
853. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
854. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
855. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
856. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
857. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
858. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
859. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
860. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
861. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
862. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
863. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
864. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
865. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
866. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
867. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
868. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
869. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
870. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
871. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
872. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
873. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
874. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
875. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
876. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
877. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
878. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
879. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
880. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
881. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
882. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
883. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
884. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
885. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
886. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
887. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
888. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
889. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
890. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
891. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
892. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
893. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
894. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
895. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
896. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
897. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
898. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
899. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
900. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
901. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
902. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
903. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
904. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
905. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
906. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
907. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
908. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
909. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
910. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
911. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
912. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
913. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
914. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
915. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
916. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
917. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
918. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
919. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
920. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
921. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
922. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
923. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
924. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
925. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
926. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
927. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
928. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
929. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
930. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
931. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
932. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
933. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
934. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
935. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
936. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
937. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
938. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
939. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
940. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
941. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
942. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
943. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
944. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
945. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
946. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
947. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
948. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
949. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
950. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
951. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
952. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
953. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
954. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
955. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
956. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
957. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
958. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
959. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
960. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
961. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
962. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
963. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
964. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
965. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
966. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
967. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
968. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
969. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
970. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
971. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
972. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
973. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
974. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
975. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
976. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
977. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
978. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
979. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
980. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
981. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
982. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
983. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
984. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
985. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
986. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
987. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
988. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
989. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
990. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
991. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
992. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
993. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
994. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
995. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
996. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
997. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
998. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
999. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1000. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1001. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1002. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1003. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1004. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1005. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1006. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1007. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1008. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1009. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1010. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1011. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1012. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1013. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1014. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1015. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1016. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1017. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1018. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1019. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1020. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1021. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1022. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1023. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1024. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1025. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1026. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1027. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1028. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1029. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1030. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1031. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1032. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1033. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1034. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1035. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1036. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1037. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1038. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1039. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1040. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1041. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1042. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1043. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1044. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1045. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1046. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1047. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1048. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1049. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1050. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1051. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1052. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1053. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1054. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1055. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1056. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1057. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1058. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1059. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1060. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1061. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1062. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1063. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1064. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1065. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1066. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1067. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1068. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1069. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1070. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1071. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1072. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1073. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1074. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1075. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1076. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1077. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1078. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1079. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1080. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1081. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1082. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1083. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1084. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1085. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1086. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1087. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1088. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1089. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1090. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1091. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1092. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1093. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1094. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1095. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1096. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1097. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1098. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1099. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1100. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1101. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1102. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1103. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1104. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1105. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1106. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1107. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1108. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1109. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1110. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1111. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1112. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1113. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1114. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1115. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1116. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1117. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1118. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1119. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1120. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1121. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1122. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1123. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1124. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1125. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1126. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1127. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1128. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1129. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1130. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1131. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1132. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1133. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1134. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1135. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1136. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1137. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1138. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1139. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1140. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1141. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1142. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1143. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1144. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1145. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1146. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1147. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1148. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1149. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1150. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1151. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1152. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1153. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1154. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1155. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1156. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1157. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1158. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1159. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1160. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1161. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1162. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1163. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1164. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1165. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1166. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1167. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1168. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1169. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1170. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1171. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1172. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1173. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1174. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1175. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1176. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1177. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1178. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1179. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1180. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1181. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1182. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1183. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1184. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1185. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1186. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1187. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1188. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1189. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1190. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1191. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1192. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1193. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1194. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1195. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1196. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1197. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1198. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1199. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1200. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1201. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1202. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1203. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1204. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1205. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1206. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1207. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1208. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1209. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1210. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1211. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1212. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1213. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1214. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1215. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1216. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1217. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1218. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1219. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1220. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1221. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1222. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1223. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1224. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1225. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1226. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1227. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1228. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1229. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1230. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1231. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1232. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1233. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1234. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1235. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1236. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1237. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1238. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1239. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1240. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1241. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1242. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1243. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1244. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1245. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1246. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1247. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1248. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1249. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1250. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1251. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1252. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1253. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1254. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1255. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1256. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1257. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1258. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1259. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1260. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1261. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1262. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1263. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1264. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1265. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1266. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1267. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1268. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1269. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1270. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1271. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1272. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1273. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1274. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1275. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1276. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1277. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1278. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1279. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1280. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1281. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1282. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1283. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1284. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1285. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1286. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1287. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1288. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1289. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1290. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1291. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1292. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1293. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1294. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1295. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1296. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1297. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1298. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1299. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1300. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1301. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1302. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1303. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1304. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1305. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1306. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1307. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1308. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1309. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1310. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1311. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1312. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1313. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1314. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1315. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1316. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1317. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1318. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1319. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1320. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1321. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1322. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1323. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1324. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1325. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1326. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1327. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1328. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1329. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1330. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1331. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1332. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1333. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1334. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1335. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1336. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1337. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1338. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1339. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1340. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1341. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1342. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1343. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1344. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1345. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1346. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1347. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1348. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1349. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1350. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1351. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1352. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1353. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1354. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1355. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1356. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1357. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1358. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1359. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1360. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1361. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1362. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1363. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1364. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1365. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1366. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1367. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1368. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1369. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1370. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1371. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1372. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1373. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1374. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1375. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1376. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1377. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1378. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1379. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1380. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1381. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1382. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1383. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1384. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1385. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1386. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1387. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1388. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1389. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1390. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1391. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1392. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1393. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1394. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1395. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1396. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1397. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1398. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1399. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1400. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1401. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1402. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1403. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1404. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1405. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1406. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1407. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1408. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1409. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1410. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1411. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1412. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1413. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1414. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1415. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1416. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1417. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1418. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1419. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1420. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1421. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1422. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1423. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1424. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1425. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1426. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1427. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1428. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1429. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1430. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1431. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1432. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1433. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1434. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1435. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1436. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1437. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1438. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1439. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1440. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1441. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1442. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1443. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1444. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1445. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1446. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1447. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1448. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1449. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1450. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1451. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1452. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1453. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1454. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1455. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1456. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1457. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1458. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1459. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1460. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1461. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1462. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1463. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1464. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1465. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1466. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1467. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1468. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1469. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1470. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1471. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1472. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1473. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1474. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1475. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1476. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1477. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1478. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1479. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1480. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1481. gbinv1.seq - Invertebrate sequence entries, part 1.
1482. gbinv10.seq - Invertebrate sequence entries, part 10.
1483. gbinv100.seq - Invertebrate sequence entries, part 100.
1484. gbinv101.seq - Invertebrate sequence entries, part 101.
1485. gbinv102.seq - Invertebrate sequence entries, part 102.
1486. gbinv103.seq - Invertebrate sequence entries, part 103.
1487. gbinv104.seq - Invertebrate sequence entries, part 104.
1488. gbinv105.seq - Invertebrate sequence entries, part 105.
1489. gbinv106.seq - Invertebrate sequence entries, part 106.
1490. gbinv107.seq - Invertebrate sequence entries, part 107.
1491. gbinv108.seq - Invertebrate sequence entries, part 108.
1492. gbinv109.seq - Invertebrate sequence entries, part 109.
1493. gbinv11.seq - Invertebrate sequence entries, part 11.
1494. gbinv110.seq - Invertebrate sequence entries, part 110.
1495. gbinv111.seq - Invertebrate sequence entries, part 111.
1496. gbinv112.seq - Invertebrate sequence entries, part 112.
1497. gbinv113.seq - Invertebrate sequence entries, part 113.
1498. gbinv114.seq - Invertebrate sequence entries, part 114.
1499. gbinv115.seq - Invertebrate sequence entries, part 115.
1500. gbinv116.seq - Invertebrate sequence entries, part 116.
1501. gbinv117.seq - Invertebrate sequence entries, part 117.
1502. gbinv118.seq - Invertebrate sequence entries, part 118.
1503. gbinv119.seq - Invertebrate sequence entries, part 119.
1504. gbinv12.seq - Invertebrate sequence entries, part 12.
1505. gbinv120.seq - Invertebrate sequence entries, part 120.
1506. gbinv121.seq - Invertebrate sequence entries, part 121.
1507. gbinv122.seq - Invertebrate sequence entries, part 122.
1508. gbinv123.seq - Invertebrate sequence entries, part 123.
1509. gbinv124.seq - Invertebrate sequence entries, part 124.
1510. gbinv125.seq - Invertebrate sequence entries, part 125.
1511. gbinv126.seq - Invertebrate sequence entries, part 126.
1512. gbinv127.seq - Invertebrate sequence entries, part 127.
1513. gbinv128.seq - Invertebrate sequence entries, part 128.
1514. gbinv129.seq - Invertebrate sequence entries, part 129.
1515. gbinv13.seq - Invertebrate sequence entries, part 13.
1516. gbinv130.seq - Invertebrate sequence entries, part 130.
1517. gbinv131.seq - Invertebrate sequence entries, part 131.
1518. gbinv132.seq - Invertebrate sequence entries, part 132.
1519. gbinv133.seq - Invertebrate sequence entries, part 133.
1520. gbinv14.seq - Invertebrate sequence entries, part 14.
1521. gbinv15.seq - Invertebrate sequence entries, part 15.
1522. gbinv16.seq - Invertebrate sequence entries, part 16.
1523. gbinv17.seq - Invertebrate sequence entries, part 17.
1524. gbinv18.seq - Invertebrate sequence entries, part 18.
1525. gbinv19.seq - Invertebrate sequence entries, part 19.
1526. gbinv2.seq - Invertebrate sequence entries, part 2.
1527. gbinv20.seq - Invertebrate sequence entries, part 20.
1528. gbinv21.seq - Invertebrate sequence entries, part 21.
1529. gbinv22.seq - Invertebrate sequence entries, part 22.
1530. gbinv23.seq - Invertebrate sequence entries, part 23.
1531. gbinv24.seq - Invertebrate sequence entries, part 24.
1532. gbinv25.seq - Invertebrate sequence entries, part 25.
1533. gbinv26.seq - Invertebrate sequence entries, part 26.
1534. gbinv27.seq - Invertebrate sequence entries, part 27.
1535. gbinv28.seq - Invertebrate sequence entries, part 28.
1536. gbinv29.seq - Invertebrate sequence entries, part 29.
1537. gbinv3.seq - Invertebrate sequence entries, part 3.
1538. gbinv30.seq - Invertebrate sequence entries, part 30.
1539. gbinv31.seq - Invertebrate sequence entries, part 31.
1540. gbinv32.seq - Invertebrate sequence entries, part 32.
1541. gbinv33.seq - Invertebrate sequence entries, part 33.
1542. gbinv34.seq - Invertebrate sequence entries, part 34.
1543. gbinv35.seq - Invertebrate sequence entries, part 35.
1544. gbinv36.seq - Invertebrate sequence entries, part 36.
1545. gbinv37.seq - Invertebrate sequence entries, part 37.
1546. gbinv38.seq - Invertebrate sequence entries, part 38.
1547. gbinv39.seq - Invertebrate sequence entries, part 39.
1548. gbinv4.seq - Invertebrate sequence entries, part 4.
1549. gbinv40.seq - Invertebrate sequence entries, part 40.
1550. gbinv41.seq - Invertebrate sequence entries, part 41.
1551. gbinv42.seq - Invertebrate sequence entries, part 42.
1552. gbinv43.seq - Invertebrate sequence entries, part 43.
1553. gbinv44.seq - Invertebrate sequence entries, part 44.
1554. gbinv45.seq - Invertebrate sequence entries, part 45.
1555. gbinv46.seq - Invertebrate sequence entries, part 46.
1556. gbinv47.seq - Invertebrate sequence entries, part 47.
1557. gbinv48.seq - Invertebrate sequence entries, part 48.
1558. gbinv49.seq - Invertebrate sequence entries, part 49.
1559. gbinv5.seq - Invertebrate sequence entries, part 5.
1560. gbinv50.seq - Invertebrate sequence entries, part 50.
1561. gbinv51.seq - Invertebrate sequence entries, part 51.
1562. gbinv52.seq - Invertebrate sequence entries, part 52.
1563. gbinv53.seq - Invertebrate sequence entries, part 53.
1564. gbinv54.seq - Invertebrate sequence entries, part 54.
1565. gbinv55.seq - Invertebrate sequence entries, part 55.
1566. gbinv56.seq - Invertebrate sequence entries, part 56.
1567. gbinv57.seq - Invertebrate sequence entries, part 57.
1568. gbinv58.seq - Invertebrate sequence entries, part 58.
1569. gbinv59.seq - Invertebrate sequence entries, part 59.
1570. gbinv6.seq - Invertebrate sequence entries, part 6.
1571. gbinv60.seq - Invertebrate sequence entries, part 60.
1572. gbinv61.seq - Invertebrate sequence entries, part 61.
1573. gbinv62.seq - Invertebrate sequence entries, part 62.
1574. gbinv63.seq - Invertebrate sequence entries, part 63.
1575. gbinv64.seq - Invertebrate sequence entries, part 64.
1576. gbinv65.seq - Invertebrate sequence entries, part 65.
1577. gbinv66.seq - Invertebrate sequence entries, part 66.
1578. gbinv67.seq - Invertebrate sequence entries, part 67.
1579. gbinv68.seq - Invertebrate sequence entries, part 68.
1580. gbinv69.seq - Invertebrate sequence entries, part 69.
1581. gbinv7.seq - Invertebrate sequence entries, part 7.
1582. gbinv70.seq - Invertebrate sequence entries, part 70.
1583. gbinv71.seq - Invertebrate sequence entries, part 71.
1584. gbinv72.seq - Invertebrate sequence entries, part 72.
1585. gbinv73.seq - Invertebrate sequence entries, part 73.
1586. gbinv74.seq - Invertebrate sequence entries, part 74.
1587. gbinv75.seq - Invertebrate sequence entries, part 75.
1588. gbinv76.seq - Invertebrate sequence entries, part 76.
1589. gbinv77.seq - Invertebrate sequence entries, part 77.
1590. gbinv78.seq - Invertebrate sequence entries, part 78.
1591. gbinv79.seq - Invertebrate sequence entries, part 79.
1592. gbinv8.seq - Invertebrate sequence entries, part 8.
1593. gbinv80.seq - Invertebrate sequence entries, part 80.
1594. gbinv81.seq - Invertebrate sequence entries, part 81.
1595. gbinv82.seq - Invertebrate sequence entries, part 82.
1596. gbinv83.seq - Invertebrate sequence entries, part 83.
1597. gbinv84.seq - Invertebrate sequence entries, part 84.
1598. gbinv85.seq - Invertebrate sequence entries, part 85.
1599. gbinv86.seq - Invertebrate sequence entries, part 86.
1600. gbinv87.seq - Invertebrate sequence entries, part 87.
1601. gbinv88.seq - Invertebrate sequence entries, part 88.
1602. gbinv89.seq - Invertebrate sequence entries, part 89.
1603. gbinv9.seq - Invertebrate sequence entries, part 9.
1604. gbinv90.seq - Invertebrate sequence entries, part 90.
1605. gbinv91.seq - Invertebrate sequence entries, part 91.
1606. gbinv92.seq - Invertebrate sequence entries, part 92.
1607. gbinv93.seq - Invertebrate sequence entries, part 93.
1608. gbinv94.seq - Invertebrate sequence entries, part 94.
1609. gbinv95.seq - Invertebrate sequence entries, part 95.
1610. gbinv96.seq - Invertebrate sequence entries, part 96.
1611. gbinv97.seq - Invertebrate sequence entries, part 97.
1612. gbinv98.seq - Invertebrate sequence entries, part 98.
1613. gbinv99.seq - Invertebrate sequence entries, part 99.
1614. gbmam1.seq - Other mammalian sequence entries, part 1.
1615. gbmam2.seq - Other mammalian sequence entries, part 2.
1616. gbmam3.seq - Other mammalian sequence entries, part 3.
1617. gbmam4.seq - Other mammalian sequence entries, part 4.
1618. gbmam5.seq - Other mammalian sequence entries, part 5.
1619. gbmam6.seq - Other mammalian sequence entries, part 6.
1620. gbmam7.seq - Other mammalian sequence entries, part 7.
1621. gbmam8.seq - Other mammalian sequence entries, part 8.
1622. gbmam9.seq - Other mammalian sequence entries, part 9.
1623. gbnew.txt - Accession numbers of entries new since the previous release.
1624. gbpat1.seq - Patent sequence entries, part 1.
1625. gbpat10.seq - Patent sequence entries, part 10.
1626. gbpat100.seq - Patent sequence entries, part 100.
1627. gbpat101.seq - Patent sequence entries, part 101.
1628. gbpat102.seq - Patent sequence entries, part 102.
1629. gbpat103.seq - Patent sequence entries, part 103.
1630. gbpat104.seq - Patent sequence entries, part 104.
1631. gbpat105.seq - Patent sequence entries, part 105.
1632. gbpat106.seq - Patent sequence entries, part 106.
1633. gbpat107.seq - Patent sequence entries, part 107.
1634. gbpat108.seq - Patent sequence entries, part 108.
1635. gbpat109.seq - Patent sequence entries, part 109.
1636. gbpat11.seq - Patent sequence entries, part 11.
1637. gbpat110.seq - Patent sequence entries, part 110.
1638. gbpat111.seq - Patent sequence entries, part 111.
1639. gbpat112.seq - Patent sequence entries, part 112.
1640. gbpat113.seq - Patent sequence entries, part 113.
1641. gbpat114.seq - Patent sequence entries, part 114.
1642. gbpat115.seq - Patent sequence entries, part 115.
1643. gbpat116.seq - Patent sequence entries, part 116.
1644. gbpat117.seq - Patent sequence entries, part 117.
1645. gbpat118.seq - Patent sequence entries, part 118.
1646. gbpat119.seq - Patent sequence entries, part 119.
1647. gbpat12.seq - Patent sequence entries, part 12.
1648. gbpat120.seq - Patent sequence entries, part 120.
1649. gbpat121.seq - Patent sequence entries, part 121.
1650. gbpat122.seq - Patent sequence entries, part 122.
1651. gbpat123.seq - Patent sequence entries, part 123.
1652. gbpat124.seq - Patent sequence entries, part 124.
1653. gbpat125.seq - Patent sequence entries, part 125.
1654. gbpat126.seq - Patent sequence entries, part 126.
1655. gbpat127.seq - Patent sequence entries, part 127.
1656. gbpat128.seq - Patent sequence entries, part 128.
1657. gbpat129.seq - Patent sequence entries, part 129.
1658. gbpat13.seq - Patent sequence entries, part 13.
1659. gbpat130.seq - Patent sequence entries, part 130.
1660. gbpat131.seq - Patent sequence entries, part 131.
1661. gbpat132.seq - Patent sequence entries, part 132.
1662. gbpat133.seq - Patent sequence entries, part 133.
1663. gbpat134.seq - Patent sequence entries, part 134.
1664. gbpat135.seq - Patent sequence entries, part 135.
1665. gbpat136.seq - Patent sequence entries, part 136.
1666. gbpat137.seq - Patent sequence entries, part 137.
1667. gbpat138.seq - Patent sequence entries, part 138.
1668. gbpat139.seq - Patent sequence entries, part 139.
1669. gbpat14.seq - Patent sequence entries, part 14.
1670. gbpat140.seq - Patent sequence entries, part 140.
1671. gbpat141.seq - Patent sequence entries, part 141.
1672. gbpat142.seq - Patent sequence entries, part 142.
1673. gbpat143.seq - Patent sequence entries, part 143.
1674. gbpat144.seq - Patent sequence entries, part 144.
1675. gbpat145.seq - Patent sequence entries, part 145.
1676. gbpat146.seq - Patent sequence entries, part 146.
1677. gbpat147.seq - Patent sequence entries, part 147.
1678. gbpat148.seq - Patent sequence entries, part 148.
1679. gbpat149.seq - Patent sequence entries, part 149.
1680. gbpat15.seq - Patent sequence entries, part 15.
1681. gbpat150.seq - Patent sequence entries, part 150.
1682. gbpat151.seq - Patent sequence entries, part 151.
1683. gbpat152.seq - Patent sequence entries, part 152.
1684. gbpat153.seq - Patent sequence entries, part 153.
1685. gbpat154.seq - Patent sequence entries, part 154.
1686. gbpat155.seq - Patent sequence entries, part 155.
1687. gbpat156.seq - Patent sequence entries, part 156.
1688. gbpat157.seq - Patent sequence entries, part 157.
1689. gbpat158.seq - Patent sequence entries, part 158.
1690. gbpat159.seq - Patent sequence entries, part 159.
1691. gbpat16.seq - Patent sequence entries, part 16.
1692. gbpat160.seq - Patent sequence entries, part 160.
1693. gbpat161.seq - Patent sequence entries, part 161.
1694. gbpat162.seq - Patent sequence entries, part 162.
1695. gbpat163.seq - Patent sequence entries, part 163.
1696. gbpat164.seq - Patent sequence entries, part 164.
1697. gbpat165.seq - Patent sequence entries, part 165.
1698. gbpat166.seq - Patent sequence entries, part 166.
1699. gbpat167.seq - Patent sequence entries, part 167.
1700. gbpat168.seq - Patent sequence entries, part 168.
1701. gbpat169.seq - Patent sequence entries, part 169.
1702. gbpat17.seq - Patent sequence entries, part 17.
1703. gbpat170.seq - Patent sequence entries, part 170.
1704. gbpat171.seq - Patent sequence entries, part 171.
1705. gbpat172.seq - Patent sequence entries, part 172.
1706. gbpat173.seq - Patent sequence entries, part 173.
1707. gbpat174.seq - Patent sequence entries, part 174.
1708. gbpat175.seq - Patent sequence entries, part 175.
1709. gbpat176.seq - Patent sequence entries, part 176.
1710. gbpat177.seq - Patent sequence entries, part 177.
1711. gbpat178.seq - Patent sequence entries, part 178.
1712. gbpat179.seq - Patent sequence entries, part 179.
1713. gbpat18.seq - Patent sequence entries, part 18.
1714. gbpat180.seq - Patent sequence entries, part 180.
1715. gbpat181.seq - Patent sequence entries, part 181.
1716. gbpat182.seq - Patent sequence entries, part 182.
1717. gbpat183.seq - Patent sequence entries, part 183.
1718. gbpat184.seq - Patent sequence entries, part 184.
1719. gbpat185.seq - Patent sequence entries, part 185.
1720. gbpat186.seq - Patent sequence entries, part 186.
1721. gbpat187.seq - Patent sequence entries, part 187.
1722. gbpat188.seq - Patent sequence entries, part 188.
1723. gbpat189.seq - Patent sequence entries, part 189.
1724. gbpat19.seq - Patent sequence entries, part 19.
1725. gbpat190.seq - Patent sequence entries, part 190.
1726. gbpat191.seq - Patent sequence entries, part 191.
1727. gbpat192.seq - Patent sequence entries, part 192.
1728. gbpat193.seq - Patent sequence entries, part 193.
1729. gbpat194.seq - Patent sequence entries, part 194.
1730. gbpat195.seq - Patent sequence entries, part 195.
1731. gbpat196.seq - Patent sequence entries, part 196.
1732. gbpat197.seq - Patent sequence entries, part 197.
1733. gbpat198.seq - Patent sequence entries, part 198.
1734. gbpat199.seq - Patent sequence entries, part 199.
1735. gbpat2.seq - Patent sequence entries, part 2.
1736. gbpat20.seq - Patent sequence entries, part 20.
1737. gbpat200.seq - Patent sequence entries, part 200.
1738. gbpat201.seq - Patent sequence entries, part 201.
1739. gbpat202.seq - Patent sequence entries, part 202.
1740. gbpat203.seq - Patent sequence entries, part 203.
1741. gbpat204.seq - Patent sequence entries, part 204.
1742. gbpat205.seq - Patent sequence entries, part 205.
1743. gbpat206.seq - Patent sequence entries, part 206.
1744. gbpat207.seq - Patent sequence entries, part 207.
1745. gbpat208.seq - Patent sequence entries, part 208.
1746. gbpat209.seq - Patent sequence entries, part 209.
1747. gbpat21.seq - Patent sequence entries, part 21.
1748. gbpat210.seq - Patent sequence entries, part 210.
1749. gbpat211.seq - Patent sequence entries, part 211.
1750. gbpat212.seq - Patent sequence entries, part 212.
1751. gbpat213.seq - Patent sequence entries, part 213.
1752. gbpat214.seq - Patent sequence entries, part 214.
1753. gbpat215.seq - Patent sequence entries, part 215.
1754. gbpat216.seq - Patent sequence entries, part 216.
1755. gbpat217.seq - Patent sequence entries, part 217.
1756. gbpat22.seq - Patent sequence entries, part 22.
1757. gbpat23.seq - Patent sequence entries, part 23.
1758. gbpat24.seq - Patent sequence entries, part 24.
1759. gbpat25.seq - Patent sequence entries, part 25.
1760. gbpat26.seq - Patent sequence entries, part 26.
1761. gbpat27.seq - Patent sequence entries, part 27.
1762. gbpat28.seq - Patent sequence entries, part 28.
1763. gbpat29.seq - Patent sequence entries, part 29.
1764. gbpat3.seq - Patent sequence entries, part 3.
1765. gbpat30.seq - Patent sequence entries, part 30.
1766. gbpat31.seq - Patent sequence entries, part 31.
1767. gbpat32.seq - Patent sequence entries, part 32.
1768. gbpat33.seq - Patent sequence entries, part 33.
1769. gbpat34.seq - Patent sequence entries, part 34.
1770. gbpat35.seq - Patent sequence entries, part 35.
1771. gbpat36.seq - Patent sequence entries, part 36.
1772. gbpat37.seq - Patent sequence entries, part 37.
1773. gbpat38.seq - Patent sequence entries, part 38.
1774. gbpat39.seq - Patent sequence entries, part 39.
1775. gbpat4.seq - Patent sequence entries, part 4.
1776. gbpat40.seq - Patent sequence entries, part 40.
1777. gbpat41.seq - Patent sequence entries, part 41.
1778. gbpat42.seq - Patent sequence entries, part 42.
1779. gbpat43.seq - Patent sequence entries, part 43.
1780. gbpat44.seq - Patent sequence entries, part 44.
1781. gbpat45.seq - Patent sequence entries, part 45.
1782. gbpat46.seq - Patent sequence entries, part 46.
1783. gbpat47.seq - Patent sequence entries, part 47.
1784. gbpat48.seq - Patent sequence entries, part 48.
1785. gbpat49.seq - Patent sequence entries, part 49.
1786. gbpat5.seq - Patent sequence entries, part 5.
1787. gbpat50.seq - Patent sequence entries, part 50.
1788. gbpat51.seq - Patent sequence entries, part 51.
1789. gbpat52.seq - Patent sequence entries, part 52.
1790. gbpat53.seq - Patent sequence entries, part 53.
1791. gbpat54.seq - Patent sequence entries, part 54.
1792. gbpat55.seq - Patent sequence entries, part 55.
1793. gbpat56.seq - Patent sequence entries, part 56.
1794. gbpat57.seq - Patent sequence entries, part 57.
1795. gbpat58.seq - Patent sequence entries, part 58.
1796. gbpat59.seq - Patent sequence entries, part 59.
1797. gbpat6.seq - Patent sequence entries, part 6.
1798. gbpat60.seq - Patent sequence entries, part 60.
1799. gbpat61.seq - Patent sequence entries, part 61.
1800. gbpat62.seq - Patent sequence entries, part 62.
1801. gbpat63.seq - Patent sequence entries, part 63.
1802. gbpat64.seq - Patent sequence entries, part 64.
1803. gbpat65.seq - Patent sequence entries, part 65.
1804. gbpat66.seq - Patent sequence entries, part 66.
1805. gbpat67.seq - Patent sequence entries, part 67.
1806. gbpat68.seq - Patent sequence entries, part 68.
1807. gbpat69.seq - Patent sequence entries, part 69.
1808. gbpat7.seq - Patent sequence entries, part 7.
1809. gbpat70.seq - Patent sequence entries, part 70.
1810. gbpat71.seq - Patent sequence entries, part 71.
1811. gbpat72.seq - Patent sequence entries, part 72.
1812. gbpat73.seq - Patent sequence entries, part 73.
1813. gbpat74.seq - Patent sequence entries, part 74.
1814. gbpat75.seq - Patent sequence entries, part 75.
1815. gbpat76.seq - Patent sequence entries, part 76.
1816. gbpat77.seq - Patent sequence entries, part 77.
1817. gbpat78.seq - Patent sequence entries, part 78.
1818. gbpat79.seq - Patent sequence entries, part 79.
1819. gbpat8.seq - Patent sequence entries, part 8.
1820. gbpat80.seq - Patent sequence entries, part 80.
1821. gbpat81.seq - Patent sequence entries, part 81.
1822. gbpat82.seq - Patent sequence entries, part 82.
1823. gbpat83.seq - Patent sequence entries, part 83.
1824. gbpat84.seq - Patent sequence entries, part 84.
1825. gbpat85.seq - Patent sequence entries, part 85.
1826. gbpat86.seq - Patent sequence entries, part 86.
1827. gbpat87.seq - Patent sequence entries, part 87.
1828. gbpat88.seq - Patent sequence entries, part 88.
1829. gbpat89.seq - Patent sequence entries, part 89.
1830. gbpat9.seq - Patent sequence entries, part 9.
1831. gbpat90.seq - Patent sequence entries, part 90.
1832. gbpat91.seq - Patent sequence entries, part 91.
1833. gbpat92.seq - Patent sequence entries, part 92.
1834. gbpat93.seq - Patent sequence entries, part 93.
1835. gbpat94.seq - Patent sequence entries, part 94.
1836. gbpat95.seq - Patent sequence entries, part 95.
1837. gbpat96.seq - Patent sequence entries, part 96.
1838. gbpat97.seq - Patent sequence entries, part 97.
1839. gbpat98.seq - Patent sequence entries, part 98.
1840. gbpat99.seq - Patent sequence entries, part 99.
1841. gbphg1.seq - Phage sequence entries, part 1.
1842. gbphg2.seq - Phage sequence entries, part 2.
1843. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1844. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1845. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1846. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1847. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1848. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1849. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1850. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1851. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1852. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1853. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1854. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1855. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1856. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1857. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1858. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1859. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1860. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1861. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1862. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1863. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1864. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1865. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1866. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1867. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1868. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1869. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1870. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1871. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1872. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1873. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1874. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1875. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1876. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1877. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1878. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1879. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1880. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1881. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1882. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1883. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1884. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1885. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1886. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1887. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1888. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1889. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1890. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1891. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1892. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1893. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1894. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1895. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1896. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1897. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1898. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1899. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
1900. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
1901. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
1902. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
1903. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
1904. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
1905. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
1906. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
1907. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
1908. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
1909. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1910. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
1911. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
1912. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
1913. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
1914. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
1915. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
1916. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
1917. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
1918. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
1919. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
1920. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1921. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
1922. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
1923. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
1924. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
1925. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
1926. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
1927. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
1928. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
1929. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
1930. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
1931. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1932. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
1933. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
1934. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
1935. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
1936. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
1937. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
1938. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
1939. gbpri1.seq - Primate sequence entries, part 1.
1940. gbpri10.seq - Primate sequence entries, part 10.
1941. gbpri11.seq - Primate sequence entries, part 11.
1942. gbpri12.seq - Primate sequence entries, part 12.
1943. gbpri13.seq - Primate sequence entries, part 13.
1944. gbpri14.seq - Primate sequence entries, part 14.
1945. gbpri15.seq - Primate sequence entries, part 15.
1946. gbpri16.seq - Primate sequence entries, part 16.
1947. gbpri17.seq - Primate sequence entries, part 17.
1948. gbpri18.seq - Primate sequence entries, part 18.
1949. gbpri19.seq - Primate sequence entries, part 19.
1950. gbpri2.seq - Primate sequence entries, part 2.
1951. gbpri20.seq - Primate sequence entries, part 20.
1952. gbpri21.seq - Primate sequence entries, part 21.
1953. gbpri22.seq - Primate sequence entries, part 22.
1954. gbpri23.seq - Primate sequence entries, part 23.
1955. gbpri24.seq - Primate sequence entries, part 24.
1956. gbpri25.seq - Primate sequence entries, part 25.
1957. gbpri26.seq - Primate sequence entries, part 26.
1958. gbpri27.seq - Primate sequence entries, part 27.
1959. gbpri28.seq - Primate sequence entries, part 28.
1960. gbpri29.seq - Primate sequence entries, part 29.
1961. gbpri3.seq - Primate sequence entries, part 3.
1962. gbpri30.seq - Primate sequence entries, part 30.
1963. gbpri31.seq - Primate sequence entries, part 31.
1964. gbpri32.seq - Primate sequence entries, part 32.
1965. gbpri33.seq - Primate sequence entries, part 33.
1966. gbpri34.seq - Primate sequence entries, part 34.
1967. gbpri35.seq - Primate sequence entries, part 35.
1968. gbpri36.seq - Primate sequence entries, part 36.
1969. gbpri37.seq - Primate sequence entries, part 37.
1970. gbpri38.seq - Primate sequence entries, part 38.
1971. gbpri39.seq - Primate sequence entries, part 39.
1972. gbpri4.seq - Primate sequence entries, part 4.
1973. gbpri40.seq - Primate sequence entries, part 40.
1974. gbpri41.seq - Primate sequence entries, part 41.
1975. gbpri42.seq - Primate sequence entries, part 42.
1976. gbpri43.seq - Primate sequence entries, part 43.
1977. gbpri44.seq - Primate sequence entries, part 44.
1978. gbpri45.seq - Primate sequence entries, part 45.
1979. gbpri46.seq - Primate sequence entries, part 46.
1980. gbpri47.seq - Primate sequence entries, part 47.
1981. gbpri48.seq - Primate sequence entries, part 48.
1982. gbpri5.seq - Primate sequence entries, part 5.
1983. gbpri6.seq - Primate sequence entries, part 6.
1984. gbpri7.seq - Primate sequence entries, part 7.
1985. gbpri8.seq - Primate sequence entries, part 8.
1986. gbpri9.seq - Primate sequence entries, part 9.
1987. gbrel.txt - Release notes (this document).
1988. gbrod1.seq - Rodent sequence entries, part 1.
1989. gbrod10.seq - Rodent sequence entries, part 10.
1990. gbrod11.seq - Rodent sequence entries, part 11.
1991. gbrod12.seq - Rodent sequence entries, part 12.
1992. gbrod13.seq - Rodent sequence entries, part 13.
1993. gbrod14.seq - Rodent sequence entries, part 14.
1994. gbrod15.seq - Rodent sequence entries, part 15.
1995. gbrod16.seq - Rodent sequence entries, part 16.
1996. gbrod17.seq - Rodent sequence entries, part 17.
1997. gbrod18.seq - Rodent sequence entries, part 18.
1998. gbrod19.seq - Rodent sequence entries, part 19.
1999. gbrod2.seq - Rodent sequence entries, part 2.
2000. gbrod20.seq - Rodent sequence entries, part 20.
2001. gbrod21.seq - Rodent sequence entries, part 21.
2002. gbrod22.seq - Rodent sequence entries, part 22.
2003. gbrod23.seq - Rodent sequence entries, part 23.
2004. gbrod24.seq - Rodent sequence entries, part 24.
2005. gbrod25.seq - Rodent sequence entries, part 25.
2006. gbrod26.seq - Rodent sequence entries, part 26.
2007. gbrod27.seq - Rodent sequence entries, part 27.
2008. gbrod28.seq - Rodent sequence entries, part 28.
2009. gbrod29.seq - Rodent sequence entries, part 29.
2010. gbrod3.seq - Rodent sequence entries, part 3.
2011. gbrod30.seq - Rodent sequence entries, part 30.
2012. gbrod31.seq - Rodent sequence entries, part 31.
2013. gbrod4.seq - Rodent sequence entries, part 4.
2014. gbrod5.seq - Rodent sequence entries, part 5.
2015. gbrod6.seq - Rodent sequence entries, part 6.
2016. gbrod7.seq - Rodent sequence entries, part 7.
2017. gbrod8.seq - Rodent sequence entries, part 8.
2018. gbrod9.seq - Rodent sequence entries, part 9.
2019. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2020. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2021. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2022. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2023. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2024. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2025. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2026. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2027. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2028. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2029. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2030. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2031. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2032. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2033. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2034. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2035. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2036. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2037. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2038. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2039. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2040. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2041. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2042. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2043. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2044. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2045. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2046. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2047. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2048. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2049. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2050. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2051. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2052. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2053. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2054. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2055. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2056. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2057. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2058. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2059. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2060. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2061. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2062. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2063. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2064. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2065. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2066. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2067. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2068. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2069. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2070. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2071. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2072. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2073. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2074. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2075. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2076. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2077. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2078. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2079. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2080. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2081. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2082. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2083. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2084. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2085. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2086. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2087. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2088. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2089. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2090. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2091. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2092. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2093. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2094. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2095. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2096. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2097. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2098. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2099. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2100. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2101. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2102. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2103. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2104. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2105. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2106. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2107. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2108. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2109. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2110. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2111. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2112. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2113. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2114. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2115. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2116. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2117. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2118. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2119. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2120. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2121. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2122. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2123. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2124. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2125. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2126. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2127. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2128. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2129. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2130. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2131. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2132. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2133. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2134. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2135. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2136. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2137. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2138. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2139. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2140. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2141. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2142. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2143. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2144. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2145. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2146. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2147. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2148. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2149. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2150. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2151. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2152. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2153. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2154. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2155. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2156. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2157. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2158. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2159. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2160. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2161. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2162. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2163. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2164. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2165. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2166. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2167. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2168. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2169. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2170. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2171. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2172. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2173. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2174. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2175. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2176. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2177. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2178. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2179. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2180. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2181. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2182. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2183. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2184. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2185. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2186. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2187. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2188. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2189. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2190. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2191. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2192. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2193. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2194. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2195. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2196. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2197. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2198. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2199. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2200. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2201. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2202. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2203. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2204. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2205. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2206. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2207. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2208. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2209. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2210. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2211. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2212. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2213. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2214. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2215. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2216. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2217. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2218. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2219. gbuna1.seq - Unannotated sequence entries, part 1.
2220. gbvrl1.seq - Viral sequence entries, part 1.
2221. gbvrl10.seq - Viral sequence entries, part 10.
2222. gbvrl11.seq - Viral sequence entries, part 11.
2223. gbvrl12.seq - Viral sequence entries, part 12.
2224. gbvrl13.seq - Viral sequence entries, part 13.
2225. gbvrl14.seq - Viral sequence entries, part 14.
2226. gbvrl15.seq - Viral sequence entries, part 15.
2227. gbvrl16.seq - Viral sequence entries, part 16.
2228. gbvrl17.seq - Viral sequence entries, part 17.
2229. gbvrl18.seq - Viral sequence entries, part 18.
2230. gbvrl19.seq - Viral sequence entries, part 19.
2231. gbvrl2.seq - Viral sequence entries, part 2.
2232. gbvrl20.seq - Viral sequence entries, part 20.
2233. gbvrl21.seq - Viral sequence entries, part 21.
2234. gbvrl22.seq - Viral sequence entries, part 22.
2235. gbvrl23.seq - Viral sequence entries, part 23.
2236. gbvrl24.seq - Viral sequence entries, part 24.
2237. gbvrl25.seq - Viral sequence entries, part 25.
2238. gbvrl26.seq - Viral sequence entries, part 26.
2239. gbvrl27.seq - Viral sequence entries, part 27.
2240. gbvrl28.seq - Viral sequence entries, part 28.
2241. gbvrl29.seq - Viral sequence entries, part 29.
2242. gbvrl3.seq - Viral sequence entries, part 3.
2243. gbvrl30.seq - Viral sequence entries, part 30.
2244. gbvrl31.seq - Viral sequence entries, part 31.
2245. gbvrl32.seq - Viral sequence entries, part 32.
2246. gbvrl33.seq - Viral sequence entries, part 33.
2247. gbvrl4.seq - Viral sequence entries, part 4.
2248. gbvrl5.seq - Viral sequence entries, part 5.
2249. gbvrl6.seq - Viral sequence entries, part 6.
2250. gbvrl7.seq - Viral sequence entries, part 7.
2251. gbvrl8.seq - Viral sequence entries, part 8.
2252. gbvrl9.seq - Viral sequence entries, part 9.
2253. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2254. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2255. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2256. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2257. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2258. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2259. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2260. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2261. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2262. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2263. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2264. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2265. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2266. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2267. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2268. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2269. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2270. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2271. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2272. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2273. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2274. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2275. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2276. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2277. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2278. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2279. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2280. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2281. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2282. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2283. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2284. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2285. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2286. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2287. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2288. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2289. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2290. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2291. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2292. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2293. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2294. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2295. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2296. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2297. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 206.0 flatfiles require roughly 700 GB (sequence
files only) or 700 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249997894     gbbct1.seq
 245948007     gbbct10.seq
 238967086     gbbct100.seq
 246082152     gbbct101.seq
 249116493     gbbct102.seq
 248456865     gbbct103.seq
 242187433     gbbct104.seq
 246793618     gbbct105.seq
 243798006     gbbct106.seq
 240240569     gbbct107.seq
  97745154     gbbct108.seq
 246485382     gbbct109.seq
 248380934     gbbct11.seq
 249572062     gbbct110.seq
 249100664     gbbct111.seq
 246717136     gbbct112.seq
 247429158     gbbct113.seq
 246056538     gbbct114.seq
 245791265     gbbct115.seq
  35697219     gbbct116.seq
 247834838     gbbct117.seq
 245776743     gbbct118.seq
 248190658     gbbct119.seq
 239030029     gbbct12.seq
 245090760     gbbct120.seq
 247334839     gbbct121.seq
 244247711     gbbct122.seq
 249524401     gbbct123.seq
 242401214     gbbct124.seq
 247740593     gbbct125.seq
  70087911     gbbct126.seq
 247172170     gbbct127.seq
 242228996     gbbct128.seq
 245394388     gbbct129.seq
 249754061     gbbct13.seq
 242251348     gbbct130.seq
 242696502     gbbct131.seq
 239575884     gbbct132.seq
 244382964     gbbct133.seq
  75463875     gbbct134.seq
 240206985     gbbct135.seq
  57543735     gbbct136.seq
   6927631     gbbct137.seq
  14306927     gbbct138.seq
  23079580     gbbct139.seq
 233391532     gbbct14.seq
  45148073     gbbct140.seq
  87881524     gbbct141.seq
 170679858     gbbct142.seq
 249997333     gbbct143.seq
 249998470     gbbct144.seq
 247208999     gbbct145.seq
 240481511     gbbct146.seq
 246240443     gbbct147.seq
 241247609     gbbct148.seq
 243336152     gbbct149.seq
 248696990     gbbct15.seq
 249854420     gbbct150.seq
 246995839     gbbct151.seq
 222836632     gbbct152.seq
 246610651     gbbct153.seq
 245211048     gbbct154.seq
 247265070     gbbct155.seq
 246339928     gbbct156.seq
 247546421     gbbct157.seq
 249994995     gbbct158.seq
 250000073     gbbct159.seq
 245476206     gbbct16.seq
 149118316     gbbct160.seq
 249998419     gbbct161.seq
 249998122     gbbct162.seq
 249833113     gbbct163.seq
 249997228     gbbct164.seq
 242473485     gbbct165.seq
 249625584     gbbct166.seq
 249883374     gbbct167.seq
 243618449     gbbct168.seq
 188359783     gbbct169.seq
 114744927     gbbct17.seq
 243334579     gbbct18.seq
 249792142     gbbct19.seq
 246659608     gbbct2.seq
 248348783     gbbct20.seq
 249804082     gbbct21.seq
 244061769     gbbct22.seq
 245379497     gbbct23.seq
 242878304     gbbct24.seq
 239679091     gbbct25.seq
 217808916     gbbct26.seq
 242805532     gbbct27.seq
 245839152     gbbct28.seq
 248681406     gbbct29.seq
 247578974     gbbct3.seq
 247877713     gbbct30.seq
 249391913     gbbct31.seq
 244189578     gbbct32.seq
 247339454     gbbct33.seq
 249981331     gbbct34.seq
 249765495     gbbct35.seq
 240922368     gbbct36.seq
 244795703     gbbct37.seq
 249622085     gbbct38.seq
 165336566     gbbct39.seq
 247486300     gbbct4.seq
 247451342     gbbct40.seq
 246942553     gbbct41.seq
 248190526     gbbct42.seq
 246579238     gbbct43.seq
 241884957     gbbct44.seq
 246673296     gbbct45.seq
 249205838     gbbct46.seq
 248559063     gbbct47.seq
 246965555     gbbct48.seq
 241585305     gbbct49.seq
 249999162     gbbct5.seq
 244262887     gbbct50.seq
 244110608     gbbct51.seq
  49416928     gbbct52.seq
 244557955     gbbct53.seq
 245263673     gbbct54.seq
 239704276     gbbct55.seq
 247755881     gbbct56.seq
 239866269     gbbct57.seq
 247440263     gbbct58.seq
 249953222     gbbct59.seq
  48118795     gbbct6.seq
 247309122     gbbct60.seq
 238422847     gbbct61.seq
 244740204     gbbct62.seq
 247475780     gbbct63.seq
 238999149     gbbct64.seq
 246363006     gbbct65.seq
 100530881     gbbct66.seq
 248766373     gbbct67.seq
 248625199     gbbct68.seq
 249954071     gbbct69.seq
 249901204     gbbct7.seq
 246141857     gbbct70.seq
 240222764     gbbct71.seq
 249454904     gbbct72.seq
 249423043     gbbct73.seq
 244707182     gbbct74.seq
 245855552     gbbct75.seq
 245592112     gbbct76.seq
 249681583     gbbct77.seq
 239407518     gbbct78.seq
 249516170     gbbct79.seq
 240988133     gbbct8.seq
  61286830     gbbct80.seq
 249376574     gbbct81.seq
 248978861     gbbct82.seq
 243180154     gbbct83.seq
 249600354     gbbct84.seq
 249296069     gbbct85.seq
 247117700     gbbct86.seq
 244878229     gbbct87.seq
 240449604     gbbct88.seq
 244022002     gbbct89.seq
 238870495     gbbct9.seq
  26340508     gbbct90.seq
 238827180     gbbct91.seq
 245659466     gbbct92.seq
 245298257     gbbct93.seq
 249065726     gbbct94.seq
 245910888     gbbct95.seq
 230810731     gbbct96.seq
 211597903     gbbct97.seq
 245061611     gbbct98.seq
 240937723     gbbct99.seq
   2524938     gbchg.txt
 249997713     gbcon1.seq
 249996065     gbcon10.seq
 249998566     gbcon100.seq
 249998527     gbcon101.seq
 249996033     gbcon102.seq
 249999285     gbcon103.seq
 135141019     gbcon104.seq
 249999018     gbcon105.seq
 249995506     gbcon106.seq
 249999938     gbcon107.seq
 249996196     gbcon108.seq
 249994668     gbcon109.seq
 248990296     gbcon11.seq
 158184767     gbcon110.seq
 249997662     gbcon111.seq
 249996981     gbcon112.seq
 249998026     gbcon113.seq
 236167379     gbcon114.seq
 171683837     gbcon115.seq
 249997499     gbcon116.seq
 249999738     gbcon117.seq
  48589625     gbcon118.seq
 249999946     gbcon119.seq
 247444459     gbcon12.seq
 249997838     gbcon120.seq
 208854824     gbcon121.seq
 204220103     gbcon122.seq
 249456787     gbcon123.seq
 249913279     gbcon124.seq
 249999271     gbcon125.seq
 249995986     gbcon126.seq
 250000240     gbcon127.seq
 201493806     gbcon128.seq
 249998604     gbcon129.seq
 249752516     gbcon13.seq
 249664036     gbcon130.seq
 248606553     gbcon131.seq
 249867670     gbcon132.seq
 249997253     gbcon133.seq
 249900766     gbcon134.seq
 249998239     gbcon135.seq
  64064621     gbcon136.seq
 249999033     gbcon137.seq
 249997532     gbcon138.seq
 249998422     gbcon139.seq
 249533613     gbcon14.seq
 249998047     gbcon140.seq
 249997396     gbcon141.seq
 249980622     gbcon142.seq
 249996223     gbcon143.seq
 249999735     gbcon144.seq
 209349414     gbcon145.seq
 249998557     gbcon146.seq
 250000160     gbcon147.seq
 250000086     gbcon148.seq
 249756064     gbcon149.seq
 249645592     gbcon15.seq
 246723201     gbcon150.seq
 249999822     gbcon151.seq
 249999025     gbcon152.seq
 249999175     gbcon153.seq
 249999110     gbcon154.seq
 249966524     gbcon155.seq
 249995042     gbcon156.seq
 249997853     gbcon157.seq
 249999114     gbcon158.seq
 113199682     gbcon159.seq
 249694899     gbcon16.seq
 249999135     gbcon160.seq
 249950010     gbcon161.seq
 249994077     gbcon162.seq
 249998595     gbcon163.seq
 249984916     gbcon164.seq
 105197595     gbcon165.seq
 249996362     gbcon166.seq
 249995596     gbcon167.seq
 249999106     gbcon168.seq
 250000234     gbcon169.seq
 157974154     gbcon17.seq
 249899962     gbcon170.seq
 249999088     gbcon171.seq
 249871149     gbcon172.seq
 249930422     gbcon173.seq
 249925260     gbcon174.seq
 249997710     gbcon175.seq
  68066745     gbcon176.seq
 249403493     gbcon177.seq
 249642744     gbcon178.seq
 249997861     gbcon179.seq
 249993310     gbcon18.seq
 249603235     gbcon180.seq
 249999774     gbcon181.seq
 249999205     gbcon182.seq
 166096233     gbcon183.seq
 249864262     gbcon184.seq
 249999632     gbcon185.seq
 249162140     gbcon186.seq
 249927921     gbcon187.seq
 247587158     gbcon188.seq
 249962598     gbcon189.seq
 249998710     gbcon19.seq
 249996790     gbcon190.seq
 249945949     gbcon191.seq
 249806929     gbcon192.seq
 249995025     gbcon193.seq
 249998577     gbcon194.seq
 249904256     gbcon195.seq
 249999635     gbcon196.seq
  94814973     gbcon197.seq
 249998885     gbcon198.seq
 249999422     gbcon199.seq
 249355953     gbcon2.seq
 249999706     gbcon20.seq
 249999751     gbcon200.seq
 249998203     gbcon201.seq
 178583557     gbcon202.seq
 250000110     gbcon203.seq
 249999468     gbcon204.seq
 249999605     gbcon205.seq
 249999663     gbcon206.seq
 138364205     gbcon207.seq
 249996333     gbcon208.seq
 249988354     gbcon209.seq
 249999763     gbcon21.seq
 249963960     gbcon210.seq
 249885606     gbcon211.seq
 249999112     gbcon212.seq
 145597068     gbcon213.seq
 249998051     gbcon214.seq
 249994641     gbcon215.seq
 250000247     gbcon216.seq
 249986733     gbcon217.seq
 249982287     gbcon218.seq
 249996267     gbcon219.seq
 247843596     gbcon22.seq
 144543217     gbcon220.seq
 249998257     gbcon221.seq
 249994642     gbcon222.seq
 249999210     gbcon223.seq
 249998808     gbcon224.seq
 219065861     gbcon225.seq
 249998544     gbcon226.seq
 249991532     gbcon227.seq
 250000040     gbcon228.seq
 249999767     gbcon229.seq
 249998986     gbcon23.seq
 179469134     gbcon230.seq
 249968617     gbcon231.seq
 249997146     gbcon232.seq
 249997231     gbcon233.seq
 249998935     gbcon234.seq
 249999144     gbcon235.seq
 249972265     gbcon236.seq
  21428424     gbcon237.seq
 249996911     gbcon238.seq
 249348520     gbcon239.seq
 234557793     gbcon24.seq
 249998977     gbcon240.seq
 249999733     gbcon241.seq
 250000249     gbcon242.seq
 249757933     gbcon243.seq
 249995984     gbcon244.seq
 249987577     gbcon245.seq
 115741371     gbcon246.seq
 249998055     gbcon247.seq
 249998942     gbcon248.seq
 249663827     gbcon249.seq
 249996485     gbcon25.seq
 250000131     gbcon250.seq
 249997702     gbcon251.seq
 128345197     gbcon252.seq
 249998524     gbcon253.seq
 249961426     gbcon254.seq
 249995827     gbcon255.seq
 249997585     gbcon256.seq
 249976748     gbcon257.seq
 249999402     gbcon258.seq
 182798599     gbcon259.seq
 249150042     gbcon26.seq
 249999962     gbcon260.seq
 249996982     gbcon261.seq
 249987927     gbcon262.seq
 249998391     gbcon263.seq
 249998186     gbcon264.seq
 250000045     gbcon265.seq
 249998958     gbcon266.seq
  25173293     gbcon267.seq
 249996780     gbcon268.seq
 249995687     gbcon269.seq
  98910480     gbcon27.seq
 249998494     gbcon270.seq
 249996298     gbcon271.seq
 249997851     gbcon272.seq
 146875638     gbcon273.seq
 249999438     gbcon274.seq
 249996140     gbcon275.seq
 249998268     gbcon276.seq
 249996910     gbcon277.seq
 249996627     gbcon278.seq
 130710404     gbcon279.seq
 250000124     gbcon28.seq
 249998530     gbcon280.seq
 249998600     gbcon281.seq
 249996615     gbcon282.seq
 249995776     gbcon283.seq
 249998685     gbcon284.seq
 249998289     gbcon285.seq
  14868285     gbcon286.seq
 249997335     gbcon287.seq
 250000048     gbcon288.seq
 249999321     gbcon289.seq
  79027611     gbcon29.seq
 249998345     gbcon290.seq
 249999640     gbcon291.seq
 249998392     gbcon292.seq
 249999875     gbcon293.seq
 249680560     gbcon294.seq
 249999757     gbcon295.seq
  13285026     gbcon296.seq
 249996261     gbcon297.seq
 249998916     gbcon298.seq
 249821492     gbcon299.seq
 249284827     gbcon3.seq
 249993709     gbcon30.seq
 249991101     gbcon300.seq
 249999256     gbcon301.seq
  29194075     gbcon302.seq
  18863606     gbcon303.seq
 249868388     gbcon31.seq
 249999028     gbcon32.seq
 249997108     gbcon33.seq
 116769026     gbcon34.seq
 249998917     gbcon35.seq
 249996531     gbcon36.seq
 249997326     gbcon37.seq
 249998915     gbcon38.seq
 249998283     gbcon39.seq
 249992516     gbcon4.seq
 212314610     gbcon40.seq
 249997270     gbcon41.seq
 249999221     gbcon42.seq
 249994732     gbcon43.seq
 249996897     gbcon44.seq
 249997078     gbcon45.seq
 249997414     gbcon46.seq
  63412389     gbcon47.seq
 249995423     gbcon48.seq
 249997315     gbcon49.seq
 249994412     gbcon5.seq
 249997250     gbcon50.seq
 249997590     gbcon51.seq
 249996159     gbcon52.seq
  44928861     gbcon53.seq
 249994872     gbcon54.seq
 249995799     gbcon55.seq
 249997684     gbcon56.seq
 249996690     gbcon57.seq
 249997782     gbcon58.seq
  38241897     gbcon59.seq
 249999294     gbcon6.seq
 249998302     gbcon60.seq
 249999150     gbcon61.seq
 249998346     gbcon62.seq
 249994564     gbcon63.seq
 249999492     gbcon64.seq
 154672375     gbcon65.seq
 249999016     gbcon66.seq
 249996777     gbcon67.seq
 249999159     gbcon68.seq
 249995190     gbcon69.seq
 146162679     gbcon7.seq
 185611272     gbcon70.seq
 249996810     gbcon71.seq
 249998700     gbcon72.seq
 249997155     gbcon73.seq
 249997874     gbcon74.seq
 247616447     gbcon75.seq
 249998269     gbcon76.seq
 249995941     gbcon77.seq
 249998068     gbcon78.seq
 249999277     gbcon79.seq
 249993190     gbcon8.seq
 249999797     gbcon80.seq
  98773033     gbcon81.seq
 249997150     gbcon82.seq
 249997442     gbcon83.seq
 249995516     gbcon84.seq
 249996111     gbcon85.seq
 249995971     gbcon86.seq
  64633499     gbcon87.seq
 249998451     gbcon88.seq
 249995859     gbcon89.seq
 249997980     gbcon9.seq
 249994386     gbcon90.seq
 249994858     gbcon91.seq
 249998199     gbcon92.seq
  23638323     gbcon93.seq
 249997115     gbcon94.seq
 249995538     gbcon95.seq
 249998987     gbcon96.seq
 249999150     gbcon97.seq
 199759401     gbcon98.seq
 249994089     gbcon99.seq
   3786395     gbdel.txt
 249998933     gbenv1.seq
 249999470     gbenv10.seq
 249998257     gbenv11.seq
 249999356     gbenv12.seq
  60946830     gbenv13.seq
 249999199     gbenv14.seq
 249999926     gbenv15.seq
 249998159     gbenv16.seq
 249999651     gbenv17.seq
 249997773     gbenv18.seq
 249999405     gbenv19.seq
 249998531     gbenv2.seq
 249996430     gbenv20.seq
 237938705     gbenv21.seq
 249997330     gbenv22.seq
 249997940     gbenv23.seq
 249998333     gbenv24.seq
 249999968     gbenv25.seq
 165978464     gbenv26.seq
 249998526     gbenv27.seq
 249949108     gbenv28.seq
 249999969     gbenv29.seq
 249941729     gbenv3.seq
 249999786     gbenv30.seq
 250000133     gbenv31.seq
 249997258     gbenv32.seq
  56154549     gbenv33.seq
 249999624     gbenv34.seq
 249998602     gbenv35.seq
 249998782     gbenv36.seq
 250000004     gbenv37.seq
 187710496     gbenv38.seq
 249998968     gbenv39.seq
 249999686     gbenv4.seq
 249997632     gbenv40.seq
 249998187     gbenv41.seq
 249999335     gbenv42.seq
 249998885     gbenv43.seq
 249996858     gbenv44.seq
  54442742     gbenv45.seq
 250000020     gbenv46.seq
 249999808     gbenv47.seq
 249999508     gbenv48.seq
 249997437     gbenv49.seq
 249998039     gbenv5.seq
 198996408     gbenv50.seq
 249999437     gbenv51.seq
 249999375     gbenv52.seq
 249999236     gbenv53.seq
 249999411     gbenv54.seq
 249998333     gbenv55.seq
  88788481     gbenv56.seq
 249999933     gbenv57.seq
 249998108     gbenv58.seq
 249999086     gbenv59.seq
 249998865     gbenv6.seq
 249999982     gbenv60.seq
 249997385     gbenv61.seq
 125120617     gbenv62.seq
 249999341     gbenv63.seq
 249998536     gbenv64.seq
 249999503     gbenv65.seq
 249998256     gbenv66.seq
 249999274     gbenv67.seq
  79260662     gbenv68.seq
 249997351     gbenv69.seq
 249999987     gbenv7.seq
 249999514     gbenv70.seq
 249998951     gbenv71.seq
 249999680     gbenv72.seq
 249999631     gbenv73.seq
 111301317     gbenv74.seq
 249997813     gbenv75.seq
 249999564     gbenv76.seq
 249998409     gbenv77.seq
 249998828     gbenv78.seq
 249999262     gbenv79.seq
    368712     gbenv8.seq
  42326651     gbenv80.seq
 249998764     gbenv9.seq
 524289247     gbest1.seq
 524290179     gbest10.seq
 524289097     gbest100.seq
 524290044     gbest101.seq
 524289746     gbest102.seq
 524290143     gbest103.seq
 350626198     gbest104.seq
 524290437     gbest105.seq
 524291288     gbest106.seq
 524289171     gbest107.seq
 382495690     gbest108.seq
 386199839     gbest109.seq
 524292351     gbest11.seq
 380000388     gbest110.seq
 380752459     gbest111.seq
 377684389     gbest112.seq
 381798471     gbest113.seq
 385867766     gbest114.seq
 385246064     gbest115.seq
 384104444     gbest116.seq
 380304417     gbest117.seq
 403271712     gbest118.seq
 478961531     gbest119.seq
 524290260     gbest12.seq
 524288832     gbest120.seq
 524291279     gbest121.seq
 524291355     gbest122.seq
 524291111     gbest123.seq
 471067127     gbest124.seq
 524289237     gbest125.seq
 524290784     gbest126.seq
 524289852     gbest127.seq
 524289456     gbest128.seq
 524289052     gbest129.seq
 144348436     gbest13.seq
 524290655     gbest130.seq
 524290261     gbest131.seq
 524291681     gbest132.seq
 524288810     gbest133.seq
 524292712     gbest134.seq
 524291458     gbest135.seq
 524292258     gbest136.seq
 281003451     gbest137.seq
 524291027     gbest138.seq
 524290069     gbest139.seq
 524289497     gbest14.seq
 524289907     gbest140.seq
 524290805     gbest141.seq
 524292294     gbest142.seq
 524289395     gbest143.seq
 524290580     gbest144.seq
 524290979     gbest145.seq
 524292930     gbest146.seq
 524292380     gbest147.seq
 524290094     gbest148.seq
 524290761     gbest149.seq
 524291129     gbest15.seq
 524291466     gbest150.seq
 458373944     gbest151.seq
 524289814     gbest152.seq
 524291743     gbest153.seq
 524291197     gbest154.seq
 524291300     gbest155.seq
 524289714     gbest156.seq
 524290430     gbest157.seq
 524289622     gbest158.seq
 524291215     gbest159.seq
 524289495     gbest16.seq
 524290003     gbest160.seq
 524291189     gbest161.seq
 524292159     gbest162.seq
 524289033     gbest163.seq
 227251799     gbest164.seq
 524290812     gbest165.seq
 524288852     gbest166.seq
 524291501     gbest167.seq
 524292082     gbest168.seq
 524291124     gbest169.seq
 524289758     gbest17.seq
 524289637     gbest170.seq
 524290637     gbest171.seq
 524290645     gbest172.seq
 524290485     gbest173.seq
 524289773     gbest174.seq
 524290893     gbest175.seq
 524290711     gbest176.seq
 524289642     gbest177.seq
  92931618     gbest178.seq
 524289086     gbest179.seq
 524289662     gbest18.seq
 524289463     gbest180.seq
 524288887     gbest181.seq
 524290046     gbest182.seq
 524290350     gbest183.seq
 524291590     gbest184.seq
 524290077     gbest185.seq
 524290139     gbest186.seq
 524289938     gbest187.seq
 524290440     gbest188.seq
 524289467     gbest189.seq
 524289972     gbest19.seq
 524289571     gbest190.seq
 456074785     gbest191.seq
 524292321     gbest192.seq
 524289721     gbest193.seq
 524295648     gbest194.seq
 524292043     gbest195.seq
 524289264     gbest196.seq
 524289568     gbest197.seq
 524291001     gbest198.seq
 524290484     gbest199.seq
 524289009     gbest2.seq
 524289912     gbest20.seq
 524289278     gbest200.seq
 524291545     gbest201.seq
 524290872     gbest202.seq
 524290228     gbest203.seq
 524290090     gbest204.seq
  54104975     gbest205.seq
 524290496     gbest206.seq
 524288928     gbest207.seq
 524291218     gbest208.seq
 524289398     gbest209.seq
 524290770     gbest21.seq
 524289227     gbest210.seq
 524288989     gbest211.seq
 524290255     gbest212.seq
 524292774     gbest213.seq
 524288980     gbest214.seq
 524288815     gbest215.seq
 483344981     gbest216.seq
 524291175     gbest217.seq
 524289746     gbest218.seq
 524289760     gbest219.seq
 494163920     gbest22.seq
 524288768     gbest220.seq
 524290777     gbest221.seq
 524290227     gbest222.seq
 524289024     gbest223.seq
 524289018     gbest224.seq
 524292373     gbest225.seq
 524290004     gbest226.seq
 524289692     gbest227.seq
 524292291     gbest228.seq
 458810732     gbest229.seq
 491112693     gbest23.seq
 524289754     gbest230.seq
 524289818     gbest231.seq
 524288879     gbest232.seq
 524289444     gbest233.seq
 524290665     gbest234.seq
 524289042     gbest235.seq
 524289070     gbest236.seq
 524289831     gbest237.seq
 524288909     gbest238.seq
 524289789     gbest239.seq
 502297308     gbest24.seq
 524291991     gbest240.seq
 524289776     gbest241.seq
 524292042     gbest242.seq
 524289591     gbest243.seq
 237401297     gbest244.seq
 524289256     gbest245.seq
 524291541     gbest246.seq
 524289838     gbest247.seq
 524288735     gbest248.seq
 524291618     gbest249.seq
 329400420     gbest25.seq
 524289994     gbest250.seq
 524289026     gbest251.seq
 510471962     gbest252.seq
 524289165     gbest253.seq
 524289531     gbest254.seq
 524289954     gbest255.seq
 332400990     gbest256.seq
 524289278     gbest257.seq
 524290416     gbest258.seq
 524291040     gbest259.seq
 524290540     gbest26.seq
 524289178     gbest260.seq
 524289767     gbest261.seq
 524290830     gbest262.seq
 524289483     gbest263.seq
 524290921     gbest264.seq
 524289710     gbest265.seq
 524289877     gbest266.seq
 217494634     gbest267.seq
 524289549     gbest268.seq
 524289444     gbest269.seq
 524289854     gbest27.seq
 524290930     gbest270.seq
 524291465     gbest271.seq
 524290665     gbest272.seq
 524289645     gbest273.seq
 524290292     gbest274.seq
 524288897     gbest275.seq
 524291058     gbest276.seq
 524288829     gbest277.seq
 524289859     gbest278.seq
 356808824     gbest279.seq
 524291657     gbest28.seq
 524292430     gbest280.seq
 524290104     gbest281.seq
 524291274     gbest282.seq
 524291127     gbest283.seq
 524289518     gbest284.seq
 524289287     gbest285.seq
 524290844     gbest286.seq
 524288768     gbest287.seq
 524290316     gbest288.seq
 524289859     gbest289.seq
 524289170     gbest29.seq
 524288813     gbest290.seq
 280057820     gbest291.seq
 524292881     gbest292.seq
 524291035     gbest293.seq
 524289198     gbest294.seq
 524288880     gbest295.seq
 524289078     gbest296.seq
 524289179     gbest297.seq
 524289077     gbest298.seq
 524290731     gbest299.seq
 488097672     gbest3.seq
 524291365     gbest30.seq
 524290143     gbest300.seq
 524290495     gbest301.seq
 469548670     gbest302.seq
 329402572     gbest303.seq
 475796262     gbest304.seq
 472085677     gbest305.seq
 524289984     gbest306.seq
 524290215     gbest307.seq
 524291941     gbest308.seq
 524290316     gbest309.seq
 524290977     gbest31.seq
 524289981     gbest310.seq
 524289596     gbest311.seq
 524289209     gbest312.seq
 524289615     gbest313.seq
 524292378     gbest314.seq
 524292115     gbest315.seq
 387001262     gbest316.seq
 524292043     gbest317.seq
 524289801     gbest318.seq
 524290331     gbest319.seq
 524289293     gbest32.seq
 524291358     gbest320.seq
 524289659     gbest321.seq
 524289296     gbest322.seq
 524289511     gbest323.seq
 524291770     gbest324.seq
 524290189     gbest325.seq
 524290750     gbest326.seq
 524291768     gbest327.seq
 517058288     gbest328.seq
 516252435     gbest329.seq
 524289108     gbest33.seq
 222913888     gbest330.seq
 524289012     gbest331.seq
 524289849     gbest332.seq
 524291213     gbest333.seq
 524289988     gbest334.seq
 524289326     gbest335.seq
 524289903     gbest336.seq
 495677560     gbest337.seq
 524289690     gbest338.seq
 524289868     gbest339.seq
 508771527     gbest34.seq
 524292349     gbest340.seq
 524288837     gbest341.seq
 524288866     gbest342.seq
 524289898     gbest343.seq
 324115626     gbest344.seq
 524289803     gbest345.seq
 524291251     gbest346.seq
 524289986     gbest347.seq
 524290428     gbest348.seq
 524290328     gbest349.seq
 486378976     gbest35.seq
 524289414     gbest350.seq
 510463832     gbest351.seq
 524290160     gbest352.seq
 524289327     gbest353.seq
 524294745     gbest354.seq
 524289235     gbest355.seq
 524291586     gbest356.seq
 524290137     gbest357.seq
 524291915     gbest358.seq
 150514017     gbest359.seq
 488137492     gbest36.seq
 524288781     gbest360.seq
 524290974     gbest361.seq
 524290601     gbest362.seq
 524288935     gbest363.seq
 524289189     gbest364.seq
 524290170     gbest365.seq
 524290341     gbest366.seq
 524291289     gbest367.seq
 524289070     gbest368.seq
 524290399     gbest369.seq
 486981445     gbest37.seq
 524290190     gbest370.seq
  25162022     gbest371.seq
 524291036     gbest372.seq
 524289206     gbest373.seq
 524294053     gbest374.seq
 524290096     gbest375.seq
 524289561     gbest376.seq
 524288966     gbest377.seq
 465284913     gbest378.seq
 524291278     gbest379.seq
 481670226     gbest38.seq
 524289049     gbest380.seq
 524288894     gbest381.seq
 524290659     gbest382.seq
 292776318     gbest383.seq
 524290726     gbest384.seq
 524288742     gbest385.seq
 524289944     gbest386.seq
 524288965     gbest387.seq
 524289370     gbest388.seq
 524289117     gbest389.seq
 485730220     gbest39.seq
 524291090     gbest390.seq
 524289372     gbest391.seq
 524291241     gbest392.seq
 524289157     gbest393.seq
 196270814     gbest394.seq
 524291494     gbest395.seq
 524290329     gbest396.seq
 524291224     gbest397.seq
 524290666     gbest398.seq
 524291456     gbest399.seq
 524290535     gbest4.seq
 132373339     gbest40.seq
 524288909     gbest400.seq
 524291787     gbest401.seq
 524291306     gbest402.seq
 524291213     gbest403.seq
 524289769     gbest404.seq
 524290150     gbest405.seq
 524290363     gbest406.seq
 507860977     gbest407.seq
 524291195     gbest408.seq
 524288943     gbest409.seq
 524288883     gbest41.seq
 524291178     gbest410.seq
 524289834     gbest411.seq
 524290831     gbest412.seq
 524289013     gbest413.seq
 524290065     gbest414.seq
 524294044     gbest415.seq
 524289951     gbest416.seq
 524289423     gbest417.seq
 524291701     gbest418.seq
 524288821     gbest419.seq
 524162079     gbest42.seq
 491962727     gbest420.seq
 524289348     gbest421.seq
 524290573     gbest422.seq
 524292002     gbest423.seq
 524289666     gbest424.seq
 524288880     gbest425.seq
 524292289     gbest426.seq
 524292635     gbest427.seq
 524296237     gbest428.seq
 524290335     gbest429.seq
 524290579     gbest43.seq
 524290504     gbest430.seq
 524292297     gbest431.seq
 524288974     gbest432.seq
 524290989     gbest433.seq
 524292608     gbest434.seq
 130003855     gbest435.seq
 524289206     gbest436.seq
 524293260     gbest437.seq
 524289892     gbest438.seq
 524291230     gbest439.seq
 524290537     gbest44.seq
 524290464     gbest440.seq
 524290432     gbest441.seq
 524290716     gbest442.seq
 524290363     gbest443.seq
 524291110     gbest444.seq
 524289122     gbest445.seq
 524290083     gbest446.seq
 524288777     gbest447.seq
 192445021     gbest448.seq
 524290804     gbest449.seq
 524291619     gbest45.seq
 524290641     gbest450.seq
 524291104     gbest451.seq
 524290722     gbest452.seq
 524290640     gbest453.seq
 524291192     gbest454.seq
 524289950     gbest455.seq
 524289237     gbest456.seq
 524290068     gbest457.seq
 524291418     gbest458.seq
 389864214     gbest459.seq
 524288812     gbest46.seq
 524290908     gbest460.seq
 524291075     gbest461.seq
 524290129     gbest462.seq
 524290854     gbest463.seq
 524289023     gbest464.seq
 524288961     gbest465.seq
 524289500     gbest466.seq
 524292364     gbest467.seq
 524289206     gbest468.seq
 524291188     gbest469.seq
 524289110     gbest47.seq
 524289928     gbest470.seq
 455189907     gbest471.seq
 524290472     gbest472.seq
 524291591     gbest473.seq
 524290508     gbest474.seq
 524290961     gbest475.seq
 524290273     gbest476.seq
 500443973     gbest477.seq
 524289371     gbest48.seq
 524289442     gbest49.seq
 524289238     gbest5.seq
 524292165     gbest50.seq
 524292390     gbest51.seq
 524289670     gbest52.seq
 524290400     gbest53.seq
 231995953     gbest54.seq
 524291003     gbest55.seq
 524291742     gbest56.seq
 524289352     gbest57.seq
 524290711     gbest58.seq
 524290510     gbest59.seq
 524290797     gbest6.seq
 524290885     gbest60.seq
 524288917     gbest61.seq
 524290811     gbest62.seq
 524289485     gbest63.seq
 524290531     gbest64.seq
 524289159     gbest65.seq
 524290108     gbest66.seq
 443025461     gbest67.seq
 524291549     gbest68.seq
 524290445     gbest69.seq
 524290214     gbest7.seq
 524289692     gbest70.seq
 524289689     gbest71.seq
 524290418     gbest72.seq
 524291530     gbest73.seq
 524290852     gbest74.seq
 524291679     gbest75.seq
 524292445     gbest76.seq
 524290889     gbest77.seq
 524290327     gbest78.seq
 524292034     gbest79.seq
 524289654     gbest8.seq
 158927029     gbest80.seq
 524289959     gbest81.seq
 524288935     gbest82.seq
 524290497     gbest83.seq
 524290470     gbest84.seq
 524290072     gbest85.seq
 524292198     gbest86.seq
 524292147     gbest87.seq
 524288876     gbest88.seq
 524289358     gbest89.seq
 524289874     gbest9.seq
 524290892     gbest90.seq
 524291328     gbest91.seq
 444889096     gbest92.seq
 524291721     gbest93.seq
 524291925     gbest94.seq
 524289122     gbest95.seq
 524291121     gbest96.seq
 524290340     gbest97.seq
 524290196     gbest98.seq
 524290261     gbest99.seq
 524291399     gbgss1.seq
 524291395     gbgss10.seq
 524291969     gbgss100.seq
 524291063     gbgss101.seq
 524290739     gbgss102.seq
 524290507     gbgss103.seq
 410347278     gbgss104.seq
 524291164     gbgss105.seq
 524288985     gbgss106.seq
 524290378     gbgss107.seq
 524290772     gbgss108.seq
 524289540     gbgss109.seq
 524290026     gbgss11.seq
 524289287     gbgss110.seq
 524291067     gbgss111.seq
 524290852     gbgss112.seq
 524289644     gbgss113.seq
 524291049     gbgss114.seq
 524289368     gbgss115.seq
  48640746     gbgss116.seq
 524291537     gbgss117.seq
 524290169     gbgss118.seq
 524289437     gbgss119.seq
 524289031     gbgss12.seq
 524290847     gbgss120.seq
 524289397     gbgss121.seq
 524289847     gbgss122.seq
 524288734     gbgss123.seq
 524290818     gbgss124.seq
 524290438     gbgss125.seq
 524288981     gbgss126.seq
 524290686     gbgss127.seq
 524291596     gbgss128.seq
 195418050     gbgss129.seq
 524291863     gbgss13.seq
 524289379     gbgss130.seq
 524291778     gbgss131.seq
 524290292     gbgss132.seq
 524291495     gbgss133.seq
 524289499     gbgss134.seq
 524290863     gbgss135.seq
 524288803     gbgss136.seq
 524289824     gbgss137.seq
 524290177     gbgss138.seq
 498460129     gbgss139.seq
 524289571     gbgss14.seq
 498423848     gbgss140.seq
 181265752     gbgss141.seq
 524290476     gbgss142.seq
 524290347     gbgss143.seq
 524289874     gbgss144.seq
 524290507     gbgss145.seq
 524289998     gbgss146.seq
 524291768     gbgss147.seq
 524288890     gbgss148.seq
 524288787     gbgss149.seq
 524291696     gbgss15.seq
 524289307     gbgss150.seq
 524290143     gbgss151.seq
 312983605     gbgss152.seq
 524289414     gbgss153.seq
 524290648     gbgss154.seq
 524290131     gbgss155.seq
 524291857     gbgss156.seq
 524290280     gbgss157.seq
 524289353     gbgss158.seq
 524289129     gbgss159.seq
 524289189     gbgss16.seq
 524289106     gbgss160.seq
 524288994     gbgss161.seq
 524289883     gbgss162.seq
 524288869     gbgss163.seq
 524288991     gbgss164.seq
 139762746     gbgss165.seq
 524289886     gbgss166.seq
 524290557     gbgss167.seq
 292879558     gbgss168.seq
 249997995     gbgss169.seq
 524289070     gbgss17.seq
 249999185     gbgss170.seq
 249999583     gbgss171.seq
 249999361     gbgss172.seq
  31680943     gbgss173.seq
 249997137     gbgss174.seq
 250000033     gbgss175.seq
 249998542     gbgss176.seq
 249998333     gbgss177.seq
 224919493     gbgss178.seq
 249998415     gbgss179.seq
 524288922     gbgss18.seq
 249998695     gbgss180.seq
 249998511     gbgss181.seq
 249998571     gbgss182.seq
 192853837     gbgss183.seq
 249997950     gbgss184.seq
 249998694     gbgss185.seq
 249998786     gbgss186.seq
 249997755     gbgss187.seq
 249998059     gbgss188.seq
  71111662     gbgss189.seq
 297811911     gbgss19.seq
 249999835     gbgss190.seq
   2112081     gbgss191.seq
  80345751     gbgss192.seq
 249999264     gbgss193.seq
 249998538     gbgss194.seq
  87602941     gbgss195.seq
 249999685     gbgss196.seq
 249998355     gbgss197.seq
 249998971     gbgss198.seq
 203257936     gbgss199.seq
 524289827     gbgss2.seq
 524291455     gbgss20.seq
 249999232     gbgss200.seq
 249998813     gbgss201.seq
 249999964     gbgss202.seq
 246326993     gbgss203.seq
 249997836     gbgss204.seq
 249999647     gbgss205.seq
 249998223     gbgss206.seq
 244710946     gbgss207.seq
 249999336     gbgss208.seq
 250000173     gbgss209.seq
 524290129     gbgss21.seq
 249997063     gbgss210.seq
 249999769     gbgss211.seq
 126496662     gbgss212.seq
 249997387     gbgss213.seq
 249997998     gbgss214.seq
 249999931     gbgss215.seq
 249998615     gbgss216.seq
  92409107     gbgss217.seq
 249999742     gbgss218.seq
 249999443     gbgss219.seq
 524289541     gbgss22.seq
 249998584     gbgss220.seq
 249998226     gbgss221.seq
 249999180     gbgss222.seq
 143872958     gbgss223.seq
 249997846     gbgss224.seq
 249999124     gbgss225.seq
 249997821     gbgss226.seq
 249997789     gbgss227.seq
  84917634     gbgss228.seq
 249999461     gbgss229.seq
 524291219     gbgss23.seq
 249999350     gbgss230.seq
 249998406     gbgss231.seq
 249998619     gbgss232.seq
 249999398     gbgss233.seq
 249998013     gbgss234.seq
 100149165     gbgss235.seq
 249999424     gbgss236.seq
 249999963     gbgss237.seq
 249997369     gbgss238.seq
  43648880     gbgss239.seq
 524291084     gbgss24.seq
  52925443     gbgss240.seq
 249999254     gbgss241.seq
 249999370     gbgss242.seq
 249998576     gbgss243.seq
 249999790     gbgss244.seq
 249997993     gbgss245.seq
 249999453     gbgss246.seq
 100320910     gbgss247.seq
 249999617     gbgss248.seq
 250000113     gbgss249.seq
 524289662     gbgss25.seq
 249997380     gbgss250.seq
 249999823     gbgss251.seq
  27507329     gbgss252.seq
 249997661     gbgss253.seq
 249999221     gbgss254.seq
 249996423     gbgss255.seq
 249997687     gbgss256.seq
 249999776     gbgss257.seq
 249999649     gbgss258.seq
 191301715     gbgss259.seq
 524289733     gbgss26.seq
 249998299     gbgss260.seq
 249998824     gbgss261.seq
 249998817     gbgss262.seq
 225684315     gbgss263.seq
 250000034     gbgss264.seq
 249999411     gbgss265.seq
 249998949     gbgss266.seq
 249998290     gbgss267.seq
 249997496     gbgss268.seq
  66032843     gbgss269.seq
 524290599     gbgss27.seq
 249999961     gbgss270.seq
 249999246     gbgss271.seq
 249997183     gbgss272.seq
 249998878     gbgss273.seq
 249998009     gbgss274.seq
 249998219     gbgss275.seq
 249997997     gbgss276.seq
 249998306     gbgss277.seq
  42561735     gbgss278.seq
 249999562     gbgss279.seq
 524291006     gbgss28.seq
 249998752     gbgss280.seq
 249999600     gbgss281.seq
 249999029     gbgss282.seq
 221982324     gbgss283.seq
 249999329     gbgss284.seq
 249998347     gbgss285.seq
 249998273     gbgss286.seq
 249999290     gbgss287.seq
  81332021     gbgss288.seq
 249999799     gbgss289.seq
 524290384     gbgss29.seq
 249998973     gbgss290.seq
 249999048     gbgss291.seq
 249999163     gbgss292.seq
 145963663     gbgss293.seq
 524290175     gbgss3.seq
 524290866     gbgss30.seq
  26686996     gbgss31.seq
 524291144     gbgss32.seq
 524289799     gbgss33.seq
 524290542     gbgss34.seq
 524289125     gbgss35.seq
 524290210     gbgss36.seq
 524290379     gbgss37.seq
 524290660     gbgss38.seq
 490815577     gbgss39.seq
 524289990     gbgss4.seq
 524291924     gbgss40.seq
 524290450     gbgss41.seq
 524289879     gbgss42.seq
  20490553     gbgss43.seq
 524289080     gbgss44.seq
 524290174     gbgss45.seq
 524289260     gbgss46.seq
 524291271     gbgss47.seq
 216599531     gbgss48.seq
 524290958     gbgss49.seq
 159721526     gbgss5.seq
 524290909     gbgss50.seq
 524289412     gbgss51.seq
 524291617     gbgss52.seq
 524288972     gbgss53.seq
 524290189     gbgss54.seq
 524291133     gbgss55.seq
 524290615     gbgss56.seq
 524291157     gbgss57.seq
 524290862     gbgss58.seq
 524289367     gbgss59.seq
 524291244     gbgss6.seq
  16331431     gbgss60.seq
 524290864     gbgss61.seq
 524290087     gbgss62.seq
 524291264     gbgss63.seq
 454607847     gbgss64.seq
 524290725     gbgss65.seq
 524288859     gbgss66.seq
 524289978     gbgss67.seq
 524290979     gbgss68.seq
 524291254     gbgss69.seq
 524289677     gbgss7.seq
 524290548     gbgss70.seq
 524292807     gbgss71.seq
 524289505     gbgss72.seq
 524288813     gbgss73.seq
 524290184     gbgss74.seq
 524290161     gbgss75.seq
 524289124     gbgss76.seq
  33504267     gbgss77.seq
 524290959     gbgss78.seq
 524289172     gbgss79.seq
 524289368     gbgss8.seq
 524290131     gbgss80.seq
 524288729     gbgss81.seq
 524291277     gbgss82.seq
 524290093     gbgss83.seq
 524291707     gbgss84.seq
 524289357     gbgss85.seq
 524290152     gbgss86.seq
 524291439     gbgss87.seq
 524291938     gbgss88.seq
 379881935     gbgss89.seq
 524291677     gbgss9.seq
 524291919     gbgss90.seq
 524289553     gbgss91.seq
 524292535     gbgss92.seq
 524291749     gbgss93.seq
 524291967     gbgss94.seq
 524289937     gbgss95.seq
 524291779     gbgss96.seq
 524292054     gbgss97.seq
 524288810     gbgss98.seq
 524290782     gbgss99.seq
 249989630     gbhtc1.seq
 249996649     gbhtc10.seq
 249998092     gbhtc11.seq
 108167350     gbhtc12.seq
 250000093     gbhtc13.seq
 249999641     gbhtc14.seq
 112838197     gbhtc15.seq
 249995334     gbhtc2.seq
 249993924     gbhtc3.seq
 249998402     gbhtc4.seq
 249989368     gbhtc5.seq
 249989186     gbhtc6.seq
 249999972     gbhtc7.seq
  85899390     gbhtc8.seq
 249999160     gbhtc9.seq
 249937929     gbhtg1.seq
 249953472     gbhtg10.seq
 249912145     gbhtg100.seq
 249866447     gbhtg101.seq
 249548804     gbhtg102.seq
 249887714     gbhtg103.seq
   3687904     gbhtg104.seq
 249803789     gbhtg105.seq
 249881846     gbhtg106.seq
 249836160     gbhtg107.seq
 249894567     gbhtg108.seq
 249973176     gbhtg109.seq
    799345     gbhtg11.seq
 249774141     gbhtg110.seq
 167855724     gbhtg111.seq
 249987293     gbhtg112.seq
 249873304     gbhtg113.seq
 249946277     gbhtg114.seq
 249972635     gbhtg115.seq
 249835838     gbhtg116.seq
 249606864     gbhtg117.seq
 249928653     gbhtg118.seq
 220893412     gbhtg119.seq
 249888187     gbhtg12.seq
 249814763     gbhtg120.seq
 249966106     gbhtg121.seq
 249907908     gbhtg122.seq
 249777594     gbhtg123.seq
 249918940     gbhtg124.seq
 120973814     gbhtg125.seq
 249860737     gbhtg126.seq
 249838185     gbhtg127.seq
 249821150     gbhtg128.seq
 249911176     gbhtg129.seq
 249968061     gbhtg13.seq
 249980071     gbhtg130.seq
 134314079     gbhtg131.seq
 249758419     gbhtg132.seq
 249798662     gbhtg133.seq
 249841930     gbhtg134.seq
 249821691     gbhtg135.seq
 249866626     gbhtg136.seq
 249833227     gbhtg137.seq
 249880039     gbhtg138.seq
 249902838     gbhtg139.seq
 249584228     gbhtg14.seq
 249949661     gbhtg140.seq
 225657006     gbhtg141.seq
 249771919     gbhtg15.seq
 249739055     gbhtg16.seq
 249165958     gbhtg17.seq
 249979906     gbhtg18.seq
 249677324     gbhtg19.seq
 249996486     gbhtg2.seq
 249986017     gbhtg20.seq
 237141712     gbhtg21.seq
 249756771     gbhtg22.seq
 249864520     gbhtg23.seq
 249983387     gbhtg24.seq
 249917977     gbhtg25.seq
 249757014     gbhtg26.seq
 249887703     gbhtg27.seq
 249957955     gbhtg28.seq
 249838322     gbhtg29.seq
 249996436     gbhtg3.seq
 249989462     gbhtg30.seq
 225321798     gbhtg31.seq
 249823597     gbhtg32.seq
 249917429     gbhtg33.seq
 249925849     gbhtg34.seq
 249914652     gbhtg35.seq
 249854015     gbhtg36.seq
 249811753     gbhtg37.seq
 249764938     gbhtg38.seq
 249624028     gbhtg39.seq
 249972999     gbhtg4.seq
 249836216     gbhtg40.seq
 224361271     gbhtg41.seq
 249887293     gbhtg42.seq
 249786703     gbhtg43.seq
 249974418     gbhtg44.seq
 249775813     gbhtg45.seq
 249970767     gbhtg46.seq
 249705527     gbhtg47.seq
 249863117     gbhtg48.seq
 249890017     gbhtg49.seq
 249908886     gbhtg5.seq
 249899841     gbhtg50.seq
 234810115     gbhtg51.seq
 249734771     gbhtg52.seq
 249974885     gbhtg53.seq
 249784977     gbhtg54.seq
 249720573     gbhtg55.seq
 249959671     gbhtg56.seq
  18795807     gbhtg57.seq
 249859950     gbhtg58.seq
 249826451     gbhtg59.seq
 249993239     gbhtg6.seq
 249998076     gbhtg60.seq
 249924538     gbhtg61.seq
 225131070     gbhtg62.seq
 249886218     gbhtg63.seq
 249907389     gbhtg64.seq
 249800911     gbhtg65.seq
 249764876     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249978568     gbhtg69.seq
 249808932     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249764380     gbhtg72.seq
 223417348     gbhtg73.seq
 249931059     gbhtg74.seq
 249860419     gbhtg75.seq
 249999269     gbhtg76.seq
 249942534     gbhtg77.seq
 234936205     gbhtg78.seq
 249847338     gbhtg79.seq
 249827069     gbhtg8.seq
 249936222     gbhtg80.seq
 249825721     gbhtg81.seq
 249853418     gbhtg82.seq
 202266986     gbhtg83.seq
 249837010     gbhtg84.seq
 249926412     gbhtg85.seq
 249824391     gbhtg86.seq
 249844580     gbhtg87.seq
 205982516     gbhtg88.seq
 249844885     gbhtg89.seq
 249952731     gbhtg9.seq
 249834702     gbhtg90.seq
 249734686     gbhtg91.seq
 249850739     gbhtg92.seq
 194386424     gbhtg93.seq
 249945082     gbhtg94.seq
 249957779     gbhtg95.seq
 249864947     gbhtg96.seq
 249788458     gbhtg97.seq
 161658952     gbhtg98.seq
 249871130     gbhtg99.seq
 249998229     gbinv1.seq
 249683669     gbinv10.seq
 249995664     gbinv100.seq
 249998338     gbinv101.seq
 249793471     gbinv102.seq
 249981535     gbinv103.seq
 249997903     gbinv104.seq
 243824572     gbinv105.seq
  52925611     gbinv106.seq
 250000144     gbinv107.seq
 249939123     gbinv108.seq
 249999855     gbinv109.seq
 249998032     gbinv11.seq
 249955699     gbinv110.seq
 249956561     gbinv111.seq
 249809300     gbinv112.seq
 249758801     gbinv113.seq
 249949307     gbinv114.seq
 249986585     gbinv115.seq
 249774002     gbinv116.seq
 249993331     gbinv117.seq
  21972150     gbinv118.seq
 250000131     gbinv119.seq
 249998569     gbinv12.seq
 249997724     gbinv120.seq
  59918656     gbinv121.seq
 249998579     gbinv122.seq
 249997816     gbinv123.seq
 249992060     gbinv124.seq
 249992217     gbinv125.seq
 146680966     gbinv126.seq
 249995603     gbinv127.seq
 249999045     gbinv128.seq
 249999297     gbinv129.seq
  33831633     gbinv13.seq
 249999642     gbinv130.seq
 249998443     gbinv131.seq
 249999508     gbinv132.seq
 248888424     gbinv133.seq
 249997634     gbinv14.seq
 249998686     gbinv15.seq
 249998802     gbinv16.seq
 164283111     gbinv17.seq
 249998641     gbinv18.seq
 249874871     gbinv19.seq
 249920789     gbinv2.seq
 249998664     gbinv20.seq
 249998550     gbinv21.seq
 249997757     gbinv22.seq
   1828279     gbinv23.seq
 229999723     gbinv24.seq
 175506967     gbinv25.seq
 249978646     gbinv26.seq
 249998044     gbinv27.seq
 214820973     gbinv28.seq
 249997650     gbinv29.seq
 249872232     gbinv3.seq
 249998908     gbinv30.seq
 249999421     gbinv31.seq
 249998613     gbinv32.seq
 164228237     gbinv33.seq
 249999186     gbinv34.seq
 249998986     gbinv35.seq
 249998774     gbinv36.seq
 249998680     gbinv37.seq
 157104547     gbinv38.seq
 249998058     gbinv39.seq
 206371805     gbinv4.seq
 249998022     gbinv40.seq
 249999492     gbinv41.seq
 249998078     gbinv42.seq
 249997702     gbinv43.seq
 249999907     gbinv44.seq
 249998569     gbinv45.seq
 249998664     gbinv46.seq
 249999320     gbinv47.seq
  30323563     gbinv48.seq
 249949092     gbinv49.seq
 249999426     gbinv5.seq
 249993012     gbinv50.seq
 247563319     gbinv51.seq
 249910237     gbinv52.seq
 249932741     gbinv53.seq
 249796765     gbinv54.seq
 249978785     gbinv55.seq
 220286538     gbinv56.seq
 249997947     gbinv57.seq
 249993437     gbinv58.seq
 249995495     gbinv59.seq
 249998860     gbinv6.seq
 249997709     gbinv60.seq
  51747128     gbinv61.seq
 249996142     gbinv62.seq
 249961763     gbinv63.seq
 249996526     gbinv64.seq
 249990785     gbinv65.seq
 249983105     gbinv66.seq
 249977710     gbinv67.seq
 249994985     gbinv68.seq
 249998590     gbinv69.seq
 249999457     gbinv7.seq
 249999068     gbinv70.seq
 224842193     gbinv71.seq
 249989083     gbinv72.seq
 249979519     gbinv73.seq
 249994236     gbinv74.seq
 249996734     gbinv75.seq
 250000084     gbinv76.seq
 249999397     gbinv77.seq
 249994988     gbinv78.seq
 249998647     gbinv79.seq
 224918081     gbinv8.seq
  30318265     gbinv80.seq
 249955084     gbinv81.seq
 249996848     gbinv82.seq
 249991951     gbinv83.seq
 249976129     gbinv84.seq
 249999979     gbinv85.seq
 249983497     gbinv86.seq
 249996597     gbinv87.seq
  89129685     gbinv88.seq
 249973374     gbinv89.seq
 249996840     gbinv9.seq
 249899692     gbinv90.seq
 249979395     gbinv91.seq
 249998794     gbinv92.seq
 249994231     gbinv93.seq
 249966581     gbinv94.seq
 249983746     gbinv95.seq
 249995960     gbinv96.seq
 249994416     gbinv97.seq
 151414968     gbinv98.seq
 249999544     gbinv99.seq
 249939961     gbmam1.seq
 249999229     gbmam2.seq
 249996220     gbmam3.seq
 249995725     gbmam4.seq
 249998259     gbmam5.seq
 249998135     gbmam6.seq
 250000084     gbmam7.seq
 249998575     gbmam8.seq
 129150732     gbmam9.seq
  41706351     gbnew.txt
 249999760     gbpat1.seq
 249996903     gbpat10.seq
 249998996     gbpat100.seq
 249999065     gbpat101.seq
 249999793     gbpat102.seq
 149112469     gbpat103.seq
 249999880     gbpat104.seq
 249999565     gbpat105.seq
 249929731     gbpat106.seq
 249824879     gbpat107.seq
 249998856     gbpat108.seq
 192960741     gbpat109.seq
 180091463     gbpat11.seq
 249999703     gbpat110.seq
 249999649     gbpat111.seq
 249998513     gbpat112.seq
  80214492     gbpat113.seq
 249999807     gbpat114.seq
 249999074     gbpat115.seq
 249614006     gbpat116.seq
 249999544     gbpat117.seq
 250000164     gbpat118.seq
  67190995     gbpat119.seq
 249996178     gbpat12.seq
 249999441     gbpat120.seq
 249999845     gbpat121.seq
 249999888     gbpat122.seq
 249999095     gbpat123.seq
 160256390     gbpat124.seq
 249999974     gbpat125.seq
 249999633     gbpat126.seq
 234784218     gbpat127.seq
 249991591     gbpat128.seq
 249970935     gbpat129.seq
 249999684     gbpat13.seq
 249999681     gbpat130.seq
 249997397     gbpat131.seq
 249997452     gbpat132.seq
  66832984     gbpat133.seq
 249992315     gbpat134.seq
 249999867     gbpat135.seq
 250000197     gbpat136.seq
 249999821     gbpat137.seq
 249998337     gbpat138.seq
  18437114     gbpat139.seq
 249999756     gbpat14.seq
 249999655     gbpat140.seq
 249998828     gbpat141.seq
 249999803     gbpat142.seq
 249999630     gbpat143.seq
  46945969     gbpat144.seq
 249999271     gbpat145.seq
 249999873     gbpat146.seq
 249999008     gbpat147.seq
 234349056     gbpat148.seq
 249999644     gbpat149.seq
 249999948     gbpat15.seq
 249999868     gbpat150.seq
 249999842     gbpat151.seq
  86184716     gbpat152.seq
 249999922     gbpat153.seq
 249998635     gbpat154.seq
 249999454     gbpat155.seq
  63661578     gbpat156.seq
 249993417     gbpat157.seq
 249999152     gbpat158.seq
 250000020     gbpat159.seq
 249999507     gbpat16.seq
 249999417     gbpat160.seq
 249999929     gbpat161.seq
 249994447     gbpat162.seq
 223351837     gbpat163.seq
 250000249     gbpat164.seq
 249999893     gbpat165.seq
 249999893     gbpat166.seq
 220539897     gbpat167.seq
 249999753     gbpat168.seq
 249999776     gbpat169.seq
  75552882     gbpat17.seq
 250000099     gbpat170.seq
  12464113     gbpat171.seq
 249993131     gbpat172.seq
 249997014     gbpat173.seq
 250000229     gbpat174.seq
 249999480     gbpat175.seq
  90662928     gbpat176.seq
 249999464     gbpat177.seq
 249999105     gbpat178.seq
 249998730     gbpat179.seq
 250000027     gbpat18.seq
 250000210     gbpat180.seq
 249999148     gbpat181.seq
 125618918     gbpat182.seq
 249999875     gbpat183.seq
 249997946     gbpat184.seq
 249999661     gbpat185.seq
 249999693     gbpat186.seq
 214724513     gbpat187.seq
 249993244     gbpat188.seq
 249199443     gbpat189.seq
 249999801     gbpat19.seq
 249999951     gbpat190.seq
 249999153     gbpat191.seq
 181174596     gbpat192.seq
 249548891     gbpat193.seq
 248493969     gbpat194.seq
 249999669     gbpat195.seq
 249999334     gbpat196.seq
 249984954     gbpat197.seq
 249998863     gbpat198.seq
 217537571     gbpat199.seq
 250000105     gbpat2.seq
 249999814     gbpat20.seq
 249999795     gbpat200.seq
 249999835     gbpat201.seq
 249999757     gbpat202.seq
 249998413     gbpat203.seq
  66629235     gbpat204.seq
 249997958     gbpat205.seq
 250000109     gbpat206.seq
 249995873     gbpat207.seq
 249997495     gbpat208.seq
 249995535     gbpat209.seq
 249998616     gbpat21.seq
 243873598     gbpat210.seq
 249999647     gbpat211.seq
 249998657     gbpat212.seq
 249999433     gbpat213.seq
 249997962     gbpat214.seq
 249999141     gbpat215.seq
 249998314     gbpat216.seq
 243047018     gbpat217.seq
 186240832     gbpat22.seq
 249999888     gbpat23.seq
 249837500     gbpat24.seq
 250000061     gbpat25.seq
 250000238     gbpat26.seq
  71657961     gbpat27.seq
 249998746     gbpat28.seq
 249999562     gbpat29.seq
 249999195     gbpat3.seq
 249999197     gbpat30.seq
 250000007     gbpat31.seq
 249999936     gbpat32.seq
 179957138     gbpat33.seq
 250000086     gbpat34.seq
 249999102     gbpat35.seq
 249998923     gbpat36.seq
 249998508     gbpat37.seq
 249998876     gbpat38.seq
 249999529     gbpat39.seq
 249999678     gbpat4.seq
 148181919     gbpat40.seq
 249997518     gbpat41.seq
 249963850     gbpat42.seq
 249999670     gbpat43.seq
 249999834     gbpat44.seq
 249999419     gbpat45.seq
 249911220     gbpat46.seq
 249999213     gbpat47.seq
 249996155     gbpat48.seq
 171736050     gbpat49.seq
  71746170     gbpat5.seq
 250000212     gbpat50.seq
 249999139     gbpat51.seq
 249996276     gbpat52.seq
 249999732     gbpat53.seq
 222942647     gbpat54.seq
 249999057     gbpat55.seq
 249999815     gbpat56.seq
 250000246     gbpat57.seq
 165007280     gbpat58.seq
 249909513     gbpat59.seq
 249999527     gbpat6.seq
 249996704     gbpat60.seq
 249999232     gbpat61.seq
 249999109     gbpat62.seq
 135442239     gbpat63.seq
 249999062     gbpat64.seq
 249998801     gbpat65.seq
 249997619     gbpat66.seq
 249998578     gbpat67.seq
 249999274     gbpat68.seq
 249999579     gbpat69.seq
 249999984     gbpat7.seq
 144894652     gbpat70.seq
 249999757     gbpat71.seq
 249999899     gbpat72.seq
 249998837     gbpat73.seq
 244404704     gbpat74.seq
 248969297     gbpat75.seq
 244459306     gbpat76.seq
 247876384     gbpat77.seq
 249998774     gbpat78.seq
 160626113     gbpat79.seq
 249996569     gbpat8.seq
 250000121     gbpat80.seq
 249999657     gbpat81.seq
 249999470     gbpat82.seq
 249999644     gbpat83.seq
 250000124     gbpat84.seq
 249999802     gbpat85.seq
  99328188     gbpat86.seq
 249159433     gbpat87.seq
 249999031     gbpat88.seq
 250000124     gbpat89.seq
 249999636     gbpat9.seq
 249999382     gbpat90.seq
 249999138     gbpat91.seq
 249999561     gbpat92.seq
 145306535     gbpat93.seq
 249999243     gbpat94.seq
 249998968     gbpat95.seq
 249999939     gbpat96.seq
 250000257     gbpat97.seq
 196969104     gbpat98.seq
 249999051     gbpat99.seq
 249925161     gbphg1.seq
 151990449     gbphg2.seq
 249998671     gbpln1.seq
 130444072     gbpln10.seq
 249997079     gbpln11.seq
 249995146     gbpln12.seq
 249997130     gbpln13.seq
 249935515     gbpln14.seq
 215759714     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
 249735106     gbpln19.seq
 249995213     gbpln2.seq
 249774094     gbpln20.seq
 249151418     gbpln21.seq
 249675698     gbpln22.seq
  94704210     gbpln23.seq
 250000100     gbpln24.seq
 100186291     gbpln25.seq
 249997227     gbpln26.seq
 249994996     gbpln27.seq
 249839663     gbpln28.seq
 221032726     gbpln29.seq
 249929082     gbpln3.seq
 180429645     gbpln30.seq
 246949840     gbpln31.seq
 245739937     gbpln32.seq
 227058566     gbpln33.seq
 249997854     gbpln34.seq
 249999125     gbpln35.seq
 249999711     gbpln36.seq
 113126511     gbpln37.seq
 249999170     gbpln38.seq
 249997991     gbpln39.seq
 249975975     gbpln4.seq
 250000019     gbpln40.seq
 249999134     gbpln41.seq
 146740969     gbpln42.seq
 249998955     gbpln43.seq
 249998860     gbpln44.seq
 249999465     gbpln45.seq
 248648215     gbpln46.seq
 245152241     gbpln47.seq
 249957383     gbpln48.seq
 249998421     gbpln49.seq
 249995853     gbpln5.seq
  39652616     gbpln50.seq
 249999645     gbpln51.seq
  54220034     gbpln52.seq
 212430978     gbpln53.seq
 248597121     gbpln54.seq
 165396879     gbpln55.seq
 996342174     gbpln56.seq
  49719597     gbpln57.seq
 204101915     gbpln58.seq
 171793602     gbpln59.seq
 249759939     gbpln6.seq
 197245497     gbpln60.seq
 177950572     gbpln61.seq
 196456207     gbpln62.seq
 189036994     gbpln63.seq
 220764539     gbpln64.seq
 227204412     gbpln65.seq
 224027089     gbpln66.seq
 248372138     gbpln67.seq
 188440426     gbpln68.seq
 249999008     gbpln69.seq
 249922991     gbpln7.seq
 249999322     gbpln70.seq
  59489739     gbpln71.seq
 249998418     gbpln72.seq
 249998866     gbpln73.seq
 249999185     gbpln74.seq
 249997317     gbpln75.seq
 249997776     gbpln76.seq
  17104818     gbpln77.seq
 249997298     gbpln78.seq
 249999426     gbpln79.seq
 248304515     gbpln8.seq
 249999728     gbpln80.seq
 249878616     gbpln81.seq
  71759868     gbpln82.seq
 249998194     gbpln83.seq
 249921009     gbpln84.seq
 249999640     gbpln85.seq
 163801233     gbpln86.seq
 249999260     gbpln87.seq
 249997073     gbpln88.seq
 249962412     gbpln89.seq
 249982845     gbpln9.seq
 247763508     gbpln90.seq
 243099148     gbpln91.seq
 248441929     gbpln92.seq
 218197234     gbpln93.seq
 228797144     gbpln94.seq
 249999030     gbpln95.seq
 126586354     gbpln96.seq
 149172248     gbpri1.seq
 249845156     gbpri10.seq
 139393827     gbpri11.seq
 249962746     gbpri12.seq
 249896478     gbpri13.seq
 249896766     gbpri14.seq
 249947118     gbpri15.seq
 249865833     gbpri16.seq
 249867629     gbpri17.seq
 249758014     gbpri18.seq
 249922775     gbpri19.seq
 249845908     gbpri2.seq
 249959135     gbpri20.seq
 249969488     gbpri21.seq
 249989622     gbpri22.seq
 115763062     gbpri23.seq
 177375493     gbpri24.seq
 249997291     gbpri25.seq
 211437612     gbpri26.seq
 249959023     gbpri27.seq
 249925912     gbpri28.seq
 249994457     gbpri29.seq
 249942098     gbpri3.seq
 249836177     gbpri30.seq
 249807606     gbpri31.seq
 249986381     gbpri32.seq
 249985967     gbpri33.seq
 249981263     gbpri34.seq
  28122328     gbpri35.seq
 249995918     gbpri36.seq
 249993543     gbpri37.seq
 249589332     gbpri38.seq
 249997650     gbpri39.seq
 249793576     gbpri4.seq
 249993833     gbpri40.seq
 195715946     gbpri41.seq
 249998766     gbpri42.seq
 249981862     gbpri43.seq
 249999659     gbpri44.seq
 249976249     gbpri45.seq
 249965922     gbpri46.seq
 249998480     gbpri47.seq
 202939251     gbpri48.seq
 249943913     gbpri5.seq
 249813246     gbpri6.seq
 249907574     gbpri7.seq
 249923680     gbpri8.seq
 249791320     gbpri9.seq
    382337     gbrel.txt
 249673208     gbrod1.seq
 249757541     gbrod10.seq
  72893030     gbrod11.seq
 249871284     gbrod12.seq
 249783783     gbrod13.seq
 249992872     gbrod14.seq
 249651633     gbrod15.seq
 249953778     gbrod16.seq
 249885197     gbrod17.seq
 249943446     gbrod18.seq
 249996390     gbrod19.seq
 249823351     gbrod2.seq
   6188951     gbrod20.seq
 249952483     gbrod21.seq
 249769192     gbrod22.seq
 191022460     gbrod23.seq
 249998757     gbrod24.seq
 249996340     gbrod25.seq
 249828867     gbrod26.seq
 249849904     gbrod27.seq
 249999203     gbrod28.seq
 249996340     gbrod29.seq
 249797615     gbrod3.seq
 250000257     gbrod30.seq
 117011846     gbrod31.seq
 249821308     gbrod4.seq
 249939685     gbrod5.seq
 249982451     gbrod6.seq
 249996758     gbrod7.seq
 249985991     gbrod8.seq
 249811350     gbrod9.seq
 250000209     gbsts1.seq
 249997655     gbsts10.seq
 210923828     gbsts11.seq
 249996524     gbsts12.seq
 249999446     gbsts13.seq
 249998695     gbsts14.seq
 249998900     gbsts15.seq
  24518272     gbsts16.seq
 250000234     gbsts17.seq
 249997176     gbsts18.seq
 249998932     gbsts19.seq
 249999484     gbsts2.seq
 186768560     gbsts20.seq
 249998340     gbsts3.seq
 249995813     gbsts4.seq
  39683863     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998177     gbsts9.seq
 249847605     gbsyn1.seq
 249995372     gbsyn2.seq
 249948765     gbsyn3.seq
 249970075     gbsyn4.seq
 249985234     gbsyn5.seq
 249996201     gbsyn6.seq
 249998927     gbsyn7.seq
  76059427     gbsyn8.seq
 249998403     gbtsa1.seq
  56875503     gbtsa10.seq
 249997039     gbtsa100.seq
 249999885     gbtsa101.seq
 249999226     gbtsa102.seq
 106366043     gbtsa103.seq
 249999743     gbtsa104.seq
 249999340     gbtsa105.seq
 249999346     gbtsa106.seq
 249997672     gbtsa107.seq
 249999551     gbtsa108.seq
 249998954     gbtsa109.seq
 249999071     gbtsa11.seq
 227293918     gbtsa110.seq
 249998448     gbtsa111.seq
 249998116     gbtsa112.seq
 249999828     gbtsa113.seq
 249998570     gbtsa114.seq
 249997860     gbtsa115.seq
  16572847     gbtsa116.seq
 249998403     gbtsa117.seq
 249999879     gbtsa118.seq
 249998407     gbtsa119.seq
 249997105     gbtsa12.seq
 220794559     gbtsa120.seq
 249998051     gbtsa121.seq
 249999703     gbtsa122.seq
 249996345     gbtsa123.seq
 250000098     gbtsa124.seq
 249997963     gbtsa125.seq
 249999333     gbtsa126.seq
 173664525     gbtsa127.seq
 249999326     gbtsa128.seq
 249997095     gbtsa129.seq
 249999445     gbtsa13.seq
 249998452     gbtsa130.seq
 249997998     gbtsa131.seq
 249997891     gbtsa132.seq
 249997873     gbtsa133.seq
   5590876     gbtsa134.seq
 249999600     gbtsa135.seq
 249996475     gbtsa136.seq
 249999082     gbtsa137.seq
 249996441     gbtsa138.seq
 133577391     gbtsa139.seq
 250000126     gbtsa14.seq
 249998131     gbtsa140.seq
 249999514     gbtsa141.seq
 249997541     gbtsa142.seq
 249997718     gbtsa143.seq
  35878567     gbtsa144.seq
 249998956     gbtsa145.seq
 249999594     gbtsa146.seq
 249997728     gbtsa147.seq
 249999490     gbtsa148.seq
 249998415     gbtsa149.seq
 209212004     gbtsa15.seq
 249999441     gbtsa150.seq
 249999497     gbtsa151.seq
 249998320     gbtsa152.seq
  53889829     gbtsa153.seq
 249998344     gbtsa154.seq
 249998929     gbtsa155.seq
 249999098     gbtsa156.seq
 249998969     gbtsa157.seq
 249998410     gbtsa158.seq
 249999385     gbtsa159.seq
 249997341     gbtsa16.seq
  84677788     gbtsa160.seq
 249999569     gbtsa161.seq
 249998179     gbtsa162.seq
 249995797     gbtsa163.seq
 138119415     gbtsa164.seq
 249998761     gbtsa165.seq
 249999950     gbtsa166.seq
 249998026     gbtsa167.seq
 249995835     gbtsa168.seq
 249991603     gbtsa169.seq
 250000210     gbtsa17.seq
 249992574     gbtsa170.seq
 249997225     gbtsa171.seq
  63230020     gbtsa172.seq
 249999364     gbtsa18.seq
 249995880     gbtsa19.seq
 249998557     gbtsa2.seq
 249998752     gbtsa20.seq
 249993612     gbtsa21.seq
 249998596     gbtsa22.seq
 249998639     gbtsa23.seq
 120742389     gbtsa24.seq
 249998989     gbtsa25.seq
 249996697     gbtsa26.seq
 250000178     gbtsa27.seq
 249998474     gbtsa28.seq
 249995742     gbtsa29.seq
 249999903     gbtsa3.seq
  14687257     gbtsa30.seq
 249999463     gbtsa31.seq
 249999328     gbtsa32.seq
 249999843     gbtsa33.seq
 249999306     gbtsa34.seq
 249999161     gbtsa35.seq
 249996845     gbtsa36.seq
  77066999     gbtsa37.seq
 249998838     gbtsa38.seq
 249998049     gbtsa39.seq
 249999323     gbtsa4.seq
 249998584     gbtsa40.seq
 249998509     gbtsa41.seq
 249998813     gbtsa42.seq
 249998265     gbtsa43.seq
 249999019     gbtsa44.seq
  35343531     gbtsa45.seq
 249999415     gbtsa46.seq
 249998692     gbtsa47.seq
 249999756     gbtsa48.seq
 249999818     gbtsa49.seq
 151717879     gbtsa5.seq
  77518171     gbtsa50.seq
 249999788     gbtsa51.seq
 249999066     gbtsa52.seq
 249996389     gbtsa53.seq
 249998945     gbtsa54.seq
 141892200     gbtsa55.seq
 250000009     gbtsa56.seq
 249999189     gbtsa57.seq
 249999159     gbtsa58.seq
 249996244     gbtsa59.seq
 249997875     gbtsa6.seq
 249998322     gbtsa60.seq
 249999017     gbtsa61.seq
 249997739     gbtsa62.seq
 246411734     gbtsa63.seq
 249999221     gbtsa64.seq
 249998419     gbtsa65.seq
 249998283     gbtsa66.seq
 249998268     gbtsa67.seq
 250000204     gbtsa68.seq
 249999005     gbtsa69.seq
 249998005     gbtsa7.seq
 232171452     gbtsa70.seq
 249999409     gbtsa71.seq
 249999138     gbtsa72.seq
 249998170     gbtsa73.seq
 249998697     gbtsa74.seq
 249995875     gbtsa75.seq
 249998691     gbtsa76.seq
 185136198     gbtsa77.seq
 249999580     gbtsa78.seq
 249997881     gbtsa79.seq
 249999806     gbtsa8.seq
 249999346     gbtsa80.seq
 249997691     gbtsa81.seq
 249991851     gbtsa82.seq
 108251130     gbtsa83.seq
 249998427     gbtsa84.seq
 249999836     gbtsa85.seq
 250000051     gbtsa86.seq
 249999626     gbtsa87.seq
 249998399     gbtsa88.seq
  45211978     gbtsa89.seq
 249999617     gbtsa9.seq
 249999089     gbtsa90.seq
 249999676     gbtsa91.seq
 249999794     gbtsa92.seq
 249999476     gbtsa93.seq
 250000214     gbtsa94.seq
 150661019     gbtsa95.seq
 249994299     gbtsa96.seq
 249999674     gbtsa97.seq
 249997982     gbtsa98.seq
 249999245     gbtsa99.seq
    742384     gbuna1.seq
 249998399     gbvrl1.seq
 249999725     gbvrl10.seq
 249983251     gbvrl11.seq
 249999515     gbvrl12.seq
 249996418     gbvrl13.seq
 108530614     gbvrl14.seq
 249995261     gbvrl15.seq
 249993416     gbvrl16.seq
 249997056     gbvrl17.seq
 250000260     gbvrl18.seq
 219849338     gbvrl19.seq
 249997806     gbvrl2.seq
 249996432     gbvrl20.seq
 249998660     gbvrl21.seq
 249951049     gbvrl22.seq
 249998480     gbvrl23.seq
 139616987     gbvrl24.seq
 249997334     gbvrl25.seq
 249996127     gbvrl26.seq
 249998520     gbvrl27.seq
 249999066     gbvrl28.seq
 249997443     gbvrl29.seq
 249999847     gbvrl3.seq
 249952806     gbvrl30.seq
 249924783     gbvrl31.seq
 249996316     gbvrl32.seq
 205442422     gbvrl33.seq
 249992702     gbvrl4.seq
 249999544     gbvrl5.seq
  64998991     gbvrl6.seq
 249999143     gbvrl7.seq
 249998714     gbvrl8.seq
 249995774     gbvrl9.seq
 249840944     gbvrt1.seq
 249799215     gbvrt10.seq
 249794109     gbvrt11.seq
 139876329     gbvrt12.seq
 249810239     gbvrt13.seq
 249922035     gbvrt14.seq
 249938361     gbvrt15.seq
 249999906     gbvrt16.seq
 249998245     gbvrt17.seq
 250000082     gbvrt18.seq
  63053774     gbvrt19.seq
 249961185     gbvrt2.seq
 249939876     gbvrt20.seq
 249998927     gbvrt21.seq
 250000106     gbvrt22.seq
 249999570     gbvrt23.seq
 249998559     gbvrt24.seq
  99274252     gbvrt25.seq
 249996626     gbvrt26.seq
 249998137     gbvrt27.seq
 249998924     gbvrt28.seq
 194403427     gbvrt29.seq
 249999863     gbvrt3.seq
 249998199     gbvrt30.seq
 249997985     gbvrt31.seq
  11203494     gbvrt32.seq
 250000103     gbvrt33.seq
 127136313     gbvrt34.seq
 249997557     gbvrt35.seq
 243859935     gbvrt36.seq
 241177285     gbvrt37.seq
 246581287     gbvrt38.seq
 232615814     gbvrt39.seq
 249871360     gbvrt4.seq
 249952145     gbvrt40.seq
 249702379     gbvrt41.seq
 249950691     gbvrt42.seq
 249906306     gbvrt43.seq
 249997996     gbvrt44.seq
  41894169     gbvrt45.seq
 184417644     gbvrt5.seq
 249996750     gbvrt6.seq
 249993727     gbvrt7.seq
 249844290     gbvrt8.seq
 249986830     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63676      86237035
BCT10        6838       96100195
BCT100       22         102814540
BCT101       22         103958922
BCT102       23         107772772
BCT103       23         107938575
BCT104       21         101718555
BCT105       22         104582791
BCT106       32         111535016
BCT107       43         104655809
BCT108       12         41456904
BCT109       48         112307628
BCT11        66         116730258
BCT110       64         112336311
BCT111       67         113180722
BCT112       52         112208164
BCT113       42         117429270
BCT114       60         110504352
BCT115       42         113055875
BCT116       7          16754406
BCT117       43         115007355
BCT118       33         110632264
BCT119       39         109398726
BCT12        74         112572581
BCT120       47         115369246
BCT121       27         112902174
BCT122       59         112015078
BCT123       42         110413278
BCT124       31         106697233
BCT125       59         110854804
BCT126       18         30808425
BCT127       73         112210414
BCT128       49         110420665
BCT129       70         108846125
BCT13        110        115172505
BCT130       73         108270921
BCT131       47         106924119
BCT132       69         105310850
BCT133       64         107184448
BCT134       32         30254441
BCT135       204        94545960
BCT136       324        21043424
BCT137       1589       2511877
BCT138       3180       5275358
BCT139       6346       7804712
BCT14        65         108986169
BCT140       12647      15076261
BCT141       25619      27729952
BCT142       50573      54087651
BCT143       75979      77685855
BCT144       71339      76837096
BCT145       10220      95075844
BCT146       5443       100113517
BCT147       3165       107650334
BCT148       136        102080631
BCT149       36         112925712
BCT15        62         117057163
BCT150       2974       106616604
BCT151       5656       103041055
BCT152       40952      78493794
BCT153       71161      76273665
BCT154       4002       110123140
BCT155       4472       110827957
BCT156       6598       108077694
BCT157       3996       104792432
BCT158       44021      93205624
BCT159       75507      78512545
BCT16        54         122104847
BCT160       42212      48423514
BCT161       75766      78496167
BCT162       71869      78012952
BCT163       72959      74098699
BCT164       70425      75797116
BCT165       65806      75825068
BCT166       2791       120175393
BCT167       1671       195662102
BCT168       2376       119580409
BCT169       30330      69315501
BCT17        16100      45514237
BCT18        53926      85358182
BCT19        93         110189094
BCT2         28634      100042835
BCT20        143        97370347
BCT21        58         112869568
BCT22        52         109549606
BCT23        46         112848421
BCT24        57         112994744
BCT25        66         108817610
BCT26        36         96325907
BCT27        40         106881287
BCT28        59         107430269
BCT29        74         111675186
BCT3         48         110791450
BCT30        55         110045255
BCT31        63         106845588
BCT32        55         109391288
BCT33        53         108650404
BCT34        46         110496749
BCT35        95         109522868
BCT36        58         106383657
BCT37        67         109486091
BCT38        125        110095720
BCT39        37         71643089
BCT4         56         110933776
BCT40        200        111474100
BCT41        54         111189650
BCT42        35         108859141
BCT43        59         107860764
BCT44        56         105257887
BCT45        45         109560296
BCT46        74         109517239
BCT47        64         110904710
BCT48        45         108836596
BCT49        59         106741684
BCT5         26996      102525613
BCT50        69         107012469
BCT51        77         109262802
BCT52        22         22714378
BCT53        67         109336234
BCT54        60         104664634
BCT55        53         102829098
BCT56        56         108908758
BCT57        58         105643854
BCT58        54         109754097
BCT59        72         109941269
BCT6         11320      17069351
BCT60        61         106056484
BCT61        62         107001009
BCT62        40         113733092
BCT63        79         111042894
BCT64        50         106161732
BCT65        55         111967167
BCT66        37         44997032
BCT67        43         109822487
BCT68        50         116699480
BCT69        66         111693041
BCT7         38999      84800009
BCT70        50         111462164
BCT71        53         109197673
BCT72        98         115985017
BCT73        73         111137910
BCT74        80         106445736
BCT75        63         114250996
BCT76        69         114803403
BCT77        45         117172892
BCT78        60         109393972
BCT79        55         114714637
BCT8         5504       92826644
BCT80        11         29093403
BCT81        51         118678324
BCT82        259        116137065
BCT83        58         113942473
BCT84        61         111209396
BCT85        301        114578531
BCT86        78         108038525
BCT87        42         110022070
BCT88        52         105304136
BCT89        59         107221935
BCT9         13773      85406365
BCT90        4          12180716
BCT91        48         110361661
BCT92        56         109244680
BCT93        60         111765352
BCT94        45         109058782
BCT95        40         105551587
BCT96        59         103124810
BCT97        43         93815277
BCT98        27         104026474
BCT99        23         101240152
ENV1         92499      71778112
ENV10        86241      70376740
ENV11        93114      72865701
ENV12        82327      86593474
ENV13        21811      18683061
ENV14        84738      80839604
ENV15        118358     43038303
ENV16        89124      77081587
ENV17        96420      67765715
ENV18        96087      63222722
ENV19        109683     66843172
ENV2         94843      71434846
ENV20        122095     64551688
ENV21        61261      82709047
ENV22        70040      85924755
ENV23        90488      74778280
ENV24        126921     36738344
ENV25        122961     29000705
ENV26        82473      18957081
ENV27        123098     49754846
ENV28        97824      67149552
ENV29        114989     56528159
ENV3         87429      71087878
ENV30        135983     52751640
ENV31        108916     60881626
ENV32        94391      65629897
ENV33        17274      17176215
ENV34        62536      84995133
ENV35        88878      73349565
ENV36        102553     44141399
ENV37        96887      56112903
ENV38        70840      54882251
ENV39        111202     47238091
ENV4         88176      76198567
ENV40        100853     61087261
ENV41        107058     61683564
ENV42        63688      90610808
ENV43        72575      78925374
ENV44        62024      84274132
ENV45        13505      18369560
ENV46        70511      78327058
ENV47        107975     49618250
ENV48        112475     56237274
ENV49        104669     61489417
ENV5         68177      90467278
ENV50        80437      42459437
ENV51        100601     44031549
ENV52        42861      53350410
ENV53        41971      54595072
ENV54        57534      57098479
ENV55        96531      61572356
ENV56        34850      19396221
ENV57        95154      61925914
ENV58        77632      77118687
ENV59        83797      61117043
ENV6         88215      85623066
ENV60        86120      68906562
ENV61        103673     51651598
ENV62        43708      34247858
ENV63        109701     46049551
ENV64        90257      60826513
ENV65        101190     51592891
ENV66        94649      55603652
ENV67        79283      75849049
ENV68        27978      19863582
ENV69        79804      88235559
ENV7         101924     65025075
ENV70        84541      50080088
ENV71        85126      61508341
ENV72        59985      72208804
ENV73        107235     29538344
ENV74        48208      12183375
ENV75        80519      70592747
ENV76        93751      58093309
ENV77        106419     56285900
ENV78        115757     29290895
ENV79        93828      65220160
ENV8         215        22079
ENV80        15943      11347938
ENV9         131425     31030486
EST1         159501     61802328
EST10        168132     72499545
EST100       233180     141648965
EST101       238393     125254902
EST102       191026     104655632
EST103       184830     102226005
EST104       100733     70251969
EST105       160793     120288276
EST106       172958     105841260
EST107       135193     84889201
EST108       63932      23808488
EST109       63338      22261346
EST11        169723     73902937
EST110       63851      23133226
EST111       63869      26849945
EST112       64350      23029302
EST113       64591      24539191
EST114       63594      26973372
EST115       63768      26213515
EST116       64045      27335866
EST117       63900      25168231
EST118       61272      33469505
EST119       120119     61658199
EST12        168186     70568370
EST120       160919     86029379
EST121       189568     92905401
EST122       149897     96429847
EST123       158956     93620456
EST124       131061     85293493
EST125       189731     90977142
EST126       156617     83257552
EST127       157618     84632479
EST128       157468     85054318
EST129       151462     85009188
EST13        68158      33127915
EST130       174360     93566480
EST131       183212     117004626
EST132       202722     102482687
EST133       160190     87340771
EST134       162725     82800844
EST135       142905     84074870
EST136       145154     91024077
EST137       95710      49769890
EST138       172777     97663884
EST139       246342     113875121
EST14        217585     109035233
EST140       155006     83736349
EST141       167528     92436361
EST142       150777     88043351
EST143       134580     82656547
EST144       154929     96464140
EST145       155631     85622942
EST146       124335     63556509
EST147       121380     65182376
EST148       127981     57779251
EST149       127278     51196162
EST15        169561     105956998
EST150       128605     51245254
EST151       112845     42053122
EST152       164083     82760221
EST153       176886     74093862
EST154       162695     110605072
EST155       201399     123493991
EST156       214798     122042152
EST157       175841     97101745
EST158       155513     108270606
EST159       140932     95562318
EST16        180260     112984417
EST160       155960     96058948
EST161       156903     82312089
EST162       138782     78206954
EST163       170233     94586562
EST164       65908      41318450
EST165       150544     92148531
EST166       192311     110540155
EST167       146172     84137286
EST168       142922     72473018
EST169       150163     87598151
EST17        195775     114384740
EST170       191360     104937907
EST171       156731     96071285
EST172       168082     82951311
EST173       127350     86837915
EST174       171491     100605680
EST175       173550     100425440
EST176       121182     67842513
EST177       157581     90759292
EST178       30504      17711886
EST179       170569     103118617
EST18        193484     121867026
EST180       181352     119525150
EST181       143933     116907863
EST182       194595     99420245
EST183       153367     103453412
EST184       155102     101611887
EST185       141129     81730184
EST186       176856     71860812
EST187       150855     84387401
EST188       157679     100255452
EST189       157169     96485778
EST19        157928     113092636
EST190       141351     84408883
EST191       157941     95317425
EST192       146219     93549248
EST193       129684     90614026
EST194       144277     88245832
EST195       136442     88919433
EST196       130143     93052519
EST197       163885     87139678
EST198       174664     96032506
EST199       174066     96944735
EST2         162336     61672462
EST20        190101     100197697
EST200       172167     96137189
EST201       169387     95520944
EST202       172287     95599675
EST203       174058     95359928
EST204       174613     96170247
EST205       18101      9755055
EST206       189439     105532431
EST207       206003     105139262
EST208       172523     102457315
EST209       180704     102079826
EST21        218443     107504524
EST210       201584     122977156
EST211       195516     112810009
EST212       192652     124228441
EST213       137471     92114444
EST214       219367     139943712
EST215       236168     119193031
EST216       161410     109253253
EST217       185708     100025668
EST218       205925     102642354
EST219       128176     93544718
EST22        191571     62852643
EST220       146738     85094894
EST221       209053     116594980
EST222       156493     101526071
EST223       107216     114118567
EST224       156382     101759132
EST225       161126     96983686
EST226       144719     102052890
EST227       220195     107820699
EST228       136791     97221552
EST229       121478     87288889
EST23        139256     39634688
EST230       136410     96095080
EST231       123150     88115571
EST232       144987     90835992
EST233       128972     88148741
EST234       140347     105279825
EST235       130898     91746059
EST236       124979     84436105
EST237       142901     88970441
EST238       162011     122027568
EST239       121491     117304020
EST24        102646     27798964
EST240       139575     103354392
EST241       178769     108140869
EST242       163213     101499028
EST243       160446     100786414
EST244       81841      48653050
EST245       165734     126098149
EST246       142605     105144180
EST247       159032     101015894
EST248       216871     95551679
EST249       178408     113629880
EST25        123099     51169979
EST250       159221     82245378
EST251       221638     34167298
EST252       215766     85679115
EST253       163421     123055313
EST254       172894     101604374
EST255       163630     108393468
EST256       113394     70011587
EST257       155797     114785790
EST258       185160     110473039
EST259       188001     98614258
EST26        214445     97482243
EST260       176895     111551159
EST261       165061     110036454
EST262       233536     110593764
EST263       278582     120533068
EST264       185390     112618019
EST265       188050     37126542
EST266       260199     124604297
EST267       63300      41648791
EST268       154851     99486461
EST269       168224     103092435
EST27        219635     110423077
EST270       167920     114482688
EST271       193287     101399951
EST272       162428     109166152
EST273       191522     111889878
EST274       201998     44413077
EST275       201798     48628749
EST276       184660     102910119
EST277       183127     119494882
EST278       175341     114357246
EST279       119455     67928041
EST28        190737     88630916
EST280       175283     113891255
EST281       176094     76763965
EST282       126811     80303531
EST283       135250     86683668
EST284       159524     98457748
EST285       260824     27489567
EST286       262083     26340583
EST287       144414     107412298
EST288       168982     111011718
EST289       159377     99736047
EST29        158219     69020223
EST290       161449     89078242
EST291       148352     13586495
EST292       204650     77329520
EST293       168870     106766024
EST294       175835     106207122
EST295       154347     101144532
EST296       201509     107846026
EST297       151910     110034762
EST298       167553     101410027
EST299       187276     114855967
EST3         151288     53609752
EST30        171904     69749025
EST300       179813     103570496
EST301       186760     98007318
EST302       184123     64387422
EST303       128667     45790076
EST304       183850     71448330
EST305       184789     69357800
EST306       184799     98742856
EST307       181785     130704618
EST308       144468     83394744
EST309       151892     92887641
EST31        150459     63757813
EST310       131974     100211614
EST311       161429     96318057
EST312       173200     99407416
EST313       149410     96656710
EST314       166868     94251863
EST315       160549     107489938
EST316       104558     74147062
EST317       164420     107648554
EST318       157992     110239299
EST319       181429     154181530
EST32        168406     76228911
EST320       170408     107436823
EST321       141831     78721514
EST322       142416     96863940
EST323       146338     99885058
EST324       135531     91087886
EST325       149437     100206151
EST326       150296     101298591
EST327       178685     108498484
EST328       148808     85333720
EST329       149517     85076705
EST33        176088     68246886
EST330       62892      39741112
EST331       151225     107802985
EST332       160984     97837066
EST333       143346     90771308
EST334       142678     89365108
EST335       208853     112102718
EST336       130504     72066496
EST337       91178      54958641
EST338       132440     87598613
EST339       138324     87773972
EST34        118252     40602272
EST340       124351     79110919
EST341       168492     85678506
EST342       212573     84948334
EST343       166913     88551287
EST344       107392     62324491
EST345       165282     103881353
EST346       144135     88620181
EST347       133240     88826357
EST348       136569     89216657
EST349       189232     121949437
EST35        96372      29581039
EST350       157188     96217947
EST351       156724     78069614
EST352       185993     129202710
EST353       114223     78697483
EST354       73452      43939464
EST355       139252     76990619
EST356       130631     78125752
EST357       148865     56384294
EST358       158631     32534951
EST359       45690      8977727
EST36        96776      30249374
EST360       154618     46181107
EST361       192272     123503918
EST362       247645     114845634
EST363       252327     115405693
EST364       176660     99966627
EST365       142793     92585607
EST366       138340     86428252
EST367       158129     94315516
EST368       195653     120233645
EST369       222273     58623640
EST37        95687      29025588
EST370       187005     114079052
EST371       11377      6617851
EST372       214523     117698165
EST373       203337     121031638
EST374       195791     105972617
EST375       150243     74073638
EST376       178957     118834469
EST377       179947     112426482
EST378       149758     117988531
EST379       181700     143647888
EST38        97559      29501837
EST380       154588     90344860
EST381       164955     106941069
EST382       190682     108741707
EST383       111720     58689821
EST384       205415     113952515
EST385       181607     107163361
EST386       206227     127568286
EST387       182908     119525596
EST388       205802     138276930
EST389       226696     130413645
EST39        97733      30978986
EST390       201218     139312934
EST391       209564     169413232
EST392       215480     131936895
EST393       160678     100998999
EST394       82977      37241378
EST395       174803     77398206
EST396       169088     13122418
EST397       154755     14109204
EST398       158539     32738013
EST399       158921     31826509
EST4         171413     67335709
EST40        27728      7102120
EST400       158430     32910847
EST401       147204     96065484
EST402       188415     113787607
EST403       161606     108928444
EST404       165988     101525912
EST405       148359     102150138
EST406       143137     99932070
EST407       142526     89704093
EST408       175502     125169324
EST409       143112     93829621
EST41        101354     52983819
EST410       178847     105584469
EST411       167937     26557309
EST412       167495     69058748
EST413       152280     108614880
EST414       170746     106063211
EST415       149877     93809708
EST416       169584     95780617
EST417       185927     126697346
EST418       140310     92745163
EST419       131712     90297608
EST42        119679     50944607
EST420       146583     90250519
EST421       161304     95158390
EST422       175731     93780967
EST423       154026     94945533
EST424       169753     95882249
EST425       173996     106783300
EST426       131478     85205379
EST427       102007     73232907
EST428       79154      60729499
EST429       112252     72564625
EST43        166411     92035027
EST430       156062     85998131
EST431       128098     77853080
EST432       137596     90968755
EST433       142110     83559547
EST434       167651     97574688
EST435       34570      23511686
EST436       180339     94117419
EST437       164006     105456700
EST438       154584     96515010
EST439       172769     77479224
EST44        170744     72308210
EST440       194242     107483316
EST441       154430     83981296
EST442       170302     99509017
EST443       219859     128436194
EST444       159154     109034776
EST445       167941     103055542
EST446       140061     90751238
EST447       135970     92079741
EST448       51148      29584842
EST449       208279     77325180
EST45        167909     85223112
EST450       187761     84457615
EST451       206197     88427146
EST452       197986     83967181
EST453       183333     113403376
EST454       182123     109268181
EST455       188496     113659535
EST456       200133     121641410
EST457       191422     104293933
EST458       187513     86392478
EST459       146461     84148947
EST46        168982     87084077
EST460       216733     125919969
EST461       168966     103197068
EST462       189579     116222694
EST463       183914     109969512
EST464       140002     102027018
EST465       148661     89610325
EST466       191040     96641867
EST467       145780     82145537
EST468       161480     87192553
EST469       175639     90337984
EST47        163899     88154777
EST470       181083     113327852
EST471       146871     87034687
EST472       180298     123482828
EST473       182380     120605123
EST474       195144     123484839
EST475       175279     79632113
EST476       168799     59188379
EST477       155423     60468727
EST48        162677     83089665
EST49        160164     91354350
EST5         169507     66374636
EST50        162211     88532575
EST51        157798     99194839
EST52        160057     70177340
EST53        147615     82719228
EST54        70500      46816236
EST55        167551     70093416
EST56        165237     74994967
EST57        165115     91163079
EST58        159415     97161912
EST59        156923     102320143
EST6         172145     67172196
EST60        165197     99302734
EST61        160368     108442238
EST62        172139     80371560
EST63        174118     93613371
EST64        155340     84274901
EST65        148841     81570532
EST66        158994     98444950
EST67        130761     74738141
EST68        150125     92006704
EST69        195985     108809274
EST7         170570     73072789
EST70        182679     95704632
EST71        222671     122066626
EST72        186924     112075552
EST73        203427     120494462
EST74        164684     90641415
EST75        132274     60462954
EST76        137545     67731396
EST77        158968     99578392
EST78        157440     96507528
EST79        142905     78852254
EST8         180022     73163588
EST80        44358      20636155
EST81        164121     100517447
EST82        212723     115158654
EST83        224811     124302232
EST84        200937     94556507
EST85        212098     93356446
EST86        161344     93008941
EST87        144319     87611118
EST88        164573     80878122
EST89        159034     80100411
EST9         169002     69439824
EST90        153994     102498345
EST91        151730     89322922
EST92        130261     84057909
EST93        156201     113028434
EST94        141252     103426150
EST95        142079     101607299
EST96        141278     97671252
EST97        147758     81859664
EST98        178938     111022651
EST99        224332     135929884
GSS1         200956     88002998
GSS10        132705     60745240
GSS100       145433     114443307
GSS101       141764     116180696
GSS102       143557     116922653
GSS103       168501     129420855
GSS104       146799     80635635
GSS105       192097     121271500
GSS106       168802     112804754
GSS107       198979     116658306
GSS108       205243     134847694
GSS109       209583     138195917
GSS11        137159     73866503
GSS110       207317     140856763
GSS111       206094     142305226
GSS112       205170     143520702
GSS113       204900     143985744
GSS114       202032     146594861
GSS115       182163     139159076
GSS116       16104      9733798
GSS117       133162     84221146
GSS118       170189     80224521
GSS119       183840     79343474
GSS12        148406     75892516
GSS120       170040     148157293
GSS121       177781     120695369
GSS122       180155     146211161
GSS123       187659     120761817
GSS124       186941     139004840
GSS125       192458     127367962
GSS126       192011     93473385
GSS127       167386     156195718
GSS128       163764     114173523
GSS129       60045      36170859
GSS13        145697     69144434
GSS130       170924     155391140
GSS131       172238     154355826
GSS132       172284     155048214
GSS133       173670     154060692
GSS134       171880     154915342
GSS135       180818     138727359
GSS136       178920     146931888
GSS137       165756     119158151
GSS138       190643     95937190
GSS139       258272     39831727
GSS14        171223     85489549
GSS140       258271     39806206
GSS141       93957      14435985
GSS142       255964     58806066
GSS143       260425     57449147
GSS144       191730     85708160
GSS145       196898     67820685
GSS146       186512     148755687
GSS147       182887     151529765
GSS148       168597     155742158
GSS149       171019     157769882
GSS15        161657     98232653
GSS150       238045     70591905
GSS151       226815     82624596
GSS152       129341     51996947
GSS153       209214     56380289
GSS154       157841     95882122
GSS155       180936     114458291
GSS156       135932     86662696
GSS157       166381     133026095
GSS158       184500     161558028
GSS159       194052     159476168
GSS16        173477     87329978
GSS160       191204     124842932
GSS161       217163     138259804
GSS162       221447     132907455
GSS163       158631     97938793
GSS164       149748     86107808
GSS165       42916      31338317
GSS166       212621     158651660
GSS167       189244     95373371
GSS168       85297      7439260
GSS169       87049      63866074
GSS17        184270     114514257
GSS170       83577      62786585
GSS171       103148     48382659
GSS172       68919      58592511
GSS173       8534       7665388
GSS174       68591      57924394
GSS175       69224      56650935
GSS176       69460      56187403
GSS177       71202      55998401
GSS178       68561      51865315
GSS179       75915      58209304
GSS18        192267     113918148
GSS180       86719      74437329
GSS181       81366      44383585
GSS182       92251      45020353
GSS183       64685      48313007
GSS184       77811      61666620
GSS185       70214      59194054
GSS186       68204      63291319
GSS187       62721      52920889
GSS188       94997      42350372
GSS189       19516      4538570
GSS19        107974     48380632
GSS190       112930     70870954
GSS191       830        565879
GSS192       23226      28867035
GSS193       109084     70678875
GSS194       84403      34582519
GSS195       35904      22282147
GSS196       103304     62490220
GSS197       102329     63761256
GSS198       104196     67611234
GSS199       82171      41322048
GSS2         182795     92568599
GSS20        181810     101786580
GSS200       83102      54651503
GSS201       95552      61239914
GSS202       107362     78589696
GSS203       106457     76738025
GSS204       106101     79982459
GSS205       104001     80014803
GSS206       75801      50678132
GSS207       105097     63619915
GSS208       109868     66415305
GSS209       105995     59196161
GSS21        166509     114370216
GSS210       68060      37226354
GSS211       69100      38526913
GSS212       38147      18321461
GSS213       85817      46213833
GSS214       97756      56282806
GSS215       94838      49467300
GSS216       96276      55952494
GSS217       41313      23149851
GSS218       114055     43442995
GSS219       116422     39251295
GSS22        170128     97970449
GSS220       108546     52732132
GSS221       108722     67128647
GSS222       101583     78242094
GSS223       56996      34057395
GSS224       96897      36918766
GSS225       96399      37676586
GSS226       97739      35452830
GSS227       95145      39751140
GSS228       33820      15967145
GSS229       103939     66277823
GSS23        187498     127408864
GSS230       94551      61190929
GSS231       95128      60357048
GSS232       94773      60868501
GSS233       75675      70017159
GSS234       80658      68522367
GSS235       32685      33693673
GSS236       83736      28233267
GSS237       84219      27346468
GSS238       84926      25909272
GSS239       14851      4422302
GSS24        195136     130447043
GSS240       16547      7508221
GSS241       94142      60608363
GSS242       97374      65482699
GSS243       96141      65699826
GSS244       87647      48537317
GSS245       96960      54078820
GSS246       89387      48759073
GSS247       35861      19580707
GSS248       90839      57016024
GSS249       89674      61866093
GSS25        177578     104708359
GSS250       88534      63668650
GSS251       89290      62493340
GSS252       9699       6996370
GSS253       87995      63795538
GSS254       90590      62742076
GSS255       94937      59925372
GSS256       74696      63777273
GSS257       84391      78676825
GSS258       82881      80793634
GSS259       69452      51663438
GSS26        187090     109211766
GSS260       114900     62956729
GSS261       109229     55656739
GSS262       107532     52126493
GSS263       99054      44380734
GSS264       109801     49060015
GSS265       97917      46046727
GSS266       73058      72226496
GSS267       77174      72621583
GSS268       92147      71194681
GSS269       24563      18498472
GSS27        169240     151421865
GSS270       92250      71055526
GSS271       85869      83025280
GSS272       83675      87061685
GSS273       82362      86366324
GSS274       87240      67099066
GSS275       90053      72027971
GSS276       91485      69770366
GSS277       92051      60727282
GSS278       16085      9815234
GSS279       94787      57200301
GSS28        190474     145243740
GSS280       93517      59081345
GSS281       93900      58510429
GSS282       94714      57307691
GSS283       83843      51265303
GSS284       104594     69753809
GSS285       105287     75065932
GSS286       110489     69020768
GSS287       108020     71887545
GSS288       34723      23874823
GSS289       112486     66705569
GSS29        152644     107767608
GSS290       97739      61236450
GSS291       106989     56618583
GSS292       93192      73280778
GSS293       52708      33005111
GSS3         175744     88089328
GSS30        192323     131421772
GSS31        10101      6712642
GSS32        196657     127651461
GSS33        217776     116759610
GSS34        219644     114213054
GSS35        220777     112664012
GSS36        214622     123365339
GSS37        199352     157077838
GSS38        195922     147426365
GSS39        191244     68588056
GSS4         167450     85326614
GSS40        185345     98002042
GSS41        190663     126768070
GSS42        171525     159218367
GSS43        6464       4245790
GSS44        184487     100551761
GSS45        173356     121956763
GSS46        183653     123771899
GSS47        189151     121133069
GSS48        73041      64192484
GSS49        172209     102210173
GSS5         50957      30366520
GSS50        168276     103464302
GSS51        168453     103104964
GSS52        182982     120643470
GSS53        184863     116613345
GSS54        180880     122036628
GSS55        186108     112857554
GSS56        190270     135477831
GSS57        178563     104540821
GSS58        193546     119346867
GSS59        179863     132177428
GSS6         162011     84658147
GSS60        5293       4823991
GSS61        173080     139097497
GSS62        162251     111940135
GSS63        162287     111957763
GSS64        157141     106504657
GSS65        156916     129183900
GSS66        170503     142796915
GSS67        179240     116632250
GSS68        202718     127006598
GSS69        193507     110487624
GSS7         165849     79606985
GSS70        244856     126494010
GSS71        160935     106885564
GSS72        159278     119591355
GSS73        162713     124578321
GSS74        162678     124640986
GSS75        175218     109076498
GSS76        190382     140117053
GSS77        13398      7917760
GSS78        197142     125263567
GSS79        169736     110844237
GSS8         165859     89017102
GSS80        199335     130669706
GSS81        211104     88692781
GSS82        190300     97184852
GSS83        132489     92556808
GSS84        146857     117960163
GSS85        139728     117087788
GSS86        142924     114044689
GSS87        144172     119953236
GSS88        141878     115747548
GSS89        107735     89811059
GSS9         138220     67303044
GSS90        149553     122345018
GSS91        147788     117792665
GSS92        144115     113155638
GSS93        142979     115531478
GSS94        144339     119769367
GSS95        148217     121718869
GSS96        147793     117902839
GSS97        146200     121153918
GSS98        146261     121035223
GSS99        146701     120155849
HTC1         25047      27029900
HTC10        70234      71339095
HTC11        72099      70026705
HTC12        26033      31619747
HTC13        67517      60542416
HTC14        69056      69673712
HTC15        42805      28057550
HTC2         16071      36202003
HTC3         16014      36607191
HTC4         16234      35514380
HTC5         15960      40329026
HTC6         16042      37386456
HTC7         53544      31189020
HTC8         31528      19962928
HTC9         60735      77635959
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1440       190959407
HTG113       1519       189543650
HTG114       1397       176295718
HTG115       1216       154301500
HTG116       1336       175258470
HTG117       1375       190219547
HTG118       1114       190209102
HTG119       990        162413998
HTG12        1452       184004673
HTG120       1554       186401663
HTG121       1913       189992602
HTG122       1002       187846202
HTG123       1076       193254809
HTG124       1101       193132031
HTG125       507        93740442
HTG126       1031       189469892
HTG127       1055       192678789
HTG128       1163       191852916
HTG129       1080       192395749
HTG13        875        191786413
HTG130       1084       193090210
HTG131       588        103686357
HTG132       1122       192519796
HTG133       1078       192373539
HTG134       1078       192352380
HTG135       1167       191892724
HTG136       2130       191479856
HTG137       1095       192378745
HTG138       1077       192076391
HTG139       1089       192444477
HTG14        753        191921309
HTG140       1036       190333830
HTG141       1388       164669644
HTG15        745        191963148
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1148       192593691
HTG77        1188       192551497
HTG78        1069       180930974
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93655      48150123
INV10        49200      92661380
INV100       35892      166944993
INV101       23159      177277868
INV102       22654      170374262
INV103       4699       190767649
INV104       29376      152389625
INV105       55624      119361124
INV106       566        40635863
INV107       13290      185663668
INV108       46052      156995419
INV109       17685      178053678
INV11        64941      83296490
INV110       10931      169579136
INV111       5400       173896352
INV112       2395       175847816
INV113       1060       176715006
INV114       1347       176603189
INV115       1932       176497159
INV116       2801       175849650
INV117       16243      174674613
INV118       2628       14728008
INV119       39813      159668855
INV12        77617      62102768
INV120       62444      141571579
INV121       19462      30223725
INV122       104664     106635585
INV123       74485      120950484
INV124       12150      167707416
INV125       18312      163693932
INV126       13696      93886771
INV127       29262      155753563
INV128       38610      149060814
INV129       51684      139700572
INV13        10882      10123606
INV130       70877      126444377
INV131       97323      108082698
INV132       125942     86452766
INV133       47821      122382277
INV14        84554      65942075
INV15        80759      66729524
INV16        78589      66808940
INV17        49380      46534975
INV18        36767      122083599
INV19        365        151525256
INV2         56444      96501231
INV20        49519      104207846
INV21        77098      55514645
INV22        72093      61867609
INV23        454        294468
INV24        23064      127285143
INV25        6          133712559
INV26        56471      101419892
INV27        74838      49927205
INV28        66524      48431349
INV29        76924      55033535
INV3         1390       187506460
INV30        75606      57233915
INV31        77207      59630589
INV32        73252      51433338
INV33        50134      33193350
INV34        78948      56672857
INV35        74952      55789111
INV36        73820      61390514
INV37        77354      57776751
INV38        46825      30411038
INV39        77420      56720599
INV4         795        126765008
INV40        72046      50533333
INV41        76871      59892893
INV42        75041      63191706
INV43        32665      146652327
INV44        73984      132580277
INV45        94651      114477013
INV46        112033     99368813
INV47        122560     90159744
INV48        16183      9805707
INV49        35238      166584902
INV5         26849      110612890
INV50        30754      171611440
INV51        27714      170892418
INV52        2597       191028659
INV53        6185       191114217
INV54        17831      180089188
INV55        15380      184775278
INV56        6834       166792726
INV57        8875       189509571
INV58        15662      184182101
INV59        30722      171526293
INV6         78900      70600509
INV60        65600      142208408
INV61        21638      22670137
INV62        50224      153584896
INV63        4095       191102716
INV64        11177      184659675
INV65        29153      168751324
INV66        3317       189349389
INV67        6330       186171285
INV68        12367      180474553
INV69        39596      157268982
INV7         53461      95800383
INV70        60755      142074593
INV71        67983      110944176
INV72        93001      114614617
INV73        56274      146052731
INV74        16688      171579078
INV75        33874      156329130
INV76        82253      117982423
INV77        24999      174542393
INV78        32599      158648520
INV79        60222      139121472
INV8         42014      87478903
INV80        13267      12603878
INV81        41258      162193552
INV82        8649       189035299
INV83        14549      181577331
INV84        5295       188760704
INV85        18509      176900436
INV86        34351      158679406
INV87        14344      172158272
INV88        23577      45955779
INV89        16795      180349455
INV9         80273      71508998
INV90        21027      172501512
INV91        4891       191046501
INV92        26084      174037919
INV93        14547      181030545
INV94        44397      155376448
INV95        27112      171621394
INV96        19370      174154051
INV97        49371      138775955
INV98        29055      84543185
INV99        96245      108547326
MAM1         20803      155199280
MAM2         14381      164343810
MAM3         62662      79801434
MAM4         3331       188297207
MAM5         79876      74556086
MAM6         45434      132629463
MAM7         76013      61972898
MAM8         67839      72580453
MAM9         36279      37699222
PAT1         222538     70098603
PAT10        124434     102483867
PAT100       178342     3388498
PAT101       178198     3385762
PAT102       178185     3385515
PAT103       132610     2848492
PAT104       342935     8573375
PAT105       188806     88519660
PAT106       111348     132068608
PAT107       3850       194703659
PAT108       131292     110979300
PAT109       158599     54826034
PAT11        99006      64236508
PAT110       224686     34110691
PAT111       250080     15844307
PAT112       180710     63626618
PAT113       51662      26099509
PAT114       114159     110461510
PAT115       137629     83248311
PAT116       164257     98982358
PAT117       158391     103578605
PAT118       137595     115028683
PAT119       42623      28098564
PAT12        141821     62660332
PAT120       193712     81686401
PAT121       150217     108404022
PAT122       356051     11379688
PAT123       257211     57607099
PAT124       138161     48226925
PAT125       322021     22795469
PAT126       155639     102753887
PAT127       132727     110696284
PAT128       128341     121313309
PAT129       21664      184390005
PAT13        103913     59427456
PAT130       144888     112900567
PAT131       171997     96403773
PAT132       44618      171217879
PAT133       9167       47581637
PAT134       33645      178334734
PAT135       153558     109675196
PAT136       178705     90913377
PAT137       136049     115324159
PAT138       120392     123342367
PAT139       8527       8992390
PAT14        102690     49413471
PAT140       155429     101473147
PAT141       184764     88815933
PAT142       182409     85292093
PAT143       174403     93928365
PAT144       28829      20461016
PAT145       147929     108545966
PAT146       160945     101973668
PAT147       185311     90980420
PAT148       231649     49265020
PAT149       203540     47701039
PAT15        120398     52425890
PAT150       277765     9659534
PAT151       220400     46464910
PAT152       106913     2885992
PAT153       270386     21672571
PAT154       186716     61205669
PAT155       109743     106072275
PAT156       47609      9569112
PAT157       87243      88069835
PAT158       78301      95521036
PAT159       144667     77923609
PAT16        108586     62723905
PAT160       167872     71101364
PAT161       121201     93112552
PAT162       103356     85053142
PAT163       165832     46476460
PAT164       270022     5130418
PAT165       269978     5129582
PAT166       269978     5129582
PAT167       237888     4519872
PAT168       269396     5118524
PAT169       235458     25558526
PAT17        47611      17036323
PAT170       203676     47168259
PAT171       12113      425307
PAT172       165316     74866922
PAT173       91680      126651183
PAT174       172431     71668474
PAT175       213541     66907470
PAT176       42480      48675721
PAT177       235138     59544089
PAT178       123750     125093767
PAT179       217504     66591902
PAT18        146771     52594264
PAT180       198097     84199370
PAT181       186239     73868425
PAT182       49377      40851625
PAT183       93072      87231074
PAT184       91814      79965559
PAT185       83779      91675964
PAT186       108702     54187286
PAT187       101031     56670672
PAT188       150189     24631215
PAT189       93817      82459162
PAT19        153705     78039102
PAT190       26010      162900357
PAT191       113946     65760783
PAT192       81611      28133789
PAT193       3631       191518875
PAT194       84408      78157905
PAT195       145071     26290709
PAT196       76957      99954231
PAT197       95300      71301966
PAT198       129710     31538759
PAT199       116263     69649269
PAT2         194511     84661805
PAT20        104712     118084998
PAT200       86788      129976495
PAT201       158941     78754581
PAT202       213430     47115269
PAT203       169392     66573870
PAT204       59678      8569578
PAT205       161905     78473868
PAT206       120048     100582914
PAT207       86564      129132805
PAT208       37996      167174831
PAT209       35971      168657367
PAT21        133770     95332049
PAT210       75246      137662390
PAT211       252341     29172437
PAT212       137370     91936918
PAT213       148387     82274084
PAT214       141922     75233264
PAT215       139424     87026199
PAT216       157082     89060288
PAT217       229826     25723771
PAT22        84661      79580685
PAT23        123515     103389745
PAT24        119462     105505402
PAT25        145165     86772212
PAT26        175020     64351893
PAT27        71838      1795950
PAT28        102159     77384755
PAT29        93963      87602611
PAT3         171983     95894882
PAT30        119896     61652359
PAT31        96715      78968561
PAT32        128327     55026481
PAT33        92075      51060843
PAT34        117819     69179012
PAT35        119664     35931015
PAT36        105603     75805817
PAT37        138293     26983846
PAT38        157926     27534073
PAT39        114532     50392981
PAT4         153746     106059506
PAT40        54164      54773198
PAT41        95720      83164078
PAT42        100235     70852545
PAT43        136071     39459525
PAT44        143788     35448269
PAT45        123821     64575799
PAT46        104398     81176714
PAT47        93299      74375876
PAT48        113234     66602624
PAT49        65388      54850684
PAT5         57159      23935291
PAT50        135191     107998311
PAT51        167081     97032801
PAT52        116396     127553842
PAT53        196336     76726384
PAT54        80312      127991532
PAT55        27631      180872621
PAT56        185408     93066629
PAT57        274259     6856475
PAT58        129447     31627433
PAT59        161320     77719729
PAT6         170642     91909261
PAT60        92712      89262898
PAT61        106331     74865633
PAT62        122365     64031899
PAT63        67707      30354265
PAT64        70749      109767380
PAT65        87947      82758205
PAT66        92970      78936927
PAT67        93166      72442104
PAT68        93383      75086630
PAT69        115772     60531684
PAT7         154726     88206566
PAT70        102742     9941933
PAT71        175930     10547617
PAT72        171510     10872561
PAT73        171496     10866737
PAT74        99862      86225235
PAT75        99         196466297
PAT76        67         192869889
PAT77        103        195600591
PAT78        1136       196318666
PAT79        97600      5772327
PAT8         131247     96844624
PAT80        151009     9636510
PAT81        151022     9621259
PAT82        151024     9622125
PAT83        151021     9620837
PAT84        94630      88055548
PAT85        92267      94521591
PAT86        37549      34673766
PAT87        83459      93185861
PAT88        15566      180450125
PAT89        164893     19209769
PAT9         129030     101191050
PAT90        178944     3399936
PAT91        177434     3371246
PAT92        175305     3330795
PAT93        101400     1926600
PAT94        169168     12412189
PAT95        178699     3395281
PAT96        178691     3395129
PAT97        178677     3394863
PAT98        140783     2674877
PAT99        178683     3394977
PHG1         5825       104107209
PHG2         3407       63286492
PLN1         59825      93476489
PLN10        39968      38292076
PLN11        72979      75719128
PLN12        37373      49238459
PLN13        40171      65481754
PLN14        22683      123580726
PLN15        21110      100271020
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        24729      127753568
PLN2         74610      77604081
PLN20        5972       146407780
PLN21        1288       168147499
PLN22        1448       166987774
PLN23        19863      32164214
PLN24        66928      69775968
PLN25        30142      32290941
PLN26        76750      76378085
PLN27        64714      80267316
PLN28        61731      100492338
PLN29        76         95744252
PLN3         29710      113002650
PLN30        3          61743175
PLN31        54         123504479
PLN32        916        161331748
PLN33        23367      116709698
PLN34        19231      134119123
PLN35        77814      74650789
PLN36        96603      58528603
PLN37        33964      32397814
PLN38        80221      71536009
PLN39        77610      75782435
PLN4         1390       181168384
PLN40        80132      70308297
PLN41        81858      75336617
PLN42        59112      32961981
PLN43        98834      55161544
PLN44        82301      68379615
PLN45        45165      99063367
PLN46        4701       157065213
PLN47        11878      163908287
PLN48        29599      120402521
PLN49        56822      101907244
PLN5         1883       187301041
PLN50        14204      9731423
PLN51        80555      72584337
PLN52        19280      13839580
PLN53        49499      72634085
PLN54        25058      110561902
PLN55        8937       84814503
PLN56        1          774434471
PLN57        6101       26368585
PLN58        123        147490029
PLN59        2          135217911
PLN6         1841       194216982
PLN60        2          155188403
PLN61        2          140023111
PLN62        2          154604167
PLN63        2          148753627
PLN64        3          173772618
PLN65        3          178836778
PLN66        3          176344173
PLN67        3          195539469
PLN68        12232      129331347
PLN69        82186      65247741
PLN7         1689       194138750
PLN70        93123      57680160
PLN71        21388      15003750
PLN72        77325      71118802
PLN73        70167      84178942
PLN74        76930      67642138
PLN75        71455      76703965
PLN76        79718      65960125
PLN77        5183       4745062
PLN78        78233      63203094
PLN79        74953      69869951
PLN8         1960       190358808
PLN80        84360      54768844
PLN81        80698      59057845
PLN82        18281      21707067
PLN83        73652      63012329
PLN84        68744      75902327
PLN85        65951      79957671
PLN86        42748      51311463
PLN87        96842      49725622
PLN88        72614      70932702
PLN89        68004      70926183
PLN9         58411      92933858
PLN90        64124      75978472
PLN91        3181       151858083
PLN92        80         195085331
PLN93        31352      124833550
PLN94        6          179755961
PLN95        18333      165758460
PLN96        24278      46897910
PRI1         23031      59758996
PRI10        1256       179127241
PRI11        836        100834284
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         20491      146598347
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2081       192786782
PRI23        19268      54903848
PRI24        31503      84573688
PRI25        61939      78158734
PRI26        31359      70668943
PRI27        8758       172032991
PRI28        2265       191511011
PRI29        1666       190948953
PRI3         1438       174847016
PRI30        2074       192136957
PRI31        2195       191096868
PRI32        13092      162173929
PRI33        2070       170768935
PRI34        58140      87752540
PRI35        5447       11317817
PRI36        32168      63556677
PRI37        20508      119026093
PRI38        19010      150448070
PRI39        67639      85444074
PRI4         1278       185720090
PRI40        50057      89385040
PRI41        41880      80941531
PRI42        47283      95820542
PRI43        26895      100976070
PRI44        28744      109048468
PRI45        22921      105509391
PRI46        30065      98990836
PRI47        41858      113076171
PRI48        46349      84601478
PRI5         1331       184490346
PRI6         1181       179828432
PRI7         1230       180342991
PRI8         1224       178975091
PRI9         1368       174891786
ROD1         35904      134992574
ROD10        988        181626798
ROD11        278        52591059
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15458      158988425
ROD2         909        175671113
ROD20        1358       2500688
ROD21        20403      157183388
ROD22        1220       193673930
ROD23        937        147781632
ROD24        15479      168700346
ROD25        37932      68967800
ROD26        20945      110596383
ROD27        1537       193206645
ROD28        146059     23767425
ROD29        77783      76316111
ROD3         909        173264505
ROD30        83520      54205593
ROD31        32489      37263230
ROD4         900        173560454
ROD5         919        174617121
ROD6         965        177760544
ROD7         974        179667688
ROD8         974        181293382
ROD9         996        181705058
STS1         85207      36726695
STS10        57907      44420216
STS11        48911      37504044
STS12        57924      43637361
STS13        64262      42841250
STS14        93608      34189309
STS15        104286     26516541
STS16        10136      2746022
STS17        103700     27504029
STS18        97687      33627593
STS19        96675      34551519
STS2         84241      49869513
STS20        70892      25045452
STS3         66814      26319442
STS4         77150      36962079
STS5         8569       5026950
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55715      37766563
SYN1         52566      70975360
SYN2         44334      79158147
SYN3         22121      131149423
SYN4         4591       176431735
SYN5         4588       176376431
SYN6         4594       176347846
SYN7         13494      156141855
SYN8         14666      25297135
TSA1         120229     38175118
TSA10        18501      20932212
TSA100       66522      67080686
TSA101       64005      75825743
TSA102       87314      55376103
TSA103       51068      27412276
TSA104       74245      86358066
TSA105       80229      75622518
TSA106       84814      72313292
TSA107       77875      83688591
TSA108       94381      51984420
TSA109       99489      69630247
TSA11        134181     34620238
TSA110       58885      96680672
TSA111       109175     49378845
TSA112       63354      68310026
TSA113       80812      88891396
TSA114       70537      71912951
TSA115       57870      119429113
TSA116       5002       6820454
TSA117       106689     67779914
TSA118       93410      83369889
TSA119       98615      76609458
TSA12        60167      20022990
TSA120       88033      68056906
TSA121       84936      58872153
TSA122       77781      62305776
TSA123       82123      76300148
TSA124       98272      60539749
TSA125       94511      42629446
TSA126       76651      54391930
TSA127       42631      39910255
TSA128       59626      61176103
TSA129       59047      61657426
TSA13        64386      59430252
TSA130       59168      62167042
TSA131       71956      78379950
TSA132       88191      51726115
TSA133       63742      65122388
TSA134       1784       708763
TSA135       78372      34800123
TSA136       74749      67769223
TSA137       81134      78516520
TSA138       74738      64368149
TSA139       41094      34067132
TSA14        92644      61562171
TSA140       87600      70235611
TSA141       89003      68194525
TSA142       84656      77065314
TSA143       76791      81310397
TSA144       12038      10028761
TSA145       104187     53670971
TSA146       81024      61412061
TSA147       69807      78230935
TSA148       73068      68063462
TSA149       87167      75197912
TSA15        86754      43106045
TSA150       89965      70421878
TSA151       62321      102799580
TSA152       95551      74305126
TSA153       20005      13967517
TSA154       83185      63773173
TSA155       83474      63810105
TSA156       78951      73455247
TSA157       76902      76048404
TSA158       93312      58446350
TSA159       101578     67502282
TSA16        76033      85960467
TSA160       33762      23521630
TSA161       103445     64539230
TSA162       94920      75734700
TSA163       79702      63344755
TSA164       31205      48010899
TSA165       51213      97186237
TSA166       46452      106484857
TSA167       44628      110049083
TSA168       41761      115650886
TSA169       39155      120742763
TSA17        78962      72486729
TSA170       37682      123622558
TSA171       35954      127010074
TSA172       12428      25615990
TSA18        86040      43851121
TSA19        74055      87962158
TSA2         112872     41354278
TSA20        86960      74141027
TSA21        69119      78719064
TSA22        90916      73011986
TSA23        98799      47910685
TSA24        49952      16727762
TSA25        85797      70106183
TSA26        120080     38852195
TSA27        135073     34045322
TSA28        52643      68389480
TSA29        47693      62712379
TSA3         109738     40819744
TSA30        2568       4358627
TSA31        60987      81840924
TSA32        93007      67047844
TSA33        109158     50156094
TSA34        105985     49608229
TSA35        101802     53927291
TSA36        104196     47869725
TSA37        25155      16078008
TSA38        66195      59263498
TSA39        92195      67722162
TSA4         110871     47429155
TSA40        92732      62207585
TSA41        79993      85992869
TSA42        99500      49867771
TSA43        113591     34204106
TSA44        95201      67568206
TSA45        13667      8496844
TSA46        94353      35365815
TSA47        77391      35904179
TSA48        106332     43403178
TSA49        113806     45488371
TSA5         76764      23186803
TSA50        29846      20501254
TSA51        105735     50140224
TSA52        100655     54491793
TSA53        94817      63356575
TSA54        83277      83596257
TSA55        63297      25469672
TSA56        90365      71288560
TSA57        97490      54396288
TSA58        60102      105473410
TSA59        86943      65053367
TSA6         111583     58975350
TSA60        78610      70648120
TSA61        83052      72225685
TSA62        82797      72051274
TSA63        69027      90930325
TSA64        90777      66753345
TSA65        75897      84474971
TSA66        71863      73184540
TSA67        68804      60806651
TSA68        84938      78092730
TSA69        85242      78226283
TSA7         87421      57901423
TSA70        70135      97561426
TSA71        85540      69665112
TSA72        84998      51586540
TSA73        102325     68656057
TSA74        87168      58768010
TSA75        103817     56958943
TSA76        73541      73023551
TSA77        78857      44745962
TSA78        87334      79220475
TSA79        91715      69203605
TSA8         104450     72517643
TSA80        78648      53425286
TSA81        79096      57205952
TSA82        97059      60761749
TSA83        38217      34954526
TSA84        89257      76980939
TSA85        95080      55375897
TSA86        110845     44819727
TSA87        97242      58062674
TSA88        65162      96953486
TSA89        15114      14610282
TSA9         109298     60842426
TSA90        101297     55494442
TSA91        91074      53960295
TSA92        93807      43529224
TSA93        85784      74014953
TSA94        73198      72111378
TSA95        39917      46713872
TSA96        77437      80992651
TSA97        77545      54883790
TSA98        84159      38595329
TSA99        76607      52796861
UNA1         323        187511
VRL1         65113      70964277
VRL10        44971      73447768
VRL11        63155      71657893
VRL12        68663      66509968
VRL13        61487      72684594
VRL14        22130      32092374
VRL15        62814      70983412
VRL16        57367      72680187
VRL17        62979      64423822
VRL18        56279      73623363
VRL19        50609      64467459
VRL2         67723      65270207
VRL20        54760      72349167
VRL21        58462      71425723
VRL22        55944      73539399
VRL23        55595      73545381
VRL24        27682      45274684
VRL25        52671      75186892
VRL26        37992      81890074
VRL27        47767      75025497
VRL28        48447      73960208
VRL29        47937      77945869
VRL3         71538      62023515
VRL30        52133      77765230
VRL31        42240      85525688
VRL32        45786      80301967
VRL33        51750      61163502
VRL4         69900      65719121
VRL5         68794      68182228
VRL6         13452      19261544
VRL7         48105      77432826
VRL8         46639      71842270
VRL9         43899      71384525
VRT1         63055      85547847
VRT10        1318       193270233
VRT11        8957       180700770
VRT12        3157       104392224
VRT13        13368      172113838
VRT14        5823       185035611
VRT15        3792       188749995
VRT16        49337      115780159
VRT17        79317      69295631
VRT18        77289      66388481
VRT19        20356      15079059
VRT2         1220       194376345
VRT20        71489      76486944
VRT21        44961      123029221
VRT22        77271      63213573
VRT23        79047      62095724
VRT24        81800      57909589
VRT25        32265      22415962
VRT26        102784     66127783
VRT27        81221      56299795
VRT28        85542      58171697
VRT29        61161      45932518
VRT3         56530      108598509
VRT30        90917      53917601
VRT31        75383      58104913
VRT32        3254       2698004
VRT33        74576      57401518
VRT34        37474      29393734
VRT35        80815      57512353
VRT36        6579       182212366
VRT37        8          189842922
VRT38        11         194097899
VRT39        10         183095788
VRT4         17351      161140666
VRT40        141        196691609
VRT41        358        196364952
VRT42        2023       195128877
VRT43        2494       194681088
VRT44        7284       188623173
VRT45        12659      11991726
VRT5         39135      71471478
VRT6         72947      66687595
VRT7         31771      63578137
VRT8         30510      114101527
VRT9         1267       193556471

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 206.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

20918370 17701486329   Homo sapiens
9727421   9995843320   Mus musculus
2193798   6526145906   Rattus norvegicus
2227199   5410315442   Bos taurus
4177032   5201608890   Zea mays
3296860   4894900310   Sus scrofa
1727569   3128251101   Danio rerio
1796614   1927498302   Triticum aestivum
204773    1835754064   Cyprinus carpio
744503    1743196649   Solanum lycopersicum
1332376   1617837444   Hordeum vulgare subsp. vulgare
257673    1435277686   Strongylocentrotus purpuratus
456878    1297417929   Macaca mulatta
23513     1276936156   Fasciola hepatica
1376391   1265533806   Oryza sativa Japonica Group
489747    1263755792   Spirometra erinaceieuropaei
1587994   1249264770   Xenopus (Silurana) tropicalis
1778817   1200432683   Nicotiana tabacum
2565122   1197329573   Arabidopsis thaliana
1269054   1156793689   Drosophila melanogaster

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled, as time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          February 15 2014

                NCBI-GenBank Flat File Release 206.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ02).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


   Benson DA, Clark K, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW.
   GenBank. Nucleic Acids Res. 42(Database issue):D32-7 (2014)

   DOI:  10.1093/nar/gkt1030
   PMID: 24217914

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 42(Database issue), D32-7 (2014)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 206.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Brenda Chow, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Irene Fang, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, J. Bradley Holmes,
	Jonathan Kans, Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh,
	Jim Ostell, Vasuki Palanigobu, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov,
	Elena Starchenko, Hanzhen Sun, Tatiana Tatusova, Kamen Todorov,
	Eugene Yaschenko, Sergey Zhdanov

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center