Release Notes For GenBank Release 208

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2015

               NCBI-GenBank Flat File Release 208.0

                    Distribution Release Notes

 185019352 loci, 193921042946 bases, from 185019352 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 208.0
1.2 Cutoff Date
1.3 Important Changes in Release 208.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 208.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 208.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 208.0, incorporates data processed by the INSDC databases
as of Thursday June 18, 2015 at approximately 1:33am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 208.0

1.3.1 Organizational changes

The total number of sequence data files increased by 59 with this release:

  - the BCT division is now composed of 187 files (+9)
  - the CON division is now composed of 319 files (+2)
  - the GSS division is now composed of 297 files (+4)
  - the HTG division is now composed of 151 files (+9)
  - the INV division is now composed of 128 files (+2)
  - the PAT division is now composed of 223 files (+4)
  - the PLN division is now composed of 112 files (+5)
  - the PRI division is now composed of  49 files (+1)
  - the TSA division is now composed of 195 files (+20)
  - the VRL division is now composed of  36 files (+2)
  - the VRT division is now composed of  46 files (+1)

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 125
of the GSS flatfiles in Release 208.0. Consider gbgss173.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                            June 15 2015

                NCBI-GenBank Flat File Release 208.0

                           GSS Sequences (Part 1)

   87032 loci,    63853715 bases, from    87032 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "173" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats

  As of 06/15/2016, the integer sequence identifiers known as "GIs" will no
longer be included in the GenBank, GenPept, and FASTA formats supported by
NCBI for the display of sequence records.

  As first described in the Release Notes for GenBank 199.0 in December 2013,
NCBI is in the process of moving to storage solutions which utilize only
Accession.Version identifiers. See Section 1.4.2 of these release notes for
additional background information about those developments.

  Although GI sequence identifiers served their purpose well for many years,
the Accession.Version system is completely equivalent (and much more
human-readable).

  And given the shift to non-GI-based systems, the importance of using
Accession.Version identifiers cannot be overstated. So as an initial step, NCBI
will cease the display of GI identifiers in the flatfile and FASTA views of
all sequence records.

  Previously-assigned GI identifiers will continue to exist 'behind the scenes',
and NCBI services (including URLs, APIs, etc) which accept GIs as inputs/arguments
will be supported, for those sequence records that have GIs, for the foreseeable
future.

  Over the next year NCBI will identify all such services that do not yet
support Accession.Version identifiers, and add that support. Users of those
services will then be encouraged to make use of Accession.Version rather than GIs.
Of course, for those services that already support Accession.Version, NCBI
encourages users to begin transitioning away from GI as soon as is practical.

  In the sample record below, nucleotide sequence AF123456 has been assigned a
GI of 6633795, and the protein translation of its coding region feature has
been assigned a GI of 6633796 :

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2  GI:6633795
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /db_xref="GI:6633796"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  After June 15 2016, the GI value on the VERSION line and the GI /db_xref
qualifier for the coding region feature will no longer be displayed:

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  Similarly,  the GI value will be removed from the VERSION line of the GenPept
format. Currently:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1  GI:6633796
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

As of 06/15/2016:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

  Note that the coding region feature for GenPept format has never included
the display of nucleotide GI values.

For FASTA format, GI values will be removed from the FASTA header/defline:

Currently:

>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

As of 06/15/2016:

>gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

Please direct any inquiries about these changes to the NCBI Service Desk:

  info@ncbi.nlm.nih.gov

1.4.2 GI sequence identifiers are being phased out at NCBI

  The numeric GI sequence identifier that NCBI used to assign to all
nucleotide and protein sequences was first introduced for GenBank Release
products as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for over 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who
utilize GIs in their own information systems and analysis pipelines, so it is
being implemented gradually. Unannotated WGS projects consisting of millions
of contigs and scaffolds, and unannotated TSA projects, are the first two
classes of records for which GIs are no longer being assigned. But the practice
will ultimately expand to include other classes of records.

  If GIs are central to your operations, NCBI strongly urges that you begin
planning a switch to the use of Accession.Version identifiers instead.

  The contigs and scaffolds of the ALWZ04 WGS project are good examples of
sequences that lack GIs. Below are excerpts from the flatfile representation
of the first ALWZ04 contig, and the 'singleton scaffold' which is constructed
from it. Note the absence of a GI value on the VERSION line of these two
records:

LOCUS       ALWZ040000001           1191 bp    DNA     linear   PLN 13-MAR-2015
DEFINITION  Picea glauca, whole genome shotgun sequence.
ACCESSION   ALWZ040000001 ALWZ040000000
VERSION     ALWZ040000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
ORIGIN      
        1 ctataatacc cctatgccaa acgaacccaa ttgtaaatgt aaatgcaaat gtacttaggc
       61 tggttagttg tttaatatca ttttttgtat gcaccttcca tggtataatg cgcacatgta
      121 tagcgcacta aaattatgaa gtgtgcccat tccaagatat tgcgcgtaaa aaacttaagt
      181 gtgcatgatt ttgagactag ggagactttg tgtatatgtt gtgttttata tgctggagag
      241 acaattatta ttagttagga ggattatgtt ttgtactagg caagagagcc tagatgttaa
      301 aggctagtga gcctattttt gtatatgtct catcattaat ataatacatc attgtgtgta
....
      901 ttgttgggaa ttgatttcct gaatgtgtta aactgcattg atagggatct gagaattcct
      961 ttctggccta ttgctgaagc tttggaaggg aggtggggca accgagggac tgttgagaag
     1021 agaagggtca cacttcctgg ggtgggacaa gcatgtgggg aattagggat tgcaggatgt
     1081 tagtttgaat tggcacctat gacagagtct ttcctattgt ctgagatatg tcagcttggt
     1141 taggaaaccc tttacctggg tagagtttag tcccagctcg ggggtgaccc a
//

LOCUS       ALWZ04S0000001          1191 bp    DNA     linear   CON 13-MAR-2015
DEFINITION  Picea glauca Pg-01r141201s0000001, whole genome shotgun sequence.
ACCESSION   ALWZ04S0000001 ALWZ0400000000
VERSION     ALWZ04S0000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
CONTIG      join(ALWZ040000001.1:1..1191)
//

Sample URLs from which ALWZ04 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.*.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.*.gbff.gz

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2392 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct19.seq - Bacterial sequence entries, part 19.
100. gbbct2.seq - Bacterial sequence entries, part 2.
101. gbbct20.seq - Bacterial sequence entries, part 20.
102. gbbct21.seq - Bacterial sequence entries, part 21.
103. gbbct22.seq - Bacterial sequence entries, part 22.
104. gbbct23.seq - Bacterial sequence entries, part 23.
105. gbbct24.seq - Bacterial sequence entries, part 24.
106. gbbct25.seq - Bacterial sequence entries, part 25.
107. gbbct26.seq - Bacterial sequence entries, part 26.
108. gbbct27.seq - Bacterial sequence entries, part 27.
109. gbbct28.seq - Bacterial sequence entries, part 28.
110. gbbct29.seq - Bacterial sequence entries, part 29.
111. gbbct3.seq - Bacterial sequence entries, part 3.
112. gbbct30.seq - Bacterial sequence entries, part 30.
113. gbbct31.seq - Bacterial sequence entries, part 31.
114. gbbct32.seq - Bacterial sequence entries, part 32.
115. gbbct33.seq - Bacterial sequence entries, part 33.
116. gbbct34.seq - Bacterial sequence entries, part 34.
117. gbbct35.seq - Bacterial sequence entries, part 35.
118. gbbct36.seq - Bacterial sequence entries, part 36.
119. gbbct37.seq - Bacterial sequence entries, part 37.
120. gbbct38.seq - Bacterial sequence entries, part 38.
121. gbbct39.seq - Bacterial sequence entries, part 39.
122. gbbct4.seq - Bacterial sequence entries, part 4.
123. gbbct40.seq - Bacterial sequence entries, part 40.
124. gbbct41.seq - Bacterial sequence entries, part 41.
125. gbbct42.seq - Bacterial sequence entries, part 42.
126. gbbct43.seq - Bacterial sequence entries, part 43.
127. gbbct44.seq - Bacterial sequence entries, part 44.
128. gbbct45.seq - Bacterial sequence entries, part 45.
129. gbbct46.seq - Bacterial sequence entries, part 46.
130. gbbct47.seq - Bacterial sequence entries, part 47.
131. gbbct48.seq - Bacterial sequence entries, part 48.
132. gbbct49.seq - Bacterial sequence entries, part 49.
133. gbbct5.seq - Bacterial sequence entries, part 5.
134. gbbct50.seq - Bacterial sequence entries, part 50.
135. gbbct51.seq - Bacterial sequence entries, part 51.
136. gbbct52.seq - Bacterial sequence entries, part 52.
137. gbbct53.seq - Bacterial sequence entries, part 53.
138. gbbct54.seq - Bacterial sequence entries, part 54.
139. gbbct55.seq - Bacterial sequence entries, part 55.
140. gbbct56.seq - Bacterial sequence entries, part 56.
141. gbbct57.seq - Bacterial sequence entries, part 57.
142. gbbct58.seq - Bacterial sequence entries, part 58.
143. gbbct59.seq - Bacterial sequence entries, part 59.
144. gbbct6.seq - Bacterial sequence entries, part 6.
145. gbbct60.seq - Bacterial sequence entries, part 60.
146. gbbct61.seq - Bacterial sequence entries, part 61.
147. gbbct62.seq - Bacterial sequence entries, part 62.
148. gbbct63.seq - Bacterial sequence entries, part 63.
149. gbbct64.seq - Bacterial sequence entries, part 64.
150. gbbct65.seq - Bacterial sequence entries, part 65.
151. gbbct66.seq - Bacterial sequence entries, part 66.
152. gbbct67.seq - Bacterial sequence entries, part 67.
153. gbbct68.seq - Bacterial sequence entries, part 68.
154. gbbct69.seq - Bacterial sequence entries, part 69.
155. gbbct7.seq - Bacterial sequence entries, part 7.
156. gbbct70.seq - Bacterial sequence entries, part 70.
157. gbbct71.seq - Bacterial sequence entries, part 71.
158. gbbct72.seq - Bacterial sequence entries, part 72.
159. gbbct73.seq - Bacterial sequence entries, part 73.
160. gbbct74.seq - Bacterial sequence entries, part 74.
161. gbbct75.seq - Bacterial sequence entries, part 75.
162. gbbct76.seq - Bacterial sequence entries, part 76.
163. gbbct77.seq - Bacterial sequence entries, part 77.
164. gbbct78.seq - Bacterial sequence entries, part 78.
165. gbbct79.seq - Bacterial sequence entries, part 79.
166. gbbct8.seq - Bacterial sequence entries, part 8.
167. gbbct80.seq - Bacterial sequence entries, part 80.
168. gbbct81.seq - Bacterial sequence entries, part 81.
169. gbbct82.seq - Bacterial sequence entries, part 82.
170. gbbct83.seq - Bacterial sequence entries, part 83.
171. gbbct84.seq - Bacterial sequence entries, part 84.
172. gbbct85.seq - Bacterial sequence entries, part 85.
173. gbbct86.seq - Bacterial sequence entries, part 86.
174. gbbct87.seq - Bacterial sequence entries, part 87.
175. gbbct88.seq - Bacterial sequence entries, part 88.
176. gbbct89.seq - Bacterial sequence entries, part 89.
177. gbbct9.seq - Bacterial sequence entries, part 9.
178. gbbct90.seq - Bacterial sequence entries, part 90.
179. gbbct91.seq - Bacterial sequence entries, part 91.
180. gbbct92.seq - Bacterial sequence entries, part 92.
181. gbbct93.seq - Bacterial sequence entries, part 93.
182. gbbct94.seq - Bacterial sequence entries, part 94.
183. gbbct95.seq - Bacterial sequence entries, part 95.
184. gbbct96.seq - Bacterial sequence entries, part 96.
185. gbbct97.seq - Bacterial sequence entries, part 97.
186. gbbct98.seq - Bacterial sequence entries, part 98.
187. gbbct99.seq - Bacterial sequence entries, part 99.
188. gbchg.txt - Accession numbers of entries updated since the previous release.
189. gbcon1.seq - Constructed sequence entries, part 1.
190. gbcon10.seq - Constructed sequence entries, part 10.
191. gbcon100.seq - Constructed sequence entries, part 100.
192. gbcon101.seq - Constructed sequence entries, part 101.
193. gbcon102.seq - Constructed sequence entries, part 102.
194. gbcon103.seq - Constructed sequence entries, part 103.
195. gbcon104.seq - Constructed sequence entries, part 104.
196. gbcon105.seq - Constructed sequence entries, part 105.
197. gbcon106.seq - Constructed sequence entries, part 106.
198. gbcon107.seq - Constructed sequence entries, part 107.
199. gbcon108.seq - Constructed sequence entries, part 108.
200. gbcon109.seq - Constructed sequence entries, part 109.
201. gbcon11.seq - Constructed sequence entries, part 11.
202. gbcon110.seq - Constructed sequence entries, part 110.
203. gbcon111.seq - Constructed sequence entries, part 111.
204. gbcon112.seq - Constructed sequence entries, part 112.
205. gbcon113.seq - Constructed sequence entries, part 113.
206. gbcon114.seq - Constructed sequence entries, part 114.
207. gbcon115.seq - Constructed sequence entries, part 115.
208. gbcon116.seq - Constructed sequence entries, part 116.
209. gbcon117.seq - Constructed sequence entries, part 117.
210. gbcon118.seq - Constructed sequence entries, part 118.
211. gbcon119.seq - Constructed sequence entries, part 119.
212. gbcon12.seq - Constructed sequence entries, part 12.
213. gbcon120.seq - Constructed sequence entries, part 120.
214. gbcon121.seq - Constructed sequence entries, part 121.
215. gbcon122.seq - Constructed sequence entries, part 122.
216. gbcon123.seq - Constructed sequence entries, part 123.
217. gbcon124.seq - Constructed sequence entries, part 124.
218. gbcon125.seq - Constructed sequence entries, part 125.
219. gbcon126.seq - Constructed sequence entries, part 126.
220. gbcon127.seq - Constructed sequence entries, part 127.
221. gbcon128.seq - Constructed sequence entries, part 128.
222. gbcon129.seq - Constructed sequence entries, part 129.
223. gbcon13.seq - Constructed sequence entries, part 13.
224. gbcon130.seq - Constructed sequence entries, part 130.
225. gbcon131.seq - Constructed sequence entries, part 131.
226. gbcon132.seq - Constructed sequence entries, part 132.
227. gbcon133.seq - Constructed sequence entries, part 133.
228. gbcon134.seq - Constructed sequence entries, part 134.
229. gbcon135.seq - Constructed sequence entries, part 135.
230. gbcon136.seq - Constructed sequence entries, part 136.
231. gbcon137.seq - Constructed sequence entries, part 137.
232. gbcon138.seq - Constructed sequence entries, part 138.
233. gbcon139.seq - Constructed sequence entries, part 139.
234. gbcon14.seq - Constructed sequence entries, part 14.
235. gbcon140.seq - Constructed sequence entries, part 140.
236. gbcon141.seq - Constructed sequence entries, part 141.
237. gbcon142.seq - Constructed sequence entries, part 142.
238. gbcon143.seq - Constructed sequence entries, part 143.
239. gbcon144.seq - Constructed sequence entries, part 144.
240. gbcon145.seq - Constructed sequence entries, part 145.
241. gbcon146.seq - Constructed sequence entries, part 146.
242. gbcon147.seq - Constructed sequence entries, part 147.
243. gbcon148.seq - Constructed sequence entries, part 148.
244. gbcon149.seq - Constructed sequence entries, part 149.
245. gbcon15.seq - Constructed sequence entries, part 15.
246. gbcon150.seq - Constructed sequence entries, part 150.
247. gbcon151.seq - Constructed sequence entries, part 151.
248. gbcon152.seq - Constructed sequence entries, part 152.
249. gbcon153.seq - Constructed sequence entries, part 153.
250. gbcon154.seq - Constructed sequence entries, part 154.
251. gbcon155.seq - Constructed sequence entries, part 155.
252. gbcon156.seq - Constructed sequence entries, part 156.
253. gbcon157.seq - Constructed sequence entries, part 157.
254. gbcon158.seq - Constructed sequence entries, part 158.
255. gbcon159.seq - Constructed sequence entries, part 159.
256. gbcon16.seq - Constructed sequence entries, part 16.
257. gbcon160.seq - Constructed sequence entries, part 160.
258. gbcon161.seq - Constructed sequence entries, part 161.
259. gbcon162.seq - Constructed sequence entries, part 162.
260. gbcon163.seq - Constructed sequence entries, part 163.
261. gbcon164.seq - Constructed sequence entries, part 164.
262. gbcon165.seq - Constructed sequence entries, part 165.
263. gbcon166.seq - Constructed sequence entries, part 166.
264. gbcon167.seq - Constructed sequence entries, part 167.
265. gbcon168.seq - Constructed sequence entries, part 168.
266. gbcon169.seq - Constructed sequence entries, part 169.
267. gbcon17.seq - Constructed sequence entries, part 17.
268. gbcon170.seq - Constructed sequence entries, part 170.
269. gbcon171.seq - Constructed sequence entries, part 171.
270. gbcon172.seq - Constructed sequence entries, part 172.
271. gbcon173.seq - Constructed sequence entries, part 173.
272. gbcon174.seq - Constructed sequence entries, part 174.
273. gbcon175.seq - Constructed sequence entries, part 175.
274. gbcon176.seq - Constructed sequence entries, part 176.
275. gbcon177.seq - Constructed sequence entries, part 177.
276. gbcon178.seq - Constructed sequence entries, part 178.
277. gbcon179.seq - Constructed sequence entries, part 179.
278. gbcon18.seq - Constructed sequence entries, part 18.
279. gbcon180.seq - Constructed sequence entries, part 180.
280. gbcon181.seq - Constructed sequence entries, part 181.
281. gbcon182.seq - Constructed sequence entries, part 182.
282. gbcon183.seq - Constructed sequence entries, part 183.
283. gbcon184.seq - Constructed sequence entries, part 184.
284. gbcon185.seq - Constructed sequence entries, part 185.
285. gbcon186.seq - Constructed sequence entries, part 186.
286. gbcon187.seq - Constructed sequence entries, part 187.
287. gbcon188.seq - Constructed sequence entries, part 188.
288. gbcon189.seq - Constructed sequence entries, part 189.
289. gbcon19.seq - Constructed sequence entries, part 19.
290. gbcon190.seq - Constructed sequence entries, part 190.
291. gbcon191.seq - Constructed sequence entries, part 191.
292. gbcon192.seq - Constructed sequence entries, part 192.
293. gbcon193.seq - Constructed sequence entries, part 193.
294. gbcon194.seq - Constructed sequence entries, part 194.
295. gbcon195.seq - Constructed sequence entries, part 195.
296. gbcon196.seq - Constructed sequence entries, part 196.
297. gbcon197.seq - Constructed sequence entries, part 197.
298. gbcon198.seq - Constructed sequence entries, part 198.
299. gbcon199.seq - Constructed sequence entries, part 199.
300. gbcon2.seq - Constructed sequence entries, part 2.
301. gbcon20.seq - Constructed sequence entries, part 20.
302. gbcon200.seq - Constructed sequence entries, part 200.
303. gbcon201.seq - Constructed sequence entries, part 201.
304. gbcon202.seq - Constructed sequence entries, part 202.
305. gbcon203.seq - Constructed sequence entries, part 203.
306. gbcon204.seq - Constructed sequence entries, part 204.
307. gbcon205.seq - Constructed sequence entries, part 205.
308. gbcon206.seq - Constructed sequence entries, part 206.
309. gbcon207.seq - Constructed sequence entries, part 207.
310. gbcon208.seq - Constructed sequence entries, part 208.
311. gbcon209.seq - Constructed sequence entries, part 209.
312. gbcon21.seq - Constructed sequence entries, part 21.
313. gbcon210.seq - Constructed sequence entries, part 210.
314. gbcon211.seq - Constructed sequence entries, part 211.
315. gbcon212.seq - Constructed sequence entries, part 212.
316. gbcon213.seq - Constructed sequence entries, part 213.
317. gbcon214.seq - Constructed sequence entries, part 214.
318. gbcon215.seq - Constructed sequence entries, part 215.
319. gbcon216.seq - Constructed sequence entries, part 216.
320. gbcon217.seq - Constructed sequence entries, part 217.
321. gbcon218.seq - Constructed sequence entries, part 218.
322. gbcon219.seq - Constructed sequence entries, part 219.
323. gbcon22.seq - Constructed sequence entries, part 22.
324. gbcon220.seq - Constructed sequence entries, part 220.
325. gbcon221.seq - Constructed sequence entries, part 221.
326. gbcon222.seq - Constructed sequence entries, part 222.
327. gbcon223.seq - Constructed sequence entries, part 223.
328. gbcon224.seq - Constructed sequence entries, part 224.
329. gbcon225.seq - Constructed sequence entries, part 225.
330. gbcon226.seq - Constructed sequence entries, part 226.
331. gbcon227.seq - Constructed sequence entries, part 227.
332. gbcon228.seq - Constructed sequence entries, part 228.
333. gbcon229.seq - Constructed sequence entries, part 229.
334. gbcon23.seq - Constructed sequence entries, part 23.
335. gbcon230.seq - Constructed sequence entries, part 230.
336. gbcon231.seq - Constructed sequence entries, part 231.
337. gbcon232.seq - Constructed sequence entries, part 232.
338. gbcon233.seq - Constructed sequence entries, part 233.
339. gbcon234.seq - Constructed sequence entries, part 234.
340. gbcon235.seq - Constructed sequence entries, part 235.
341. gbcon236.seq - Constructed sequence entries, part 236.
342. gbcon237.seq - Constructed sequence entries, part 237.
343. gbcon238.seq - Constructed sequence entries, part 238.
344. gbcon239.seq - Constructed sequence entries, part 239.
345. gbcon24.seq - Constructed sequence entries, part 24.
346. gbcon240.seq - Constructed sequence entries, part 240.
347. gbcon241.seq - Constructed sequence entries, part 241.
348. gbcon242.seq - Constructed sequence entries, part 242.
349. gbcon243.seq - Constructed sequence entries, part 243.
350. gbcon244.seq - Constructed sequence entries, part 244.
351. gbcon245.seq - Constructed sequence entries, part 245.
352. gbcon246.seq - Constructed sequence entries, part 246.
353. gbcon247.seq - Constructed sequence entries, part 247.
354. gbcon248.seq - Constructed sequence entries, part 248.
355. gbcon249.seq - Constructed sequence entries, part 249.
356. gbcon25.seq - Constructed sequence entries, part 25.
357. gbcon250.seq - Constructed sequence entries, part 250.
358. gbcon251.seq - Constructed sequence entries, part 251.
359. gbcon252.seq - Constructed sequence entries, part 252.
360. gbcon253.seq - Constructed sequence entries, part 253.
361. gbcon254.seq - Constructed sequence entries, part 254.
362. gbcon255.seq - Constructed sequence entries, part 255.
363. gbcon256.seq - Constructed sequence entries, part 256.
364. gbcon257.seq - Constructed sequence entries, part 257.
365. gbcon258.seq - Constructed sequence entries, part 258.
366. gbcon259.seq - Constructed sequence entries, part 259.
367. gbcon26.seq - Constructed sequence entries, part 26.
368. gbcon260.seq - Constructed sequence entries, part 260.
369. gbcon261.seq - Constructed sequence entries, part 261.
370. gbcon262.seq - Constructed sequence entries, part 262.
371. gbcon263.seq - Constructed sequence entries, part 263.
372. gbcon264.seq - Constructed sequence entries, part 264.
373. gbcon265.seq - Constructed sequence entries, part 265.
374. gbcon266.seq - Constructed sequence entries, part 266.
375. gbcon267.seq - Constructed sequence entries, part 267.
376. gbcon268.seq - Constructed sequence entries, part 268.
377. gbcon269.seq - Constructed sequence entries, part 269.
378. gbcon27.seq - Constructed sequence entries, part 27.
379. gbcon270.seq - Constructed sequence entries, part 270.
380. gbcon271.seq - Constructed sequence entries, part 271.
381. gbcon272.seq - Constructed sequence entries, part 272.
382. gbcon273.seq - Constructed sequence entries, part 273.
383. gbcon274.seq - Constructed sequence entries, part 274.
384. gbcon275.seq - Constructed sequence entries, part 275.
385. gbcon276.seq - Constructed sequence entries, part 276.
386. gbcon277.seq - Constructed sequence entries, part 277.
387. gbcon278.seq - Constructed sequence entries, part 278.
388. gbcon279.seq - Constructed sequence entries, part 279.
389. gbcon28.seq - Constructed sequence entries, part 28.
390. gbcon280.seq - Constructed sequence entries, part 280.
391. gbcon281.seq - Constructed sequence entries, part 281.
392. gbcon282.seq - Constructed sequence entries, part 282.
393. gbcon283.seq - Constructed sequence entries, part 283.
394. gbcon284.seq - Constructed sequence entries, part 284.
395. gbcon285.seq - Constructed sequence entries, part 285.
396. gbcon286.seq - Constructed sequence entries, part 286.
397. gbcon287.seq - Constructed sequence entries, part 287.
398. gbcon288.seq - Constructed sequence entries, part 288.
399. gbcon289.seq - Constructed sequence entries, part 289.
400. gbcon29.seq - Constructed sequence entries, part 29.
401. gbcon290.seq - Constructed sequence entries, part 290.
402. gbcon291.seq - Constructed sequence entries, part 291.
403. gbcon292.seq - Constructed sequence entries, part 292.
404. gbcon293.seq - Constructed sequence entries, part 293.
405. gbcon294.seq - Constructed sequence entries, part 294.
406. gbcon295.seq - Constructed sequence entries, part 295.
407. gbcon296.seq - Constructed sequence entries, part 296.
408. gbcon297.seq - Constructed sequence entries, part 297.
409. gbcon298.seq - Constructed sequence entries, part 298.
410. gbcon299.seq - Constructed sequence entries, part 299.
411. gbcon3.seq - Constructed sequence entries, part 3.
412. gbcon30.seq - Constructed sequence entries, part 30.
413. gbcon300.seq - Constructed sequence entries, part 300.
414. gbcon301.seq - Constructed sequence entries, part 301.
415. gbcon302.seq - Constructed sequence entries, part 302.
416. gbcon303.seq - Constructed sequence entries, part 303.
417. gbcon304.seq - Constructed sequence entries, part 304.
418. gbcon305.seq - Constructed sequence entries, part 305.
419. gbcon306.seq - Constructed sequence entries, part 306.
420. gbcon307.seq - Constructed sequence entries, part 307.
421. gbcon308.seq - Constructed sequence entries, part 308.
422. gbcon309.seq - Constructed sequence entries, part 309.
423. gbcon31.seq - Constructed sequence entries, part 31.
424. gbcon310.seq - Constructed sequence entries, part 310.
425. gbcon311.seq - Constructed sequence entries, part 311.
426. gbcon312.seq - Constructed sequence entries, part 312.
427. gbcon313.seq - Constructed sequence entries, part 313.
428. gbcon314.seq - Constructed sequence entries, part 314.
429. gbcon315.seq - Constructed sequence entries, part 315.
430. gbcon316.seq - Constructed sequence entries, part 316.
431. gbcon317.seq - Constructed sequence entries, part 317.
432. gbcon318.seq - Constructed sequence entries, part 318.
433. gbcon319.seq - Constructed sequence entries, part 319.
434. gbcon32.seq - Constructed sequence entries, part 32.
435. gbcon33.seq - Constructed sequence entries, part 33.
436. gbcon34.seq - Constructed sequence entries, part 34.
437. gbcon35.seq - Constructed sequence entries, part 35.
438. gbcon36.seq - Constructed sequence entries, part 36.
439. gbcon37.seq - Constructed sequence entries, part 37.
440. gbcon38.seq - Constructed sequence entries, part 38.
441. gbcon39.seq - Constructed sequence entries, part 39.
442. gbcon4.seq - Constructed sequence entries, part 4.
443. gbcon40.seq - Constructed sequence entries, part 40.
444. gbcon41.seq - Constructed sequence entries, part 41.
445. gbcon42.seq - Constructed sequence entries, part 42.
446. gbcon43.seq - Constructed sequence entries, part 43.
447. gbcon44.seq - Constructed sequence entries, part 44.
448. gbcon45.seq - Constructed sequence entries, part 45.
449. gbcon46.seq - Constructed sequence entries, part 46.
450. gbcon47.seq - Constructed sequence entries, part 47.
451. gbcon48.seq - Constructed sequence entries, part 48.
452. gbcon49.seq - Constructed sequence entries, part 49.
453. gbcon5.seq - Constructed sequence entries, part 5.
454. gbcon50.seq - Constructed sequence entries, part 50.
455. gbcon51.seq - Constructed sequence entries, part 51.
456. gbcon52.seq - Constructed sequence entries, part 52.
457. gbcon53.seq - Constructed sequence entries, part 53.
458. gbcon54.seq - Constructed sequence entries, part 54.
459. gbcon55.seq - Constructed sequence entries, part 55.
460. gbcon56.seq - Constructed sequence entries, part 56.
461. gbcon57.seq - Constructed sequence entries, part 57.
462. gbcon58.seq - Constructed sequence entries, part 58.
463. gbcon59.seq - Constructed sequence entries, part 59.
464. gbcon6.seq - Constructed sequence entries, part 6.
465. gbcon60.seq - Constructed sequence entries, part 60.
466. gbcon61.seq - Constructed sequence entries, part 61.
467. gbcon62.seq - Constructed sequence entries, part 62.
468. gbcon63.seq - Constructed sequence entries, part 63.
469. gbcon64.seq - Constructed sequence entries, part 64.
470. gbcon65.seq - Constructed sequence entries, part 65.
471. gbcon66.seq - Constructed sequence entries, part 66.
472. gbcon67.seq - Constructed sequence entries, part 67.
473. gbcon68.seq - Constructed sequence entries, part 68.
474. gbcon69.seq - Constructed sequence entries, part 69.
475. gbcon7.seq - Constructed sequence entries, part 7.
476. gbcon70.seq - Constructed sequence entries, part 70.
477. gbcon71.seq - Constructed sequence entries, part 71.
478. gbcon72.seq - Constructed sequence entries, part 72.
479. gbcon73.seq - Constructed sequence entries, part 73.
480. gbcon74.seq - Constructed sequence entries, part 74.
481. gbcon75.seq - Constructed sequence entries, part 75.
482. gbcon76.seq - Constructed sequence entries, part 76.
483. gbcon77.seq - Constructed sequence entries, part 77.
484. gbcon78.seq - Constructed sequence entries, part 78.
485. gbcon79.seq - Constructed sequence entries, part 79.
486. gbcon8.seq - Constructed sequence entries, part 8.
487. gbcon80.seq - Constructed sequence entries, part 80.
488. gbcon81.seq - Constructed sequence entries, part 81.
489. gbcon82.seq - Constructed sequence entries, part 82.
490. gbcon83.seq - Constructed sequence entries, part 83.
491. gbcon84.seq - Constructed sequence entries, part 84.
492. gbcon85.seq - Constructed sequence entries, part 85.
493. gbcon86.seq - Constructed sequence entries, part 86.
494. gbcon87.seq - Constructed sequence entries, part 87.
495. gbcon88.seq - Constructed sequence entries, part 88.
496. gbcon89.seq - Constructed sequence entries, part 89.
497. gbcon9.seq - Constructed sequence entries, part 9.
498. gbcon90.seq - Constructed sequence entries, part 90.
499. gbcon91.seq - Constructed sequence entries, part 91.
500. gbcon92.seq - Constructed sequence entries, part 92.
501. gbcon93.seq - Constructed sequence entries, part 93.
502. gbcon94.seq - Constructed sequence entries, part 94.
503. gbcon95.seq - Constructed sequence entries, part 95.
504. gbcon96.seq - Constructed sequence entries, part 96.
505. gbcon97.seq - Constructed sequence entries, part 97.
506. gbcon98.seq - Constructed sequence entries, part 98.
507. gbcon99.seq - Constructed sequence entries, part 99.
508. gbdel.txt - Accession numbers of entries deleted since the previous release.
509. gbenv1.seq - Environmental sampling sequence entries, part 1.
510. gbenv10.seq - Environmental sampling sequence entries, part 10.
511. gbenv11.seq - Environmental sampling sequence entries, part 11.
512. gbenv12.seq - Environmental sampling sequence entries, part 12.
513. gbenv13.seq - Environmental sampling sequence entries, part 13.
514. gbenv14.seq - Environmental sampling sequence entries, part 14.
515. gbenv15.seq - Environmental sampling sequence entries, part 15.
516. gbenv16.seq - Environmental sampling sequence entries, part 16.
517. gbenv17.seq - Environmental sampling sequence entries, part 17.
518. gbenv18.seq - Environmental sampling sequence entries, part 18.
519. gbenv19.seq - Environmental sampling sequence entries, part 19.
520. gbenv2.seq - Environmental sampling sequence entries, part 2.
521. gbenv20.seq - Environmental sampling sequence entries, part 20.
522. gbenv21.seq - Environmental sampling sequence entries, part 21.
523. gbenv22.seq - Environmental sampling sequence entries, part 22.
524. gbenv23.seq - Environmental sampling sequence entries, part 23.
525. gbenv24.seq - Environmental sampling sequence entries, part 24.
526. gbenv25.seq - Environmental sampling sequence entries, part 25.
527. gbenv26.seq - Environmental sampling sequence entries, part 26.
528. gbenv27.seq - Environmental sampling sequence entries, part 27.
529. gbenv28.seq - Environmental sampling sequence entries, part 28.
530. gbenv29.seq - Environmental sampling sequence entries, part 29.
531. gbenv3.seq - Environmental sampling sequence entries, part 3.
532. gbenv30.seq - Environmental sampling sequence entries, part 30.
533. gbenv31.seq - Environmental sampling sequence entries, part 31.
534. gbenv32.seq - Environmental sampling sequence entries, part 32.
535. gbenv33.seq - Environmental sampling sequence entries, part 33.
536. gbenv34.seq - Environmental sampling sequence entries, part 34.
537. gbenv35.seq - Environmental sampling sequence entries, part 35.
538. gbenv36.seq - Environmental sampling sequence entries, part 36.
539. gbenv37.seq - Environmental sampling sequence entries, part 37.
540. gbenv38.seq - Environmental sampling sequence entries, part 38.
541. gbenv39.seq - Environmental sampling sequence entries, part 39.
542. gbenv4.seq - Environmental sampling sequence entries, part 4.
543. gbenv40.seq - Environmental sampling sequence entries, part 40.
544. gbenv41.seq - Environmental sampling sequence entries, part 41.
545. gbenv42.seq - Environmental sampling sequence entries, part 42.
546. gbenv43.seq - Environmental sampling sequence entries, part 43.
547. gbenv44.seq - Environmental sampling sequence entries, part 44.
548. gbenv45.seq - Environmental sampling sequence entries, part 45.
549. gbenv46.seq - Environmental sampling sequence entries, part 46.
550. gbenv47.seq - Environmental sampling sequence entries, part 47.
551. gbenv48.seq - Environmental sampling sequence entries, part 48.
552. gbenv49.seq - Environmental sampling sequence entries, part 49.
553. gbenv5.seq - Environmental sampling sequence entries, part 5.
554. gbenv50.seq - Environmental sampling sequence entries, part 50.
555. gbenv51.seq - Environmental sampling sequence entries, part 51.
556. gbenv52.seq - Environmental sampling sequence entries, part 52.
557. gbenv53.seq - Environmental sampling sequence entries, part 53.
558. gbenv54.seq - Environmental sampling sequence entries, part 54.
559. gbenv55.seq - Environmental sampling sequence entries, part 55.
560. gbenv56.seq - Environmental sampling sequence entries, part 56.
561. gbenv57.seq - Environmental sampling sequence entries, part 57.
562. gbenv58.seq - Environmental sampling sequence entries, part 58.
563. gbenv59.seq - Environmental sampling sequence entries, part 59.
564. gbenv6.seq - Environmental sampling sequence entries, part 6.
565. gbenv60.seq - Environmental sampling sequence entries, part 60.
566. gbenv61.seq - Environmental sampling sequence entries, part 61.
567. gbenv62.seq - Environmental sampling sequence entries, part 62.
568. gbenv63.seq - Environmental sampling sequence entries, part 63.
569. gbenv64.seq - Environmental sampling sequence entries, part 64.
570. gbenv65.seq - Environmental sampling sequence entries, part 65.
571. gbenv66.seq - Environmental sampling sequence entries, part 66.
572. gbenv67.seq - Environmental sampling sequence entries, part 67.
573. gbenv68.seq - Environmental sampling sequence entries, part 68.
574. gbenv69.seq - Environmental sampling sequence entries, part 69.
575. gbenv7.seq - Environmental sampling sequence entries, part 7.
576. gbenv70.seq - Environmental sampling sequence entries, part 70.
577. gbenv71.seq - Environmental sampling sequence entries, part 71.
578. gbenv72.seq - Environmental sampling sequence entries, part 72.
579. gbenv73.seq - Environmental sampling sequence entries, part 73.
580. gbenv74.seq - Environmental sampling sequence entries, part 74.
581. gbenv75.seq - Environmental sampling sequence entries, part 75.
582. gbenv76.seq - Environmental sampling sequence entries, part 76.
583. gbenv77.seq - Environmental sampling sequence entries, part 77.
584. gbenv78.seq - Environmental sampling sequence entries, part 78.
585. gbenv79.seq - Environmental sampling sequence entries, part 79.
586. gbenv8.seq - Environmental sampling sequence entries, part 8.
587. gbenv80.seq - Environmental sampling sequence entries, part 80.
588. gbenv81.seq - Environmental sampling sequence entries, part 81.
589. gbenv9.seq - Environmental sampling sequence entries, part 9.
590. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
591. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
592. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
593. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
594. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
595. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
596. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
597. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
598. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
599. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
600. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
601. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
602. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
603. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
604. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
605. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
606. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
607. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
608. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
609. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
610. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
611. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
612. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
613. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
614. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
615. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
616. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
617. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
618. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
619. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
620. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
621. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
622. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
623. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
624. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
625. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
626. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
627. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
628. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
629. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
630. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
631. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
632. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
633. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
634. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
635. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
636. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
637. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
638. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
639. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
640. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
641. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
642. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
643. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
644. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
645. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
646. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
647. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
648. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
649. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
650. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
651. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
652. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
653. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
654. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
655. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
656. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
657. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
658. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
659. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
660. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
661. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
662. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
663. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
664. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
665. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
666. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
667. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
668. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
669. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
670. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
671. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
672. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
673. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
674. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
675. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
676. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
677. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
678. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
679. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
680. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
681. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
682. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
683. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
684. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
685. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
686. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
687. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
688. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
689. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
690. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
691. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
692. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
693. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
694. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
695. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
696. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
697. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
698. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
699. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
700. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
701. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
702. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
703. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
704. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
705. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
706. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
707. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
708. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
709. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
710. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
711. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
712. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
713. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
714. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
715. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
716. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
717. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
718. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
719. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
720. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
721. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
722. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
723. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
724. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
725. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
726. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
727. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
728. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
729. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
730. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
731. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
732. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
733. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
734. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
735. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
736. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
737. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
738. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
739. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
740. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
741. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
742. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
743. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
744. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
745. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
746. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
747. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
748. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
749. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
750. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
751. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
752. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
753. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
754. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
755. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
756. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
757. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
758. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
759. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
760. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
761. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
762. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
763. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
764. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
765. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
766. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
767. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
768. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
769. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
770. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
771. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
772. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
773. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
774. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
775. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
776. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
777. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
778. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
779. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
780. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
781. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
782. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
783. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
784. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
785. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
786. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
787. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
788. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
789. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
790. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
791. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
792. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
793. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
794. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
795. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
796. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
797. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
798. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
799. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
800. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
801. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
802. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
803. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
804. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
805. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
806. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
807. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
808. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
809. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
810. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
811. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
812. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
813. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
814. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
815. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
816. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
817. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
818. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
819. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
820. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
821. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
822. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
823. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
824. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
825. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
826. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
827. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
828. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
829. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
830. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
831. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
832. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
833. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
834. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
835. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
836. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
837. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
838. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
839. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
840. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
841. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
842. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
843. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
844. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
845. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
846. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
847. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
848. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
849. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
850. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
851. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
852. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
853. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
854. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
855. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
856. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
857. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
858. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
859. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
860. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
861. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
862. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
863. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
864. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
865. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
866. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
867. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
868. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
869. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
870. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
871. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
872. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
873. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
874. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
875. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
876. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
877. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
878. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
879. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
880. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
881. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
882. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
883. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
884. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
885. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
886. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
887. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
888. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
889. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
890. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
891. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
892. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
893. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
894. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
895. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
896. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
897. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
898. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
899. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
900. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
901. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
902. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
903. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
904. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
905. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
906. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
907. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
908. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
909. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
910. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
911. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
912. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
913. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
914. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
915. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
916. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
917. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
918. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
919. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
920. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
921. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
922. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
923. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
924. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
925. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
926. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
927. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
928. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
929. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
930. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
931. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
932. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
933. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
934. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
935. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
936. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
937. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
938. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
939. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
940. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
941. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
942. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
943. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
944. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
945. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
946. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
947. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
948. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
949. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
950. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
951. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
952. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
953. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
954. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
955. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
956. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
957. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
958. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
959. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
960. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
961. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
962. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
963. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
964. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
965. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
966. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
967. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
968. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
969. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
970. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
971. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
972. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
973. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
974. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
975. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
976. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
977. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
978. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
979. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
980. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
981. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
982. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
983. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
984. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
985. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
986. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
987. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
988. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
989. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
990. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
991. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
992. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
993. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
994. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
995. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
996. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
997. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
998. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
999. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1000. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1001. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1002. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1003. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1004. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1005. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1006. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1007. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1008. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1009. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1010. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1011. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1012. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1013. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1014. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1015. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1016. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1017. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1018. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1019. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1020. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1021. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1022. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1023. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1024. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1025. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1026. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1027. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1028. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1029. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1030. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1031. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1032. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1033. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1034. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1035. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1036. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1037. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1038. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1039. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1040. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1041. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1042. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1043. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1044. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1045. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1046. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1047. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1048. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1049. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1050. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1051. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1052. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1053. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1054. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1055. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1056. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1057. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1058. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1059. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1060. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1061. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1062. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1063. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1064. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1065. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1066. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1067. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1068. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1069. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1070. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1071. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1072. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1073. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1074. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1075. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1076. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1077. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1078. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1079. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1080. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1081. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1082. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1083. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1084. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1085. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1086. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1087. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1088. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1089. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1090. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1091. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1092. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1093. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1094. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1095. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1096. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1097. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1098. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1099. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1100. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1101. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1102. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1103. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1104. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1105. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1106. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1107. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1108. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1109. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1110. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1111. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1112. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1113. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1114. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1115. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1116. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1117. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1118. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1119. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1120. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1121. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1122. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1123. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1124. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1125. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1126. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1127. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1128. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1129. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1130. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1131. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1132. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1133. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1134. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1135. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1136. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1137. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1138. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1139. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1140. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1141. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1142. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1143. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1144. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1145. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1146. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1147. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1148. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1149. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1150. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1151. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1152. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1153. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1154. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1155. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1156. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1157. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1158. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1159. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1160. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1161. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1162. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1163. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1164. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1165. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1166. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1167. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1168. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1169. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1170. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1171. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1172. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1173. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1174. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1175. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1176. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1177. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1178. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1179. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1180. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1181. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1182. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1183. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1184. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1185. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1186. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1187. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1188. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1189. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1190. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1191. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1192. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1193. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1194. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1195. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1196. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1197. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1198. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1199. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1200. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1201. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1202. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1203. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1204. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1205. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1206. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1207. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1208. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1209. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1210. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1211. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1212. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1213. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1214. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1215. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1216. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1217. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1218. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1219. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1220. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1221. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1222. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1223. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1224. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1225. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1226. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1227. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1228. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1229. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1230. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1231. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1232. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1233. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1234. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1235. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1236. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1237. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1238. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1239. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1240. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1241. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1242. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1243. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1244. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1245. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1246. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1247. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1248. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1249. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1250. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1251. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1252. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1253. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1254. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1255. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1256. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1257. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1258. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1259. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1260. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1261. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1262. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1263. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1264. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1265. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1266. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1267. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1268. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1269. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1270. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1271. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1272. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1273. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1274. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1275. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1276. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1277. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1278. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1279. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1280. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1281. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1282. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1283. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1284. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1285. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1286. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1287. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1288. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1289. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1290. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1291. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1292. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1293. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1294. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1295. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1296. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1297. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1298. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1299. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1300. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1301. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1302. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1303. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1304. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1305. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1306. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1307. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1308. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1309. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1310. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1311. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1312. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1313. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1314. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1315. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1316. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1317. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1318. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1319. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1320. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1321. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1322. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1323. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1324. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1325. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1326. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1327. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1328. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1329. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1330. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1331. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1332. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1333. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1334. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1335. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1336. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1337. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1338. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1339. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1340. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1341. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1342. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1343. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1344. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1345. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1346. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1347. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1348. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1349. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1350. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1351. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1352. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1353. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1354. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1355. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1356. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1357. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1358. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1359. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1360. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1361. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1362. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1363. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1364. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1365. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1366. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1367. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1368. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1369. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1370. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1371. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1372. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1373. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1374. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1375. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1376. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1377. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1378. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1379. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1380. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1381. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1382. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1383. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1384. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1385. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1386. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1387. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1388. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1389. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1390. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1391. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1392. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1393. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1394. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1395. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1396. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1397. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1398. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1399. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1400. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1401. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1402. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1403. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1404. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1405. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1406. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1407. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1408. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1409. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1410. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1411. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1412. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1413. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1414. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1415. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1416. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1417. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1418. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1419. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1420. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1421. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1422. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1423. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1424. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1425. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1426. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1427. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1428. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1429. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1430. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1431. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1432. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1433. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1434. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1435. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1436. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1437. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1438. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1439. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1440. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1441. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1442. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1443. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1444. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1445. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1446. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1447. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1448. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1449. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1450. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1451. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1452. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1453. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1454. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1455. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1456. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1457. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1458. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1459. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1460. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1461. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1462. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1463. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1464. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1465. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1466. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1467. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1468. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1469. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1470. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1471. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1472. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1473. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1474. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1475. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1476. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1477. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1478. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1479. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1480. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1481. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1482. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1483. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1484. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1485. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1486. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1487. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1488. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1489. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1490. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1491. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1492. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1493. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1494. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1495. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1496. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1497. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1498. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1499. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1500. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1501. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1502. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1503. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1504. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1505. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1506. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1507. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1508. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1509. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1510. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1511. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1512. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1513. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1514. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1515. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1516. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1517. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1518. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1519. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1520. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1521. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1522. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1523. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1524. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1525. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1526. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1527. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1528. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1529. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1530. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1531. gbinv1.seq - Invertebrate sequence entries, part 1.
1532. gbinv10.seq - Invertebrate sequence entries, part 10.
1533. gbinv100.seq - Invertebrate sequence entries, part 100.
1534. gbinv101.seq - Invertebrate sequence entries, part 101.
1535. gbinv102.seq - Invertebrate sequence entries, part 102.
1536. gbinv103.seq - Invertebrate sequence entries, part 103.
1537. gbinv104.seq - Invertebrate sequence entries, part 104.
1538. gbinv105.seq - Invertebrate sequence entries, part 105.
1539. gbinv106.seq - Invertebrate sequence entries, part 106.
1540. gbinv107.seq - Invertebrate sequence entries, part 107.
1541. gbinv108.seq - Invertebrate sequence entries, part 108.
1542. gbinv109.seq - Invertebrate sequence entries, part 109.
1543. gbinv11.seq - Invertebrate sequence entries, part 11.
1544. gbinv110.seq - Invertebrate sequence entries, part 110.
1545. gbinv111.seq - Invertebrate sequence entries, part 111.
1546. gbinv112.seq - Invertebrate sequence entries, part 112.
1547. gbinv113.seq - Invertebrate sequence entries, part 113.
1548. gbinv114.seq - Invertebrate sequence entries, part 114.
1549. gbinv115.seq - Invertebrate sequence entries, part 115.
1550. gbinv116.seq - Invertebrate sequence entries, part 116.
1551. gbinv117.seq - Invertebrate sequence entries, part 117.
1552. gbinv118.seq - Invertebrate sequence entries, part 118.
1553. gbinv119.seq - Invertebrate sequence entries, part 119.
1554. gbinv12.seq - Invertebrate sequence entries, part 12.
1555. gbinv120.seq - Invertebrate sequence entries, part 120.
1556. gbinv121.seq - Invertebrate sequence entries, part 121.
1557. gbinv122.seq - Invertebrate sequence entries, part 122.
1558. gbinv123.seq - Invertebrate sequence entries, part 123.
1559. gbinv124.seq - Invertebrate sequence entries, part 124.
1560. gbinv125.seq - Invertebrate sequence entries, part 125.
1561. gbinv126.seq - Invertebrate sequence entries, part 126.
1562. gbinv127.seq - Invertebrate sequence entries, part 127.
1563. gbinv128.seq - Invertebrate sequence entries, part 128.
1564. gbinv13.seq - Invertebrate sequence entries, part 13.
1565. gbinv14.seq - Invertebrate sequence entries, part 14.
1566. gbinv15.seq - Invertebrate sequence entries, part 15.
1567. gbinv16.seq - Invertebrate sequence entries, part 16.
1568. gbinv17.seq - Invertebrate sequence entries, part 17.
1569. gbinv18.seq - Invertebrate sequence entries, part 18.
1570. gbinv19.seq - Invertebrate sequence entries, part 19.
1571. gbinv2.seq - Invertebrate sequence entries, part 2.
1572. gbinv20.seq - Invertebrate sequence entries, part 20.
1573. gbinv21.seq - Invertebrate sequence entries, part 21.
1574. gbinv22.seq - Invertebrate sequence entries, part 22.
1575. gbinv23.seq - Invertebrate sequence entries, part 23.
1576. gbinv24.seq - Invertebrate sequence entries, part 24.
1577. gbinv25.seq - Invertebrate sequence entries, part 25.
1578. gbinv26.seq - Invertebrate sequence entries, part 26.
1579. gbinv27.seq - Invertebrate sequence entries, part 27.
1580. gbinv28.seq - Invertebrate sequence entries, part 28.
1581. gbinv29.seq - Invertebrate sequence entries, part 29.
1582. gbinv3.seq - Invertebrate sequence entries, part 3.
1583. gbinv30.seq - Invertebrate sequence entries, part 30.
1584. gbinv31.seq - Invertebrate sequence entries, part 31.
1585. gbinv32.seq - Invertebrate sequence entries, part 32.
1586. gbinv33.seq - Invertebrate sequence entries, part 33.
1587. gbinv34.seq - Invertebrate sequence entries, part 34.
1588. gbinv35.seq - Invertebrate sequence entries, part 35.
1589. gbinv36.seq - Invertebrate sequence entries, part 36.
1590. gbinv37.seq - Invertebrate sequence entries, part 37.
1591. gbinv38.seq - Invertebrate sequence entries, part 38.
1592. gbinv39.seq - Invertebrate sequence entries, part 39.
1593. gbinv4.seq - Invertebrate sequence entries, part 4.
1594. gbinv40.seq - Invertebrate sequence entries, part 40.
1595. gbinv41.seq - Invertebrate sequence entries, part 41.
1596. gbinv42.seq - Invertebrate sequence entries, part 42.
1597. gbinv43.seq - Invertebrate sequence entries, part 43.
1598. gbinv44.seq - Invertebrate sequence entries, part 44.
1599. gbinv45.seq - Invertebrate sequence entries, part 45.
1600. gbinv46.seq - Invertebrate sequence entries, part 46.
1601. gbinv47.seq - Invertebrate sequence entries, part 47.
1602. gbinv48.seq - Invertebrate sequence entries, part 48.
1603. gbinv49.seq - Invertebrate sequence entries, part 49.
1604. gbinv5.seq - Invertebrate sequence entries, part 5.
1605. gbinv50.seq - Invertebrate sequence entries, part 50.
1606. gbinv51.seq - Invertebrate sequence entries, part 51.
1607. gbinv52.seq - Invertebrate sequence entries, part 52.
1608. gbinv53.seq - Invertebrate sequence entries, part 53.
1609. gbinv54.seq - Invertebrate sequence entries, part 54.
1610. gbinv55.seq - Invertebrate sequence entries, part 55.
1611. gbinv56.seq - Invertebrate sequence entries, part 56.
1612. gbinv57.seq - Invertebrate sequence entries, part 57.
1613. gbinv58.seq - Invertebrate sequence entries, part 58.
1614. gbinv59.seq - Invertebrate sequence entries, part 59.
1615. gbinv6.seq - Invertebrate sequence entries, part 6.
1616. gbinv60.seq - Invertebrate sequence entries, part 60.
1617. gbinv61.seq - Invertebrate sequence entries, part 61.
1618. gbinv62.seq - Invertebrate sequence entries, part 62.
1619. gbinv63.seq - Invertebrate sequence entries, part 63.
1620. gbinv64.seq - Invertebrate sequence entries, part 64.
1621. gbinv65.seq - Invertebrate sequence entries, part 65.
1622. gbinv66.seq - Invertebrate sequence entries, part 66.
1623. gbinv67.seq - Invertebrate sequence entries, part 67.
1624. gbinv68.seq - Invertebrate sequence entries, part 68.
1625. gbinv69.seq - Invertebrate sequence entries, part 69.
1626. gbinv7.seq - Invertebrate sequence entries, part 7.
1627. gbinv70.seq - Invertebrate sequence entries, part 70.
1628. gbinv71.seq - Invertebrate sequence entries, part 71.
1629. gbinv72.seq - Invertebrate sequence entries, part 72.
1630. gbinv73.seq - Invertebrate sequence entries, part 73.
1631. gbinv74.seq - Invertebrate sequence entries, part 74.
1632. gbinv75.seq - Invertebrate sequence entries, part 75.
1633. gbinv76.seq - Invertebrate sequence entries, part 76.
1634. gbinv77.seq - Invertebrate sequence entries, part 77.
1635. gbinv78.seq - Invertebrate sequence entries, part 78.
1636. gbinv79.seq - Invertebrate sequence entries, part 79.
1637. gbinv8.seq - Invertebrate sequence entries, part 8.
1638. gbinv80.seq - Invertebrate sequence entries, part 80.
1639. gbinv81.seq - Invertebrate sequence entries, part 81.
1640. gbinv82.seq - Invertebrate sequence entries, part 82.
1641. gbinv83.seq - Invertebrate sequence entries, part 83.
1642. gbinv84.seq - Invertebrate sequence entries, part 84.
1643. gbinv85.seq - Invertebrate sequence entries, part 85.
1644. gbinv86.seq - Invertebrate sequence entries, part 86.
1645. gbinv87.seq - Invertebrate sequence entries, part 87.
1646. gbinv88.seq - Invertebrate sequence entries, part 88.
1647. gbinv89.seq - Invertebrate sequence entries, part 89.
1648. gbinv9.seq - Invertebrate sequence entries, part 9.
1649. gbinv90.seq - Invertebrate sequence entries, part 90.
1650. gbinv91.seq - Invertebrate sequence entries, part 91.
1651. gbinv92.seq - Invertebrate sequence entries, part 92.
1652. gbinv93.seq - Invertebrate sequence entries, part 93.
1653. gbinv94.seq - Invertebrate sequence entries, part 94.
1654. gbinv95.seq - Invertebrate sequence entries, part 95.
1655. gbinv96.seq - Invertebrate sequence entries, part 96.
1656. gbinv97.seq - Invertebrate sequence entries, part 97.
1657. gbinv98.seq - Invertebrate sequence entries, part 98.
1658. gbinv99.seq - Invertebrate sequence entries, part 99.
1659. gbmam1.seq - Other mammalian sequence entries, part 1.
1660. gbmam2.seq - Other mammalian sequence entries, part 2.
1661. gbmam3.seq - Other mammalian sequence entries, part 3.
1662. gbmam4.seq - Other mammalian sequence entries, part 4.
1663. gbmam5.seq - Other mammalian sequence entries, part 5.
1664. gbmam6.seq - Other mammalian sequence entries, part 6.
1665. gbmam7.seq - Other mammalian sequence entries, part 7.
1666. gbmam8.seq - Other mammalian sequence entries, part 8.
1667. gbmam9.seq - Other mammalian sequence entries, part 9.
1668. gbnew.txt - Accession numbers of entries new since the previous release.
1669. gbpat1.seq - Patent sequence entries, part 1.
1670. gbpat10.seq - Patent sequence entries, part 10.
1671. gbpat100.seq - Patent sequence entries, part 100.
1672. gbpat101.seq - Patent sequence entries, part 101.
1673. gbpat102.seq - Patent sequence entries, part 102.
1674. gbpat103.seq - Patent sequence entries, part 103.
1675. gbpat104.seq - Patent sequence entries, part 104.
1676. gbpat105.seq - Patent sequence entries, part 105.
1677. gbpat106.seq - Patent sequence entries, part 106.
1678. gbpat107.seq - Patent sequence entries, part 107.
1679. gbpat108.seq - Patent sequence entries, part 108.
1680. gbpat109.seq - Patent sequence entries, part 109.
1681. gbpat11.seq - Patent sequence entries, part 11.
1682. gbpat110.seq - Patent sequence entries, part 110.
1683. gbpat111.seq - Patent sequence entries, part 111.
1684. gbpat112.seq - Patent sequence entries, part 112.
1685. gbpat113.seq - Patent sequence entries, part 113.
1686. gbpat114.seq - Patent sequence entries, part 114.
1687. gbpat115.seq - Patent sequence entries, part 115.
1688. gbpat116.seq - Patent sequence entries, part 116.
1689. gbpat117.seq - Patent sequence entries, part 117.
1690. gbpat118.seq - Patent sequence entries, part 118.
1691. gbpat119.seq - Patent sequence entries, part 119.
1692. gbpat12.seq - Patent sequence entries, part 12.
1693. gbpat120.seq - Patent sequence entries, part 120.
1694. gbpat121.seq - Patent sequence entries, part 121.
1695. gbpat122.seq - Patent sequence entries, part 122.
1696. gbpat123.seq - Patent sequence entries, part 123.
1697. gbpat124.seq - Patent sequence entries, part 124.
1698. gbpat125.seq - Patent sequence entries, part 125.
1699. gbpat126.seq - Patent sequence entries, part 126.
1700. gbpat127.seq - Patent sequence entries, part 127.
1701. gbpat128.seq - Patent sequence entries, part 128.
1702. gbpat129.seq - Patent sequence entries, part 129.
1703. gbpat13.seq - Patent sequence entries, part 13.
1704. gbpat130.seq - Patent sequence entries, part 130.
1705. gbpat131.seq - Patent sequence entries, part 131.
1706. gbpat132.seq - Patent sequence entries, part 132.
1707. gbpat133.seq - Patent sequence entries, part 133.
1708. gbpat134.seq - Patent sequence entries, part 134.
1709. gbpat135.seq - Patent sequence entries, part 135.
1710. gbpat136.seq - Patent sequence entries, part 136.
1711. gbpat137.seq - Patent sequence entries, part 137.
1712. gbpat138.seq - Patent sequence entries, part 138.
1713. gbpat139.seq - Patent sequence entries, part 139.
1714. gbpat14.seq - Patent sequence entries, part 14.
1715. gbpat140.seq - Patent sequence entries, part 140.
1716. gbpat141.seq - Patent sequence entries, part 141.
1717. gbpat142.seq - Patent sequence entries, part 142.
1718. gbpat143.seq - Patent sequence entries, part 143.
1719. gbpat144.seq - Patent sequence entries, part 144.
1720. gbpat145.seq - Patent sequence entries, part 145.
1721. gbpat146.seq - Patent sequence entries, part 146.
1722. gbpat147.seq - Patent sequence entries, part 147.
1723. gbpat148.seq - Patent sequence entries, part 148.
1724. gbpat149.seq - Patent sequence entries, part 149.
1725. gbpat15.seq - Patent sequence entries, part 15.
1726. gbpat150.seq - Patent sequence entries, part 150.
1727. gbpat151.seq - Patent sequence entries, part 151.
1728. gbpat152.seq - Patent sequence entries, part 152.
1729. gbpat153.seq - Patent sequence entries, part 153.
1730. gbpat154.seq - Patent sequence entries, part 154.
1731. gbpat155.seq - Patent sequence entries, part 155.
1732. gbpat156.seq - Patent sequence entries, part 156.
1733. gbpat157.seq - Patent sequence entries, part 157.
1734. gbpat158.seq - Patent sequence entries, part 158.
1735. gbpat159.seq - Patent sequence entries, part 159.
1736. gbpat16.seq - Patent sequence entries, part 16.
1737. gbpat160.seq - Patent sequence entries, part 160.
1738. gbpat161.seq - Patent sequence entries, part 161.
1739. gbpat162.seq - Patent sequence entries, part 162.
1740. gbpat163.seq - Patent sequence entries, part 163.
1741. gbpat164.seq - Patent sequence entries, part 164.
1742. gbpat165.seq - Patent sequence entries, part 165.
1743. gbpat166.seq - Patent sequence entries, part 166.
1744. gbpat167.seq - Patent sequence entries, part 167.
1745. gbpat168.seq - Patent sequence entries, part 168.
1746. gbpat169.seq - Patent sequence entries, part 169.
1747. gbpat17.seq - Patent sequence entries, part 17.
1748. gbpat170.seq - Patent sequence entries, part 170.
1749. gbpat171.seq - Patent sequence entries, part 171.
1750. gbpat172.seq - Patent sequence entries, part 172.
1751. gbpat173.seq - Patent sequence entries, part 173.
1752. gbpat174.seq - Patent sequence entries, part 174.
1753. gbpat175.seq - Patent sequence entries, part 175.
1754. gbpat176.seq - Patent sequence entries, part 176.
1755. gbpat177.seq - Patent sequence entries, part 177.
1756. gbpat178.seq - Patent sequence entries, part 178.
1757. gbpat179.seq - Patent sequence entries, part 179.
1758. gbpat18.seq - Patent sequence entries, part 18.
1759. gbpat180.seq - Patent sequence entries, part 180.
1760. gbpat181.seq - Patent sequence entries, part 181.
1761. gbpat182.seq - Patent sequence entries, part 182.
1762. gbpat183.seq - Patent sequence entries, part 183.
1763. gbpat184.seq - Patent sequence entries, part 184.
1764. gbpat185.seq - Patent sequence entries, part 185.
1765. gbpat186.seq - Patent sequence entries, part 186.
1766. gbpat187.seq - Patent sequence entries, part 187.
1767. gbpat188.seq - Patent sequence entries, part 188.
1768. gbpat189.seq - Patent sequence entries, part 189.
1769. gbpat19.seq - Patent sequence entries, part 19.
1770. gbpat190.seq - Patent sequence entries, part 190.
1771. gbpat191.seq - Patent sequence entries, part 191.
1772. gbpat192.seq - Patent sequence entries, part 192.
1773. gbpat193.seq - Patent sequence entries, part 193.
1774. gbpat194.seq - Patent sequence entries, part 194.
1775. gbpat195.seq - Patent sequence entries, part 195.
1776. gbpat196.seq - Patent sequence entries, part 196.
1777. gbpat197.seq - Patent sequence entries, part 197.
1778. gbpat198.seq - Patent sequence entries, part 198.
1779. gbpat199.seq - Patent sequence entries, part 199.
1780. gbpat2.seq - Patent sequence entries, part 2.
1781. gbpat20.seq - Patent sequence entries, part 20.
1782. gbpat200.seq - Patent sequence entries, part 200.
1783. gbpat201.seq - Patent sequence entries, part 201.
1784. gbpat202.seq - Patent sequence entries, part 202.
1785. gbpat203.seq - Patent sequence entries, part 203.
1786. gbpat204.seq - Patent sequence entries, part 204.
1787. gbpat205.seq - Patent sequence entries, part 205.
1788. gbpat206.seq - Patent sequence entries, part 206.
1789. gbpat207.seq - Patent sequence entries, part 207.
1790. gbpat208.seq - Patent sequence entries, part 208.
1791. gbpat209.seq - Patent sequence entries, part 209.
1792. gbpat21.seq - Patent sequence entries, part 21.
1793. gbpat210.seq - Patent sequence entries, part 210.
1794. gbpat211.seq - Patent sequence entries, part 211.
1795. gbpat212.seq - Patent sequence entries, part 212.
1796. gbpat213.seq - Patent sequence entries, part 213.
1797. gbpat214.seq - Patent sequence entries, part 214.
1798. gbpat215.seq - Patent sequence entries, part 215.
1799. gbpat216.seq - Patent sequence entries, part 216.
1800. gbpat217.seq - Patent sequence entries, part 217.
1801. gbpat218.seq - Patent sequence entries, part 218.
1802. gbpat219.seq - Patent sequence entries, part 219.
1803. gbpat22.seq - Patent sequence entries, part 22.
1804. gbpat220.seq - Patent sequence entries, part 220.
1805. gbpat221.seq - Patent sequence entries, part 221.
1806. gbpat222.seq - Patent sequence entries, part 222.
1807. gbpat223.seq - Patent sequence entries, part 223.
1808. gbpat23.seq - Patent sequence entries, part 23.
1809. gbpat24.seq - Patent sequence entries, part 24.
1810. gbpat25.seq - Patent sequence entries, part 25.
1811. gbpat26.seq - Patent sequence entries, part 26.
1812. gbpat27.seq - Patent sequence entries, part 27.
1813. gbpat28.seq - Patent sequence entries, part 28.
1814. gbpat29.seq - Patent sequence entries, part 29.
1815. gbpat3.seq - Patent sequence entries, part 3.
1816. gbpat30.seq - Patent sequence entries, part 30.
1817. gbpat31.seq - Patent sequence entries, part 31.
1818. gbpat32.seq - Patent sequence entries, part 32.
1819. gbpat33.seq - Patent sequence entries, part 33.
1820. gbpat34.seq - Patent sequence entries, part 34.
1821. gbpat35.seq - Patent sequence entries, part 35.
1822. gbpat36.seq - Patent sequence entries, part 36.
1823. gbpat37.seq - Patent sequence entries, part 37.
1824. gbpat38.seq - Patent sequence entries, part 38.
1825. gbpat39.seq - Patent sequence entries, part 39.
1826. gbpat4.seq - Patent sequence entries, part 4.
1827. gbpat40.seq - Patent sequence entries, part 40.
1828. gbpat41.seq - Patent sequence entries, part 41.
1829. gbpat42.seq - Patent sequence entries, part 42.
1830. gbpat43.seq - Patent sequence entries, part 43.
1831. gbpat44.seq - Patent sequence entries, part 44.
1832. gbpat45.seq - Patent sequence entries, part 45.
1833. gbpat46.seq - Patent sequence entries, part 46.
1834. gbpat47.seq - Patent sequence entries, part 47.
1835. gbpat48.seq - Patent sequence entries, part 48.
1836. gbpat49.seq - Patent sequence entries, part 49.
1837. gbpat5.seq - Patent sequence entries, part 5.
1838. gbpat50.seq - Patent sequence entries, part 50.
1839. gbpat51.seq - Patent sequence entries, part 51.
1840. gbpat52.seq - Patent sequence entries, part 52.
1841. gbpat53.seq - Patent sequence entries, part 53.
1842. gbpat54.seq - Patent sequence entries, part 54.
1843. gbpat55.seq - Patent sequence entries, part 55.
1844. gbpat56.seq - Patent sequence entries, part 56.
1845. gbpat57.seq - Patent sequence entries, part 57.
1846. gbpat58.seq - Patent sequence entries, part 58.
1847. gbpat59.seq - Patent sequence entries, part 59.
1848. gbpat6.seq - Patent sequence entries, part 6.
1849. gbpat60.seq - Patent sequence entries, part 60.
1850. gbpat61.seq - Patent sequence entries, part 61.
1851. gbpat62.seq - Patent sequence entries, part 62.
1852. gbpat63.seq - Patent sequence entries, part 63.
1853. gbpat64.seq - Patent sequence entries, part 64.
1854. gbpat65.seq - Patent sequence entries, part 65.
1855. gbpat66.seq - Patent sequence entries, part 66.
1856. gbpat67.seq - Patent sequence entries, part 67.
1857. gbpat68.seq - Patent sequence entries, part 68.
1858. gbpat69.seq - Patent sequence entries, part 69.
1859. gbpat7.seq - Patent sequence entries, part 7.
1860. gbpat70.seq - Patent sequence entries, part 70.
1861. gbpat71.seq - Patent sequence entries, part 71.
1862. gbpat72.seq - Patent sequence entries, part 72.
1863. gbpat73.seq - Patent sequence entries, part 73.
1864. gbpat74.seq - Patent sequence entries, part 74.
1865. gbpat75.seq - Patent sequence entries, part 75.
1866. gbpat76.seq - Patent sequence entries, part 76.
1867. gbpat77.seq - Patent sequence entries, part 77.
1868. gbpat78.seq - Patent sequence entries, part 78.
1869. gbpat79.seq - Patent sequence entries, part 79.
1870. gbpat8.seq - Patent sequence entries, part 8.
1871. gbpat80.seq - Patent sequence entries, part 80.
1872. gbpat81.seq - Patent sequence entries, part 81.
1873. gbpat82.seq - Patent sequence entries, part 82.
1874. gbpat83.seq - Patent sequence entries, part 83.
1875. gbpat84.seq - Patent sequence entries, part 84.
1876. gbpat85.seq - Patent sequence entries, part 85.
1877. gbpat86.seq - Patent sequence entries, part 86.
1878. gbpat87.seq - Patent sequence entries, part 87.
1879. gbpat88.seq - Patent sequence entries, part 88.
1880. gbpat89.seq - Patent sequence entries, part 89.
1881. gbpat9.seq - Patent sequence entries, part 9.
1882. gbpat90.seq - Patent sequence entries, part 90.
1883. gbpat91.seq - Patent sequence entries, part 91.
1884. gbpat92.seq - Patent sequence entries, part 92.
1885. gbpat93.seq - Patent sequence entries, part 93.
1886. gbpat94.seq - Patent sequence entries, part 94.
1887. gbpat95.seq - Patent sequence entries, part 95.
1888. gbpat96.seq - Patent sequence entries, part 96.
1889. gbpat97.seq - Patent sequence entries, part 97.
1890. gbpat98.seq - Patent sequence entries, part 98.
1891. gbpat99.seq - Patent sequence entries, part 99.
1892. gbphg1.seq - Phage sequence entries, part 1.
1893. gbphg2.seq - Phage sequence entries, part 2.
1894. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1895. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1896. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
1897. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
1898. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
1899. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
1900. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
1901. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
1902. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
1903. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
1904. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
1905. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
1906. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1907. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
1908. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
1909. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
1910. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1911. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1912. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1913. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1914. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1915. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1916. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1917. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1918. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1919. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1920. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1921. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1922. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1923. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1924. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1925. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1926. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1927. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1928. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1929. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1930. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1931. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1932. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1933. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1934. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1935. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1936. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1937. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1938. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1939. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1940. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1941. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1942. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1943. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1944. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1945. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1946. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1947. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1948. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1949. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1950. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1951. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1952. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1953. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1954. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1955. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1956. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1957. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1958. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1959. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1960. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1961. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1962. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1963. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
1964. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
1965. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
1966. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
1967. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
1968. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
1969. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
1970. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
1971. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
1972. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
1973. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1974. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
1975. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
1976. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
1977. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
1978. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
1979. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
1980. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
1981. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
1982. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
1983. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
1984. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1985. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
1986. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
1987. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
1988. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
1989. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
1990. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
1991. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
1992. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
1993. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
1994. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
1995. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1996. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
1997. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
1998. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
1999. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2000. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2001. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2002. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2003. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2004. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2005. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2006. gbpri1.seq - Primate sequence entries, part 1.
2007. gbpri10.seq - Primate sequence entries, part 10.
2008. gbpri11.seq - Primate sequence entries, part 11.
2009. gbpri12.seq - Primate sequence entries, part 12.
2010. gbpri13.seq - Primate sequence entries, part 13.
2011. gbpri14.seq - Primate sequence entries, part 14.
2012. gbpri15.seq - Primate sequence entries, part 15.
2013. gbpri16.seq - Primate sequence entries, part 16.
2014. gbpri17.seq - Primate sequence entries, part 17.
2015. gbpri18.seq - Primate sequence entries, part 18.
2016. gbpri19.seq - Primate sequence entries, part 19.
2017. gbpri2.seq - Primate sequence entries, part 2.
2018. gbpri20.seq - Primate sequence entries, part 20.
2019. gbpri21.seq - Primate sequence entries, part 21.
2020. gbpri22.seq - Primate sequence entries, part 22.
2021. gbpri23.seq - Primate sequence entries, part 23.
2022. gbpri24.seq - Primate sequence entries, part 24.
2023. gbpri25.seq - Primate sequence entries, part 25.
2024. gbpri26.seq - Primate sequence entries, part 26.
2025. gbpri27.seq - Primate sequence entries, part 27.
2026. gbpri28.seq - Primate sequence entries, part 28.
2027. gbpri29.seq - Primate sequence entries, part 29.
2028. gbpri3.seq - Primate sequence entries, part 3.
2029. gbpri30.seq - Primate sequence entries, part 30.
2030. gbpri31.seq - Primate sequence entries, part 31.
2031. gbpri32.seq - Primate sequence entries, part 32.
2032. gbpri33.seq - Primate sequence entries, part 33.
2033. gbpri34.seq - Primate sequence entries, part 34.
2034. gbpri35.seq - Primate sequence entries, part 35.
2035. gbpri36.seq - Primate sequence entries, part 36.
2036. gbpri37.seq - Primate sequence entries, part 37.
2037. gbpri38.seq - Primate sequence entries, part 38.
2038. gbpri39.seq - Primate sequence entries, part 39.
2039. gbpri4.seq - Primate sequence entries, part 4.
2040. gbpri40.seq - Primate sequence entries, part 40.
2041. gbpri41.seq - Primate sequence entries, part 41.
2042. gbpri42.seq - Primate sequence entries, part 42.
2043. gbpri43.seq - Primate sequence entries, part 43.
2044. gbpri44.seq - Primate sequence entries, part 44.
2045. gbpri45.seq - Primate sequence entries, part 45.
2046. gbpri46.seq - Primate sequence entries, part 46.
2047. gbpri47.seq - Primate sequence entries, part 47.
2048. gbpri48.seq - Primate sequence entries, part 48.
2049. gbpri49.seq - Primate sequence entries, part 49.
2050. gbpri5.seq - Primate sequence entries, part 5.
2051. gbpri6.seq - Primate sequence entries, part 6.
2052. gbpri7.seq - Primate sequence entries, part 7.
2053. gbpri8.seq - Primate sequence entries, part 8.
2054. gbpri9.seq - Primate sequence entries, part 9.
2055. gbrel.txt - Release notes (this document).
2056. gbrod1.seq - Rodent sequence entries, part 1.
2057. gbrod10.seq - Rodent sequence entries, part 10.
2058. gbrod11.seq - Rodent sequence entries, part 11.
2059. gbrod12.seq - Rodent sequence entries, part 12.
2060. gbrod13.seq - Rodent sequence entries, part 13.
2061. gbrod14.seq - Rodent sequence entries, part 14.
2062. gbrod15.seq - Rodent sequence entries, part 15.
2063. gbrod16.seq - Rodent sequence entries, part 16.
2064. gbrod17.seq - Rodent sequence entries, part 17.
2065. gbrod18.seq - Rodent sequence entries, part 18.
2066. gbrod19.seq - Rodent sequence entries, part 19.
2067. gbrod2.seq - Rodent sequence entries, part 2.
2068. gbrod20.seq - Rodent sequence entries, part 20.
2069. gbrod21.seq - Rodent sequence entries, part 21.
2070. gbrod22.seq - Rodent sequence entries, part 22.
2071. gbrod23.seq - Rodent sequence entries, part 23.
2072. gbrod24.seq - Rodent sequence entries, part 24.
2073. gbrod25.seq - Rodent sequence entries, part 25.
2074. gbrod26.seq - Rodent sequence entries, part 26.
2075. gbrod27.seq - Rodent sequence entries, part 27.
2076. gbrod28.seq - Rodent sequence entries, part 28.
2077. gbrod29.seq - Rodent sequence entries, part 29.
2078. gbrod3.seq - Rodent sequence entries, part 3.
2079. gbrod30.seq - Rodent sequence entries, part 30.
2080. gbrod31.seq - Rodent sequence entries, part 31.
2081. gbrod4.seq - Rodent sequence entries, part 4.
2082. gbrod5.seq - Rodent sequence entries, part 5.
2083. gbrod6.seq - Rodent sequence entries, part 6.
2084. gbrod7.seq - Rodent sequence entries, part 7.
2085. gbrod8.seq - Rodent sequence entries, part 8.
2086. gbrod9.seq - Rodent sequence entries, part 9.
2087. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2088. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2089. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2090. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2091. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2092. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2093. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2094. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2095. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2096. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2097. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2098. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2099. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2100. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2101. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2102. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2103. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2104. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2105. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2106. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2107. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2108. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2109. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2110. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2111. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2112. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2113. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2114. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2115. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2116. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2117. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2118. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2119. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2120. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2121. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2122. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2123. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2124. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2125. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2126. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2127. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2128. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2129. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2130. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2131. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2132. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2133. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2134. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2135. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2136. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2137. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2138. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2139. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2140. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2141. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2142. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2143. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2144. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2145. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2146. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2147. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2148. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2149. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2150. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2151. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2152. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2153. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2154. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2155. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2156. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2157. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2158. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2159. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2160. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2161. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2162. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2163. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2164. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2165. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2166. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2167. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2168. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2169. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2170. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2171. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2172. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2173. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2174. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2175. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2176. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2177. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2178. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2179. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2180. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2181. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2182. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2183. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2184. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2185. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2186. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2187. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2188. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2189. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2190. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2191. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2192. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2193. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2194. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2195. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2196. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2197. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2198. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2199. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2200. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2201. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2202. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2203. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2204. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2205. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2206. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2207. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2208. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2209. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2210. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2211. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2212. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2213. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2214. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2215. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2216. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2217. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2218. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2219. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2220. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2221. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2222. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2223. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2224. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2225. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2226. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2227. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2228. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2229. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2230. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2231. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2232. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2233. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2234. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2235. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2236. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2237. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2238. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2239. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2240. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2241. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2242. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2243. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2244. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2245. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2246. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2247. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2248. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2249. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2250. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2251. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2252. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2253. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2254. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2255. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2256. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2257. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2258. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2259. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2260. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2261. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2262. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2263. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2264. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2265. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2266. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2267. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2268. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2269. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2270. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2271. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2272. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2273. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2274. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2275. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2276. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2277. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2278. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2279. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2280. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2281. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2282. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2283. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2284. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2285. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2286. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2287. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2288. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2289. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2290. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2291. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2292. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2293. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2294. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2295. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2296. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2297. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2298. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2299. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2300. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2301. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2302. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2303. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2304. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2305. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2306. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2307. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2308. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2309. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2310. gbuna1.seq - Unannotated sequence entries, part 1.
2311. gbvrl1.seq - Viral sequence entries, part 1.
2312. gbvrl10.seq - Viral sequence entries, part 10.
2313. gbvrl11.seq - Viral sequence entries, part 11.
2314. gbvrl12.seq - Viral sequence entries, part 12.
2315. gbvrl13.seq - Viral sequence entries, part 13.
2316. gbvrl14.seq - Viral sequence entries, part 14.
2317. gbvrl15.seq - Viral sequence entries, part 15.
2318. gbvrl16.seq - Viral sequence entries, part 16.
2319. gbvrl17.seq - Viral sequence entries, part 17.
2320. gbvrl18.seq - Viral sequence entries, part 18.
2321. gbvrl19.seq - Viral sequence entries, part 19.
2322. gbvrl2.seq - Viral sequence entries, part 2.
2323. gbvrl20.seq - Viral sequence entries, part 20.
2324. gbvrl21.seq - Viral sequence entries, part 21.
2325. gbvrl22.seq - Viral sequence entries, part 22.
2326. gbvrl23.seq - Viral sequence entries, part 23.
2327. gbvrl24.seq - Viral sequence entries, part 24.
2328. gbvrl25.seq - Viral sequence entries, part 25.
2329. gbvrl26.seq - Viral sequence entries, part 26.
2330. gbvrl27.seq - Viral sequence entries, part 27.
2331. gbvrl28.seq - Viral sequence entries, part 28.
2332. gbvrl29.seq - Viral sequence entries, part 29.
2333. gbvrl3.seq - Viral sequence entries, part 3.
2334. gbvrl30.seq - Viral sequence entries, part 30.
2335. gbvrl31.seq - Viral sequence entries, part 31.
2336. gbvrl32.seq - Viral sequence entries, part 32.
2337. gbvrl33.seq - Viral sequence entries, part 33.
2338. gbvrl34.seq - Viral sequence entries, part 34.
2339. gbvrl35.seq - Viral sequence entries, part 35.
2340. gbvrl36.seq - Viral sequence entries, part 36.
2341. gbvrl4.seq - Viral sequence entries, part 4.
2342. gbvrl5.seq - Viral sequence entries, part 5.
2343. gbvrl6.seq - Viral sequence entries, part 6.
2344. gbvrl7.seq - Viral sequence entries, part 7.
2345. gbvrl8.seq - Viral sequence entries, part 8.
2346. gbvrl9.seq - Viral sequence entries, part 9.
2347. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2348. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2349. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2350. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2351. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2352. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2353. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2354. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2355. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2356. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2357. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2358. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2359. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2360. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2361. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2362. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2363. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2364. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2365. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2366. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2367. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2368. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2369. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2370. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2371. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2372. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2373. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2374. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2375. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2376. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2377. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2378. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2379. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2380. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2381. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2382. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2383. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2384. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2385. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2386. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2387. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2388. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2389. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2390. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2391. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2392. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 208.0 flatfiles require roughly 722 GB (sequence
files only) or 723 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249999636     gbbct1.seq
 239170243     gbbct10.seq
 245060263     gbbct100.seq
 240937490     gbbct101.seq
 238967544     gbbct102.seq
 246081919     gbbct103.seq
 249116272     gbbct104.seq
 248456641     gbbct105.seq
 242187209     gbbct106.seq
 246793402     gbbct107.seq
 249527180     gbbct108.seq
 246373599     gbbct109.seq
 247930522     gbbct11.seq
 153501285     gbbct110.seq
 240037253     gbbct111.seq
 243847183     gbbct112.seq
 247571305     gbbct113.seq
 247923672     gbbct114.seq
 245819142     gbbct115.seq
 241964611     gbbct116.seq
 246345032     gbbct117.seq
 220374268     gbbct118.seq
 247833337     gbbct119.seq
 248751631     gbbct12.seq
 248341984     gbbct120.seq
 248379181     gbbct121.seq
 245012041     gbbct122.seq
 246314159     gbbct123.seq
 242142570     gbbct124.seq
 245946436     gbbct125.seq
 247622644     gbbct126.seq
 241858917     gbbct127.seq
 249165556     gbbct128.seq
 246209958     gbbct129.seq
 246719114     gbbct13.seq
 245565314     gbbct130.seq
  15317132     gbbct131.seq
 249165469     gbbct132.seq
 240709579     gbbct133.seq
 242325397     gbbct134.seq
 246331931     gbbct135.seq
 244267195     gbbct136.seq
 248178628     gbbct137.seq
 248381174     gbbct138.seq
 237556623     gbbct139.seq
 233391108     gbbct14.seq
 163879242     gbbct140.seq
 244066431     gbbct141.seq
 248973168     gbbct142.seq
 245634228     gbbct143.seq
 246527818     gbbct144.seq
 243459923     gbbct145.seq
 246459206     gbbct146.seq
 249853739     gbbct147.seq
 241876157     gbbct148.seq
 131890158     gbbct149.seq
 249407785     gbbct15.seq
 237086122     gbbct150.seq
  73333994     gbbct151.seq
   6910654     gbbct152.seq
  14292876     gbbct153.seq
  23068688     gbbct154.seq
  45118188     gbbct155.seq
  87822848     gbbct156.seq
 170527672     gbbct157.seq
 249997413     gbbct158.seq
 249999996     gbbct159.seq
 245509478     gbbct16.seq
 249010973     gbbct160.seq
 247064116     gbbct161.seq
 241004678     gbbct162.seq
 246347700     gbbct163.seq
 245955273     gbbct164.seq
 247593082     gbbct165.seq
 244231850     gbbct166.seq
 249997859     gbbct167.seq
  62345720     gbbct168.seq
 244556890     gbbct169.seq
 247140663     gbbct17.seq
 244048533     gbbct170.seq
 248162438     gbbct171.seq
 249997160     gbbct172.seq
 243056662     gbbct173.seq
 249997682     gbbct174.seq
 249998548     gbbct175.seq
 240440221     gbbct176.seq
 249998179     gbbct177.seq
 249999229     gbbct178.seq
 249999194     gbbct179.seq
 143836760     gbbct18.seq
 249996881     gbbct180.seq
 249999993     gbbct181.seq
 249898770     gbbct182.seq
 249508122     gbbct183.seq
 248292099     gbbct184.seq
 247627617     gbbct185.seq
 249998257     gbbct186.seq
 148584035     gbbct187.seq
 243164384     gbbct19.seq
 248827558     gbbct2.seq
 249659699     gbbct20.seq
 247941554     gbbct21.seq
 249354114     gbbct22.seq
 248385191     gbbct23.seq
 245177002     gbbct24.seq
 242877047     gbbct25.seq
 239674465     gbbct26.seq
 217808722     gbbct27.seq
 242805033     gbbct28.seq
 245839033     gbbct29.seq
 247572110     gbbct3.seq
 248681321     gbbct30.seq
 247878248     gbbct31.seq
 249387148     gbbct32.seq
 244186672     gbbct33.seq
 247334189     gbbct34.seq
 249981689     gbbct35.seq
 249765455     gbbct36.seq
 240923121     gbbct37.seq
 244794918     gbbct38.seq
 249621614     gbbct39.seq
 247485357     gbbct4.seq
 165336198     gbbct40.seq
 247450638     gbbct41.seq
 246940388     gbbct42.seq
 248190823     gbbct43.seq
 246578192     gbbct44.seq
 241883376     gbbct45.seq
 246672034     gbbct46.seq
 249202548     gbbct47.seq
 246111554     gbbct48.seq
 239781924     gbbct49.seq
 249992376     gbbct5.seq
 248870155     gbbct50.seq
 248936600     gbbct51.seq
 245189573     gbbct52.seq
  49416817     gbbct53.seq
 244557347     gbbct54.seq
 245263100     gbbct55.seq
 239703792     gbbct56.seq
 247755497     gbbct57.seq
 239866006     gbbct58.seq
 247439977     gbbct59.seq
  47977874     gbbct6.seq
 249952695     gbbct60.seq
 247308934     gbbct61.seq
 238422500     gbbct62.seq
 244739876     gbbct63.seq
 247475445     gbbct64.seq
 238998997     gbbct65.seq
 246362534     gbbct66.seq
 100528900     gbbct67.seq
 248766164     gbbct68.seq
 248624077     gbbct69.seq
 249633771     gbbct7.seq
 249953842     gbbct70.seq
 246141627     gbbct71.seq
 240223907     gbbct72.seq
 249457396     gbbct73.seq
 249423096     gbbct74.seq
 244707117     gbbct75.seq
 245854901     gbbct76.seq
 245591720     gbbct77.seq
 249680717     gbbct78.seq
 244837390     gbbct79.seq
 249870690     gbbct8.seq
 249516952     gbbct80.seq
  61286429     gbbct81.seq
 248010386     gbbct82.seq
 245923135     gbbct83.seq
 241905076     gbbct84.seq
 249666575     gbbct85.seq
 248500112     gbbct86.seq
 246051247     gbbct87.seq
 243906491     gbbct88.seq
 249091369     gbbct89.seq
 244957785     gbbct9.seq
 240229530     gbbct90.seq
 195022955     gbbct91.seq
 248656225     gbbct92.seq
 245658960     gbbct93.seq
 248780654     gbbct94.seq
 245509066     gbbct95.seq
 246283687     gbbct96.seq
 239557280     gbbct97.seq
 244484818     gbbct98.seq
 139543659     gbbct99.seq
  12571842     gbchg.txt
 249996948     gbcon1.seq
 250000069     gbcon10.seq
  32427016     gbcon100.seq
 249994975     gbcon101.seq
 249999581     gbcon102.seq
 249997722     gbcon103.seq
 249997541     gbcon104.seq
 208220377     gbcon105.seq
 249992153     gbcon106.seq
 249998787     gbcon107.seq
 249995953     gbcon108.seq
 249999393     gbcon109.seq
 248925992     gbcon11.seq
 250000027     gbcon110.seq
 143584215     gbcon111.seq
 249995301     gbcon112.seq
 249999496     gbcon113.seq
 249998124     gbcon114.seq
 249999708     gbcon115.seq
 249996885     gbcon116.seq
 166460579     gbcon117.seq
 249995504     gbcon118.seq
 249997107     gbcon119.seq
 245399310     gbcon12.seq
 249999227     gbcon120.seq
 242947298     gbcon121.seq
 174526309     gbcon122.seq
 249996492     gbcon123.seq
 249999560     gbcon124.seq
  51650671     gbcon125.seq
 249999943     gbcon126.seq
 249975993     gbcon127.seq
 208854824     gbcon128.seq
 204358912     gbcon129.seq
 241898584     gbcon13.seq
 249878181     gbcon130.seq
 249844018     gbcon131.seq
 249999081     gbcon132.seq
 249995699     gbcon133.seq
 250000112     gbcon134.seq
 207016965     gbcon135.seq
 249997581     gbcon136.seq
 249492030     gbcon137.seq
 246515164     gbcon138.seq
 244014257     gbcon139.seq
 246230288     gbcon14.seq
 249999386     gbcon140.seq
 249744643     gbcon141.seq
 249996366     gbcon142.seq
  78052304     gbcon143.seq
 249999281     gbcon144.seq
 249904987     gbcon145.seq
 249050141     gbcon146.seq
 249997298     gbcon147.seq
 249996807     gbcon148.seq
 249959666     gbcon149.seq
 240516244     gbcon15.seq
 248608480     gbcon150.seq
 249997880     gbcon151.seq
 123291616     gbcon152.seq
 249999125     gbcon153.seq
 250000177     gbcon154.seq
 249999826     gbcon155.seq
 249794202     gbcon156.seq
 247752922     gbcon157.seq
 249998960     gbcon158.seq
 249999929     gbcon159.seq
 246418372     gbcon16.seq
 249999353     gbcon160.seq
 249998479     gbcon161.seq
 250000206     gbcon162.seq
 249997117     gbcon163.seq
 249999462     gbcon164.seq
 249997376     gbcon165.seq
 130844104     gbcon166.seq
 249999124     gbcon167.seq
 249997908     gbcon168.seq
 249997525     gbcon169.seq
 249808278     gbcon17.seq
 249998316     gbcon170.seq
 226052266     gbcon171.seq
 249999366     gbcon172.seq
 249971899     gbcon173.seq
 249997860     gbcon174.seq
 249998935     gbcon175.seq
 249941821     gbcon176.seq
 249999153     gbcon177.seq
 249965909     gbcon178.seq
 249724752     gbcon179.seq
 139149497     gbcon18.seq
 249807849     gbcon180.seq
 249999341     gbcon181.seq
  77314829     gbcon182.seq
 248652303     gbcon183.seq
 249964392     gbcon184.seq
 249995974     gbcon185.seq
 249502207     gbcon186.seq
 249999603     gbcon187.seq
 249992669     gbcon188.seq
 179666930     gbcon189.seq
 249991080     gbcon19.seq
 249830885     gbcon190.seq
 249924110     gbcon191.seq
 249996379     gbcon192.seq
 250000250     gbcon193.seq
 249998641     gbcon194.seq
   9687002     gbcon195.seq
 249998811     gbcon196.seq
 249979164     gbcon197.seq
 249977208     gbcon198.seq
 249482284     gbcon199.seq
 249889128     gbcon2.seq
 249999368     gbcon20.seq
 249997611     gbcon200.seq
 249998962     gbcon201.seq
 249991098     gbcon202.seq
 249998329     gbcon203.seq
 106304844     gbcon204.seq
 249999259     gbcon205.seq
 249999298     gbcon206.seq
 249996283     gbcon207.seq
 249998745     gbcon208.seq
 205607173     gbcon209.seq
 249997432     gbcon21.seq
 249996001     gbcon210.seq
 249998524     gbcon211.seq
 249999955     gbcon212.seq
 249998250     gbcon213.seq
 163866121     gbcon214.seq
 249997728     gbcon215.seq
 249998020     gbcon216.seq
 249998687     gbcon217.seq
 249285708     gbcon218.seq
 249999305     gbcon219.seq
 249996728     gbcon22.seq
 248654967     gbcon220.seq
 249995424     gbcon221.seq
 249998246     gbcon222.seq
 249999211     gbcon223.seq
 249997851     gbcon224.seq
 249993750     gbcon225.seq
 249996796     gbcon226.seq
 190790350     gbcon227.seq
 249998617     gbcon228.seq
 249992409     gbcon229.seq
 249999276     gbcon23.seq
 249995639     gbcon230.seq
 249999237     gbcon231.seq
 221831312     gbcon232.seq
 249998954     gbcon233.seq
 249993861     gbcon234.seq
 249998913     gbcon235.seq
 249997873     gbcon236.seq
 188893324     gbcon237.seq
 249725751     gbcon238.seq
 249998402     gbcon239.seq
 240311925     gbcon24.seq
 249998298     gbcon240.seq
 249999092     gbcon241.seq
 249997388     gbcon242.seq
 249951956     gbcon243.seq
  22460543     gbcon244.seq
 249997777     gbcon245.seq
 249754364     gbcon246.seq
 249999954     gbcon247.seq
 249998563     gbcon248.seq
 249998588     gbcon249.seq
 249999128     gbcon25.seq
 249995920     gbcon250.seq
 249997744     gbcon251.seq
 249988942     gbcon252.seq
 155339940     gbcon253.seq
 249953536     gbcon254.seq
 249999333     gbcon255.seq
 249864590     gbcon256.seq
 249997638     gbcon257.seq
 249999214     gbcon258.seq
 126323358     gbcon259.seq
 249999123     gbcon26.seq
 249998524     gbcon260.seq
 249961426     gbcon261.seq
 249995827     gbcon262.seq
 249997415     gbcon263.seq
 249976748     gbcon264.seq
 249999402     gbcon265.seq
 182798599     gbcon266.seq
 249999962     gbcon267.seq
 249996982     gbcon268.seq
 249987851     gbcon269.seq
 249997985     gbcon27.seq
 249998390     gbcon270.seq
 249998892     gbcon271.seq
 249999650     gbcon272.seq
 249999917     gbcon273.seq
  25046915     gbcon274.seq
 249994058     gbcon275.seq
 249975737     gbcon276.seq
 249998997     gbcon277.seq
 249889495     gbcon278.seq
 249998761     gbcon279.seq
 246437079     gbcon28.seq
 118221903     gbcon280.seq
 249999438     gbcon281.seq
 249999422     gbcon282.seq
 249998094     gbcon283.seq
 249935199     gbcon284.seq
 249994665     gbcon285.seq
 130300787     gbcon286.seq
 249999933     gbcon287.seq
 249999816     gbcon288.seq
 249995521     gbcon289.seq
 249998053     gbcon29.seq
 249996311     gbcon290.seq
 249998374     gbcon291.seq
 250000062     gbcon292.seq
  10426564     gbcon293.seq
 249994716     gbcon294.seq
 249994930     gbcon295.seq
 249988364     gbcon296.seq
 249966549     gbcon297.seq
 249997786     gbcon298.seq
 249999806     gbcon299.seq
 249534426     gbcon3.seq
 249995986     gbcon30.seq
 137855338     gbcon300.seq
 249407746     gbcon301.seq
 249984475     gbcon302.seq
 248866634     gbcon303.seq
 250000181     gbcon304.seq
 249991406     gbcon305.seq
 249973047     gbcon306.seq
 249977646     gbcon307.seq
 249999692     gbcon308.seq
 249998852     gbcon309.seq
    689419     gbcon31.seq
 249999223     gbcon310.seq
     11428     gbcon311.seq
 250000009     gbcon312.seq
 249999657     gbcon313.seq
 249999310     gbcon314.seq
 249998171     gbcon315.seq
 249995741     gbcon316.seq
 249956313     gbcon317.seq
  42626862     gbcon318.seq
  18867251     gbcon319.seq
 249997905     gbcon32.seq
 247518350     gbcon33.seq
 104758278     gbcon34.seq
 109763945     gbcon35.seq
 249996964     gbcon36.seq
 249996809     gbcon37.seq
 249999229     gbcon38.seq
 249997951     gbcon39.seq
 249994560     gbcon4.seq
 129038064     gbcon40.seq
 249998410     gbcon41.seq
 249999995     gbcon42.seq
 249998691     gbcon43.seq
 249999465     gbcon44.seq
 249987584     gbcon45.seq
 220596442     gbcon46.seq
 249995573     gbcon47.seq
 249996408     gbcon48.seq
 249994120     gbcon49.seq
 249998233     gbcon5.seq
 249994952     gbcon50.seq
 249998384     gbcon51.seq
 249996413     gbcon52.seq
  73437195     gbcon53.seq
 249998712     gbcon54.seq
 249998158     gbcon55.seq
 249996631     gbcon56.seq
 249998184     gbcon57.seq
 249997010     gbcon58.seq
  53203903     gbcon59.seq
 249998998     gbcon6.seq
 249995129     gbcon60.seq
 249997080     gbcon61.seq
 249999244     gbcon62.seq
 249997768     gbcon63.seq
 249999302     gbcon64.seq
  46505761     gbcon65.seq
 249997479     gbcon66.seq
 250000123     gbcon67.seq
 249999337     gbcon68.seq
 249997135     gbcon69.seq
 152597266     gbcon7.seq
 249996958     gbcon70.seq
 163671197     gbcon71.seq
 249996154     gbcon72.seq
 250000031     gbcon73.seq
 249995010     gbcon74.seq
 249997630     gbcon75.seq
 194598585     gbcon76.seq
 249997650     gbcon77.seq
 249997746     gbcon78.seq
 249995972     gbcon79.seq
 249998998     gbcon8.seq
 249996499     gbcon80.seq
 249998163     gbcon81.seq
   7197220     gbcon82.seq
 249996246     gbcon83.seq
 249997498     gbcon84.seq
 249996448     gbcon85.seq
 249998072     gbcon86.seq
 249997897     gbcon87.seq
 108419384     gbcon88.seq
 249999177     gbcon89.seq
 249996582     gbcon9.seq
 250000223     gbcon90.seq
 249994923     gbcon91.seq
 249998335     gbcon92.seq
 249999420     gbcon93.seq
  73407611     gbcon94.seq
 249998420     gbcon95.seq
 249998945     gbcon96.seq
 249996184     gbcon97.seq
 249995144     gbcon98.seq
 249998952     gbcon99.seq
   1363829     gbdel.txt
 249999090     gbenv1.seq
 249999354     gbenv10.seq
 250000172     gbenv11.seq
 249999687     gbenv12.seq
  60826682     gbenv13.seq
 249999719     gbenv14.seq
 249998968     gbenv15.seq
 249998514     gbenv16.seq
 249999552     gbenv17.seq
 249998949     gbenv18.seq
 249999065     gbenv19.seq
 249998935     gbenv2.seq
 249997183     gbenv20.seq
 237899926     gbenv21.seq
 249998368     gbenv22.seq
 249998430     gbenv23.seq
 249999384     gbenv24.seq
 249999317     gbenv25.seq
 165948385     gbenv26.seq
 249999732     gbenv27.seq
 249993152     gbenv28.seq
 250000192     gbenv29.seq
 249976580     gbenv3.seq
 249999607     gbenv30.seq
 249998494     gbenv31.seq
 249999296     gbenv32.seq
  60980661     gbenv33.seq
 249999624     gbenv34.seq
 249999999     gbenv35.seq
 249998454     gbenv36.seq
 249997260     gbenv37.seq
 187704034     gbenv38.seq
 249999409     gbenv39.seq
 249999909     gbenv4.seq
 249999305     gbenv40.seq
 249998521     gbenv41.seq
 249998621     gbenv42.seq
 249997179     gbenv43.seq
 249996710     gbenv44.seq
  54350210     gbenv45.seq
 250000106     gbenv46.seq
 249998736     gbenv47.seq
 250000030     gbenv48.seq
 249998374     gbenv49.seq
 249999110     gbenv5.seq
 198901819     gbenv50.seq
 249999249     gbenv51.seq
 249999306     gbenv52.seq
 249999079     gbenv53.seq
 250000178     gbenv54.seq
 250000020     gbenv55.seq
  88760051     gbenv56.seq
 249999104     gbenv57.seq
 249998451     gbenv58.seq
 250000163     gbenv59.seq
 249999398     gbenv6.seq
 249998415     gbenv60.seq
 249998065     gbenv61.seq
 125591566     gbenv62.seq
 249998797     gbenv63.seq
 249999078     gbenv64.seq
 249999458     gbenv65.seq
 249999846     gbenv66.seq
 249999417     gbenv67.seq
  80907977     gbenv68.seq
 250000180     gbenv69.seq
 249999179     gbenv7.seq
 249972528     gbenv70.seq
 250000051     gbenv71.seq
 249998199     gbenv72.seq
 250000109     gbenv73.seq
 123107496     gbenv74.seq
 249999313     gbenv75.seq
 249998259     gbenv76.seq
 249998655     gbenv77.seq
 249999681     gbenv78.seq
 250000178     gbenv79.seq
  27175490     gbenv8.seq
 249999465     gbenv80.seq
 213592792     gbenv81.seq
 250000226     gbenv9.seq
 524289247     gbest1.seq
 524290807     gbest10.seq
 524291264     gbest100.seq
 524290365     gbest101.seq
 524290418     gbest102.seq
 524290483     gbest103.seq
 351523075     gbest104.seq
 524290437     gbest105.seq
 524291288     gbest106.seq
 524291140     gbest107.seq
 382499903     gbest108.seq
 386199420     gbest109.seq
 524290622     gbest11.seq
 380000404     gbest110.seq
 380752767     gbest111.seq
 377685132     gbest112.seq
 381800407     gbest113.seq
 385864373     gbest114.seq
 385245932     gbest115.seq
 384105322     gbest116.seq
 380303944     gbest117.seq
 403270578     gbest118.seq
 478792380     gbest119.seq
 524290393     gbest12.seq
 524288808     gbest120.seq
 524290180     gbest121.seq
 524289866     gbest122.seq
 524290503     gbest123.seq
 473320856     gbest124.seq
 524289593     gbest125.seq
 524289291     gbest126.seq
 524289150     gbest127.seq
 524289134     gbest128.seq
 524288801     gbest129.seq
 145077229     gbest13.seq
 524289803     gbest130.seq
 524290377     gbest131.seq
 524291158     gbest132.seq
 524291507     gbest133.seq
 524291946     gbest134.seq
 524290222     gbest135.seq
 524291172     gbest136.seq
 286165153     gbest137.seq
 524290674     gbest138.seq
 524291735     gbest139.seq
 524290549     gbest14.seq
 524289563     gbest140.seq
 524289007     gbest141.seq
 524292095     gbest142.seq
 524290036     gbest143.seq
 524289515     gbest144.seq
 524292354     gbest145.seq
 524290995     gbest146.seq
 524290836     gbest147.seq
 524289245     gbest148.seq
 524291729     gbest149.seq
 524290404     gbest15.seq
 524291980     gbest150.seq
 465347659     gbest151.seq
 524288908     gbest152.seq
 524289151     gbest153.seq
 524290002     gbest154.seq
 524290142     gbest155.seq
 524291336     gbest156.seq
 524289218     gbest157.seq
 524289079     gbest158.seq
 524291177     gbest159.seq
 524289286     gbest16.seq
 524291059     gbest160.seq
 524291856     gbest161.seq
 524291517     gbest162.seq
 524289948     gbest163.seq
 238711994     gbest164.seq
 524291011     gbest165.seq
 524288852     gbest166.seq
 524290337     gbest167.seq
 524290723     gbest168.seq
 524290477     gbest169.seq
 524291401     gbest17.seq
 524291503     gbest170.seq
 524289728     gbest171.seq
 524291544     gbest172.seq
 524289131     gbest173.seq
 524289702     gbest174.seq
 524289911     gbest175.seq
 524289091     gbest176.seq
 524290348     gbest177.seq
  93034975     gbest178.seq
 524289086     gbest179.seq
 524290812     gbest18.seq
 524289463     gbest180.seq
 524288882     gbest181.seq
 524289104     gbest182.seq
 524291393     gbest183.seq
 524288887     gbest184.seq
 524289908     gbest185.seq
 524291222     gbest186.seq
 524289543     gbest187.seq
 524291586     gbest188.seq
 524289133     gbest189.seq
 524288977     gbest19.seq
 524289349     gbest190.seq
 457916436     gbest191.seq
 524292321     gbest192.seq
 524289721     gbest193.seq
 524293533     gbest194.seq
 524288902     gbest195.seq
 524291816     gbest196.seq
 524290375     gbest197.seq
 524291321     gbest198.seq
 524290365     gbest199.seq
 524291947     gbest2.seq
 524291100     gbest20.seq
 524290769     gbest200.seq
 524290283     gbest201.seq
 524289059     gbest202.seq
 524290270     gbest203.seq
 524291152     gbest204.seq
  54379539     gbest205.seq
 524290496     gbest206.seq
 524288928     gbest207.seq
 524291218     gbest208.seq
 524289398     gbest209.seq
 524289114     gbest21.seq
 524290391     gbest210.seq
 524290812     gbest211.seq
 524290117     gbest212.seq
 524290181     gbest213.seq
 524290832     gbest214.seq
 524288855     gbest215.seq
 474416016     gbest216.seq
 524288861     gbest217.seq
 524289769     gbest218.seq
 524290162     gbest219.seq
 494679576     gbest22.seq
 524291432     gbest220.seq
 524289775     gbest221.seq
 524288893     gbest222.seq
 524293467     gbest223.seq
 524290655     gbest224.seq
 524291040     gbest225.seq
 524293069     gbest226.seq
 524290712     gbest227.seq
 524289634     gbest228.seq
 464504141     gbest229.seq
 491017974     gbest23.seq
 524292297     gbest230.seq
 524292376     gbest231.seq
 524288732     gbest232.seq
 524290168     gbest233.seq
 524291738     gbest234.seq
 524291912     gbest235.seq
 524289297     gbest236.seq
 524291582     gbest237.seq
 524289378     gbest238.seq
 524289202     gbest239.seq
 502280580     gbest24.seq
 524291659     gbest240.seq
 524291224     gbest241.seq
 524288955     gbest242.seq
 524290386     gbest243.seq
 247664807     gbest244.seq
 524290677     gbest245.seq
 524288994     gbest246.seq
 524289788     gbest247.seq
 524289038     gbest248.seq
 524289667     gbest249.seq
 330361269     gbest25.seq
 524289871     gbest250.seq
 524288978     gbest251.seq
 517322504     gbest252.seq
 524290565     gbest253.seq
 524290581     gbest254.seq
 524289155     gbest255.seq
 322666257     gbest256.seq
 524289934     gbest257.seq
 524290601     gbest258.seq
 524289779     gbest259.seq
 524290540     gbest26.seq
 524289825     gbest260.seq
 524291298     gbest261.seq
 524290716     gbest262.seq
 524288904     gbest263.seq
 524289523     gbest264.seq
 524289355     gbest265.seq
 524289763     gbest266.seq
 213139801     gbest267.seq
 524289917     gbest268.seq
 524291493     gbest269.seq
 524289076     gbest27.seq
 524289693     gbest270.seq
 524289164     gbest271.seq
 524289661     gbest272.seq
 524288797     gbest273.seq
 524289782     gbest274.seq
 524292841     gbest275.seq
 524291067     gbest276.seq
 524289940     gbest277.seq
 524290829     gbest278.seq
 355935622     gbest279.seq
 524291318     gbest28.seq
 524290933     gbest280.seq
 524290356     gbest281.seq
 524290619     gbest282.seq
 524289658     gbest283.seq
 524289201     gbest284.seq
 524289313     gbest285.seq
 524289999     gbest286.seq
 524291766     gbest287.seq
 524292190     gbest288.seq
 524291469     gbest289.seq
 524291872     gbest29.seq
 524289522     gbest290.seq
 295922757     gbest291.seq
 524290054     gbest292.seq
 524290301     gbest293.seq
 524291421     gbest294.seq
 524289038     gbest295.seq
 524290236     gbest296.seq
 524289892     gbest297.seq
 524291166     gbest298.seq
 524289377     gbest299.seq
 488099433     gbest3.seq
 524291533     gbest30.seq
 524290806     gbest300.seq
 524290156     gbest301.seq
 469648088     gbest302.seq
 323674192     gbest303.seq
 475499186     gbest304.seq
 472628309     gbest305.seq
 524291252     gbest306.seq
 524291196     gbest307.seq
 524291547     gbest308.seq
 524290731     gbest309.seq
 524289838     gbest31.seq
 524290195     gbest310.seq
 524291598     gbest311.seq
 524288798     gbest312.seq
 524291031     gbest313.seq
 524292897     gbest314.seq
 524291067     gbest315.seq
 380155539     gbest316.seq
 524291970     gbest317.seq
 524291430     gbest318.seq
 524291046     gbest319.seq
 524291610     gbest32.seq
 524289275     gbest320.seq
 524290001     gbest321.seq
 524290802     gbest322.seq
 524290330     gbest323.seq
 524290557     gbest324.seq
 524289983     gbest325.seq
 524289550     gbest326.seq
 524290560     gbest327.seq
 515141944     gbest328.seq
 516921326     gbest329.seq
 524289015     gbest33.seq
 221454114     gbest330.seq
 524288931     gbest331.seq
 524291898     gbest332.seq
 524289003     gbest333.seq
 524289263     gbest334.seq
 524288988     gbest335.seq
 524292293     gbest336.seq
 494806861     gbest337.seq
 524291429     gbest338.seq
 524290677     gbest339.seq
 509019580     gbest34.seq
 524291314     gbest340.seq
 524290403     gbest341.seq
 524288736     gbest342.seq
 524289183     gbest343.seq
 333225390     gbest344.seq
 524289537     gbest345.seq
 524288898     gbest346.seq
 524290319     gbest347.seq
 524289539     gbest348.seq
 524289774     gbest349.seq
 486384604     gbest35.seq
 524289753     gbest350.seq
 510748532     gbest351.seq
 524291442     gbest352.seq
 524290811     gbest353.seq
 524294744     gbest354.seq
 524289055     gbest355.seq
 524290537     gbest356.seq
 524289890     gbest357.seq
 524289770     gbest358.seq
 143697864     gbest359.seq
 488141553     gbest36.seq
 524292212     gbest360.seq
 524291679     gbest361.seq
 524289330     gbest362.seq
 524288783     gbest363.seq
 524291872     gbest364.seq
 524289628     gbest365.seq
 524289303     gbest366.seq
 524291086     gbest367.seq
 524289450     gbest368.seq
 524289070     gbest369.seq
 486975697     gbest37.seq
 524289591     gbest370.seq
  34853058     gbest371.seq
 524289676     gbest372.seq
 524289682     gbest373.seq
 524291848     gbest374.seq
 524289587     gbest375.seq
 524292976     gbest376.seq
 524290490     gbest377.seq
 463453629     gbest378.seq
 524290304     gbest379.seq
 481677015     gbest38.seq
 524291033     gbest380.seq
 524291761     gbest381.seq
 524289581     gbest382.seq
 291117155     gbest383.seq
 524289723     gbest384.seq
 524291516     gbest385.seq
 524289984     gbest386.seq
 524289086     gbest387.seq
 524291130     gbest388.seq
 524291090     gbest389.seq
 485691905     gbest39.seq
 524290661     gbest390.seq
 524290101     gbest391.seq
 524289501     gbest392.seq
 524289974     gbest393.seq
 197722470     gbest394.seq
 524289931     gbest395.seq
 524288946     gbest396.seq
 524291367     gbest397.seq
 524289920     gbest398.seq
 524288775     gbest399.seq
 524290673     gbest4.seq
 133201180     gbest40.seq
 524288755     gbest400.seq
 524291846     gbest401.seq
 524289369     gbest402.seq
 524291350     gbest403.seq
 524288967     gbest404.seq
 524290935     gbest405.seq
 524290802     gbest406.seq
 502181347     gbest407.seq
 524289295     gbest408.seq
 524289174     gbest409.seq
 524288883     gbest41.seq
 524290177     gbest410.seq
 524290589     gbest411.seq
 524289181     gbest412.seq
 524290999     gbest413.seq
 524290662     gbest414.seq
 524291792     gbest415.seq
 524290149     gbest416.seq
 524291119     gbest417.seq
 524292261     gbest418.seq
 524292514     gbest419.seq
 524162079     gbest42.seq
 489397183     gbest420.seq
 524290868     gbest421.seq
 524289950     gbest422.seq
 524290924     gbest423.seq
 524291130     gbest424.seq
 524289129     gbest425.seq
 524291716     gbest426.seq
 524288912     gbest427.seq
 524293596     gbest428.seq
 524290800     gbest429.seq
 524289370     gbest43.seq
 524291475     gbest430.seq
 524292063     gbest431.seq
 524290041     gbest432.seq
 524290309     gbest433.seq
 524289073     gbest434.seq
 140938273     gbest435.seq
 524291137     gbest436.seq
 524294124     gbest437.seq
 524288949     gbest438.seq
 524292148     gbest439.seq
 524289146     gbest44.seq
 524289068     gbest440.seq
 524292289     gbest441.seq
 524289722     gbest442.seq
 524289590     gbest443.seq
 524289685     gbest444.seq
 524291269     gbest445.seq
 524291379     gbest446.seq
 524292224     gbest447.seq
 196295442     gbest448.seq
 524289027     gbest449.seq
 524289295     gbest45.seq
 524290767     gbest450.seq
 524290059     gbest451.seq
 524290609     gbest452.seq
 524289699     gbest453.seq
 524288846     gbest454.seq
 524291430     gbest455.seq
 524290674     gbest456.seq
 524291028     gbest457.seq
 524288730     gbest458.seq
 407493421     gbest459.seq
 524290589     gbest46.seq
 524290256     gbest460.seq
 524289644     gbest461.seq
 524290043     gbest462.seq
 524291659     gbest463.seq
 524290795     gbest464.seq
 524292262     gbest465.seq
 524289236     gbest466.seq
 524290805     gbest467.seq
 524288966     gbest468.seq
 524289813     gbest469.seq
 524289430     gbest47.seq
 524289559     gbest470.seq
 450945225     gbest471.seq
 524288899     gbest472.seq
 524291142     gbest473.seq
 524288763     gbest474.seq
 524289817     gbest475.seq
 524288782     gbest476.seq
 524289889     gbest477.seq
 273953263     gbest478.seq
 524289494     gbest48.seq
 524291252     gbest49.seq
 524291428     gbest5.seq
 524291264     gbest50.seq
 524290293     gbest51.seq
 524290723     gbest52.seq
 524290241     gbest53.seq
 234781026     gbest54.seq
 524291463     gbest55.seq
 524292134     gbest56.seq
 524289401     gbest57.seq
 524289928     gbest58.seq
 524291256     gbest59.seq
 524289327     gbest6.seq
 524288919     gbest60.seq
 524290805     gbest61.seq
 524291130     gbest62.seq
 524291561     gbest63.seq
 524290299     gbest64.seq
 524292398     gbest65.seq
 524291408     gbest66.seq
 444047988     gbest67.seq
 524292777     gbest68.seq
 524288830     gbest69.seq
 524291514     gbest7.seq
 524290645     gbest70.seq
 524289099     gbest71.seq
 524291077     gbest72.seq
 524290392     gbest73.seq
 524291024     gbest74.seq
 524289540     gbest75.seq
 524297848     gbest76.seq
 524289142     gbest77.seq
 524288831     gbest78.seq
 524291543     gbest79.seq
 524291106     gbest8.seq
 164071177     gbest80.seq
 524288848     gbest81.seq
 524288861     gbest82.seq
 524290080     gbest83.seq
 524291034     gbest84.seq
 524289264     gbest85.seq
 524289494     gbest86.seq
 524290302     gbest87.seq
 524289186     gbest88.seq
 524290556     gbest89.seq
 524291048     gbest9.seq
 524290480     gbest90.seq
 524289085     gbest91.seq
 447098042     gbest92.seq
 524292244     gbest93.seq
 524289424     gbest94.seq
 524289595     gbest95.seq
 524289469     gbest96.seq
 524290518     gbest97.seq
 524291223     gbest98.seq
 524289658     gbest99.seq
 524290729     gbgss1.seq
 524290752     gbgss10.seq
 524291969     gbgss100.seq
 524291063     gbgss101.seq
 524290739     gbgss102.seq
 524290739     gbgss103.seq
 410583425     gbgss104.seq
 524290112     gbgss105.seq
 524289485     gbgss106.seq
 524290481     gbgss107.seq
 524290921     gbgss108.seq
 524288800     gbgss109.seq
 524290662     gbgss11.seq
 524290481     gbgss110.seq
 524289384     gbgss111.seq
 524290150     gbgss112.seq
 524289398     gbgss113.seq
 524290884     gbgss114.seq
 524289438     gbgss115.seq
  48765910     gbgss116.seq
 524291681     gbgss117.seq
 524291546     gbgss118.seq
 524290552     gbgss119.seq
 524289677     gbgss12.seq
 524288931     gbgss120.seq
 524289049     gbgss121.seq
 524290285     gbgss122.seq
 524290232     gbgss123.seq
 524290318     gbgss124.seq
 524288736     gbgss125.seq
 524290800     gbgss126.seq
 524291422     gbgss127.seq
 524291576     gbgss128.seq
 195531425     gbgss129.seq
 524291901     gbgss13.seq
 524289379     gbgss130.seq
 524291778     gbgss131.seq
 524290292     gbgss132.seq
 524291495     gbgss133.seq
 524289499     gbgss134.seq
 524291345     gbgss135.seq
 524290711     gbgss136.seq
 524290119     gbgss137.seq
 524290383     gbgss138.seq
 498447066     gbgss139.seq
 524291942     gbgss14.seq
 498422966     gbgss140.seq
 181241253     gbgss141.seq
 524290476     gbgss142.seq
 524290347     gbgss143.seq
 524290216     gbgss144.seq
 524289755     gbgss145.seq
 524291448     gbgss146.seq
 524291165     gbgss147.seq
 524290657     gbgss148.seq
 524288850     gbgss149.seq
 524289970     gbgss15.seq
 524288751     gbgss150.seq
 524291552     gbgss151.seq
 313847398     gbgss152.seq
 524289414     gbgss153.seq
 524290020     gbgss154.seq
 524292122     gbgss155.seq
 524289233     gbgss156.seq
 524290991     gbgss157.seq
 524290246     gbgss158.seq
 524290442     gbgss159.seq
 524290621     gbgss16.seq
 524290685     gbgss160.seq
 524288788     gbgss161.seq
 524289441     gbgss162.seq
 524290384     gbgss163.seq
 524290095     gbgss164.seq
 138395165     gbgss165.seq
 524289886     gbgss166.seq
 524290557     gbgss167.seq
 524290337     gbgss168.seq
 524288988     gbgss169.seq
 524290552     gbgss17.seq
 524289863     gbgss170.seq
 524291126     gbgss171.seq
 317660662     gbgss172.seq
 249998812     gbgss173.seq
 249997727     gbgss174.seq
 249999149     gbgss175.seq
 249999072     gbgss176.seq
  31806894     gbgss177.seq
 249997137     gbgss178.seq
 250000033     gbgss179.seq
 524289884     gbgss18.seq
 249998542     gbgss180.seq
 249998333     gbgss181.seq
 224919493     gbgss182.seq
 249998415     gbgss183.seq
 249999205     gbgss184.seq
 249999508     gbgss185.seq
 249999472     gbgss186.seq
 193957356     gbgss187.seq
 249997950     gbgss188.seq
 249998694     gbgss189.seq
 298339107     gbgss19.seq
 249998786     gbgss190.seq
 249998823     gbgss191.seq
 249998181     gbgss192.seq
  71082277     gbgss193.seq
 249999828     gbgss194.seq
   2112081     gbgss195.seq
  80348603     gbgss196.seq
 249999264     gbgss197.seq
 249998529     gbgss198.seq
  87602941     gbgss199.seq
 524290458     gbgss2.seq
 524290471     gbgss20.seq
 249999685     gbgss200.seq
 249998355     gbgss201.seq
 250000242     gbgss202.seq
 202974017     gbgss203.seq
 249999232     gbgss204.seq
 249999415     gbgss205.seq
 249999535     gbgss206.seq
 246297144     gbgss207.seq
 249997836     gbgss208.seq
 249999647     gbgss209.seq
 524289804     gbgss21.seq
 249998223     gbgss210.seq
 244710946     gbgss211.seq
 249999336     gbgss212.seq
 249996623     gbgss213.seq
 249999794     gbgss214.seq
 249996718     gbgss215.seq
 126591595     gbgss216.seq
 249997387     gbgss217.seq
 249997998     gbgss218.seq
 249999931     gbgss219.seq
 524289233     gbgss22.seq
 249998615     gbgss220.seq
  92409107     gbgss221.seq
 249999742     gbgss222.seq
 249999443     gbgss223.seq
 249998584     gbgss224.seq
 249998226     gbgss225.seq
 249999180     gbgss226.seq
 143902147     gbgss227.seq
 249997846     gbgss228.seq
 249999124     gbgss229.seq
 524288923     gbgss23.seq
 249997821     gbgss230.seq
 249997789     gbgss231.seq
  84917634     gbgss232.seq
 249999461     gbgss233.seq
 249999350     gbgss234.seq
 249998406     gbgss235.seq
 249998619     gbgss236.seq
 249999398     gbgss237.seq
 249998013     gbgss238.seq
 107958198     gbgss239.seq
 524288785     gbgss24.seq
 249999424     gbgss240.seq
 249999963     gbgss241.seq
 249997369     gbgss242.seq
  43648880     gbgss243.seq
  52925443     gbgss244.seq
 249999101     gbgss245.seq
 249999225     gbgss246.seq
 249999246     gbgss247.seq
 250000135     gbgss248.seq
 249999001     gbgss249.seq
 524291480     gbgss25.seq
 249999200     gbgss250.seq
 100152796     gbgss251.seq
 249999617     gbgss252.seq
 250000113     gbgss253.seq
 249997380     gbgss254.seq
 249999823     gbgss255.seq
  27507329     gbgss256.seq
 249997661     gbgss257.seq
 249999221     gbgss258.seq
 249996423     gbgss259.seq
 524288954     gbgss26.seq
 249997687     gbgss260.seq
 249999776     gbgss261.seq
 249999649     gbgss262.seq
 191301715     gbgss263.seq
 249998299     gbgss264.seq
 249999964     gbgss265.seq
 249999490     gbgss266.seq
 227730674     gbgss267.seq
 249998576     gbgss268.seq
 250000163     gbgss269.seq
 524291975     gbgss27.seq
 249999363     gbgss270.seq
 249998261     gbgss271.seq
 249998426     gbgss272.seq
  67465568     gbgss273.seq
 249999961     gbgss274.seq
 249999246     gbgss275.seq
 249997183     gbgss276.seq
 249998878     gbgss277.seq
 249998009     gbgss278.seq
 249998219     gbgss279.seq
 524288772     gbgss28.seq
 249997997     gbgss280.seq
 249999577     gbgss281.seq
  76845250     gbgss282.seq
 249999562     gbgss283.seq
 249998752     gbgss284.seq
 249999600     gbgss285.seq
 249999029     gbgss286.seq
 221982324     gbgss287.seq
 249999829     gbgss288.seq
 250000049     gbgss289.seq
 524291032     gbgss29.seq
 249999422     gbgss290.seq
 249998101     gbgss291.seq
  91611181     gbgss292.seq
 249998405     gbgss293.seq
 250000234     gbgss294.seq
 249999990     gbgss295.seq
 249997511     gbgss296.seq
 149647840     gbgss297.seq
 524288872     gbgss3.seq
 524290096     gbgss30.seq
  26680428     gbgss31.seq
 524291144     gbgss32.seq
 524289799     gbgss33.seq
 524290542     gbgss34.seq
 524289125     gbgss35.seq
 524290210     gbgss36.seq
 524289453     gbgss37.seq
 524289830     gbgss38.seq
 490815577     gbgss39.seq
 524291733     gbgss4.seq
 524288787     gbgss40.seq
 524291007     gbgss41.seq
 524290160     gbgss42.seq
  20596372     gbgss43.seq
 524291556     gbgss44.seq
 524291233     gbgss45.seq
 524289151     gbgss46.seq
 524290640     gbgss47.seq
 218676597     gbgss48.seq
 524290958     gbgss49.seq
 160046964     gbgss5.seq
 524290909     gbgss50.seq
 524291681     gbgss51.seq
 524289937     gbgss52.seq
 524290102     gbgss53.seq
 524291157     gbgss54.seq
 524290490     gbgss55.seq
 524290788     gbgss56.seq
 524291114     gbgss57.seq
 524288839     gbgss58.seq
 524290414     gbgss59.seq
 524291243     gbgss6.seq
  20689269     gbgss60.seq
 524289098     gbgss61.seq
 524291174     gbgss62.seq
 524290209     gbgss63.seq
 455616847     gbgss64.seq
 524290971     gbgss65.seq
 524288880     gbgss66.seq
 524289481     gbgss67.seq
 524289587     gbgss68.seq
 524289588     gbgss69.seq
 524291150     gbgss7.seq
 524291605     gbgss70.seq
 524291405     gbgss71.seq
 524291145     gbgss72.seq
 524290090     gbgss73.seq
 524290878     gbgss74.seq
 524290934     gbgss75.seq
 524291875     gbgss76.seq
  36078840     gbgss77.seq
 524290678     gbgss78.seq
 524290943     gbgss79.seq
 524291661     gbgss8.seq
 524291336     gbgss80.seq
 524290090     gbgss81.seq
 524290258     gbgss82.seq
 524290495     gbgss83.seq
 524290936     gbgss84.seq
 524290971     gbgss85.seq
 524290546     gbgss86.seq
 524290397     gbgss87.seq
 524289267     gbgss88.seq
 382096808     gbgss89.seq
 524292433     gbgss9.seq
 524291919     gbgss90.seq
 524289553     gbgss91.seq
 524292535     gbgss92.seq
 524291749     gbgss93.seq
 524291967     gbgss94.seq
 524289937     gbgss95.seq
 524291779     gbgss96.seq
 524292054     gbgss97.seq
 524288810     gbgss98.seq
 524290782     gbgss99.seq
 249989230     gbhtc1.seq
 249999562     gbhtc10.seq
 249999487     gbhtc11.seq
 108300890     gbhtc12.seq
 250000092     gbhtc13.seq
 249998895     gbhtc14.seq
 113803331     gbhtc15.seq
 249995319     gbhtc2.seq
 249993906     gbhtc3.seq
 249998396     gbhtc4.seq
 249989366     gbhtc5.seq
 249989186     gbhtc6.seq
 249996567     gbhtc7.seq
  85908087     gbhtc8.seq
 249998301     gbhtc9.seq
 249935144     gbhtg1.seq
 249953485     gbhtg10.seq
 249912145     gbhtg100.seq
 249866482     gbhtg101.seq
 249548804     gbhtg102.seq
 249888580     gbhtg103.seq
   3687995     gbhtg104.seq
 249804514     gbhtg105.seq
 249882098     gbhtg106.seq
 249837557     gbhtg107.seq
 249894606     gbhtg108.seq
 249975928     gbhtg109.seq
    799345     gbhtg11.seq
 249776742     gbhtg110.seq
 167857331     gbhtg111.seq
 249852317     gbhtg112.seq
 249920372     gbhtg113.seq
 249857995     gbhtg114.seq
 249908170     gbhtg115.seq
 249998774     gbhtg116.seq
 249966339     gbhtg117.seq
 249942541     gbhtg118.seq
 219055923     gbhtg119.seq
 249887544     gbhtg12.seq
 249984475     gbhtg120.seq
 249895000     gbhtg121.seq
 249934198     gbhtg122.seq
 249898759     gbhtg123.seq
 249889536     gbhtg124.seq
 249871990     gbhtg125.seq
 249847772     gbhtg126.seq
 249871616     gbhtg127.seq
  34589469     gbhtg128.seq
 249817396     gbhtg129.seq
 249967505     gbhtg13.seq
 249907700     gbhtg130.seq
 249866351     gbhtg131.seq
 249835929     gbhtg132.seq
 249858212     gbhtg133.seq
 136616612     gbhtg134.seq
 249860736     gbhtg135.seq
 249838185     gbhtg136.seq
 249821150     gbhtg137.seq
 249911176     gbhtg138.seq
 249980071     gbhtg139.seq
 249584228     gbhtg14.seq
 134314079     gbhtg140.seq
 249758419     gbhtg141.seq
 249798662     gbhtg142.seq
 249841930     gbhtg143.seq
 249822541     gbhtg144.seq
 249956174     gbhtg145.seq
 249893731     gbhtg146.seq
 249870843     gbhtg147.seq
 249924371     gbhtg148.seq
 249906891     gbhtg149.seq
 249771919     gbhtg15.seq
 249889054     gbhtg150.seq
 132326228     gbhtg151.seq
 249738494     gbhtg16.seq
 249165958     gbhtg17.seq
 249979927     gbhtg18.seq
 249676768     gbhtg19.seq
 249996486     gbhtg2.seq
 249986049     gbhtg20.seq
 237141740     gbhtg21.seq
 249756771     gbhtg22.seq
 249864562     gbhtg23.seq
 249983387     gbhtg24.seq
 249917977     gbhtg25.seq
 249757014     gbhtg26.seq
 249887703     gbhtg27.seq
 249957955     gbhtg28.seq
 249838323     gbhtg29.seq
 249996216     gbhtg3.seq
 249989476     gbhtg30.seq
 225321826     gbhtg31.seq
 249823604     gbhtg32.seq
 249917450     gbhtg33.seq
 249925293     gbhtg34.seq
 249914652     gbhtg35.seq
 249854022     gbhtg36.seq
 249811774     gbhtg37.seq
 249764394     gbhtg38.seq
 249623472     gbhtg39.seq
 249972436     gbhtg4.seq
 249836243     gbhtg40.seq
 224358139     gbhtg41.seq
 249873733     gbhtg42.seq
 249782842     gbhtg43.seq
 249972729     gbhtg44.seq
 249775813     gbhtg45.seq
 249970573     gbhtg46.seq
 249705359     gbhtg47.seq
 249862674     gbhtg48.seq
 249890010     gbhtg49.seq
 249908886     gbhtg5.seq
 249899853     gbhtg50.seq
 234810112     gbhtg51.seq
 249734770     gbhtg52.seq
 249974903     gbhtg53.seq
 249784976     gbhtg54.seq
 249720573     gbhtg55.seq
 249959670     gbhtg56.seq
  18795807     gbhtg57.seq
 249859956     gbhtg58.seq
 249826448     gbhtg59.seq
 249992697     gbhtg6.seq
 249998076     gbhtg60.seq
 249924538     gbhtg61.seq
 225131068     gbhtg62.seq
 249886180     gbhtg63.seq
 249907389     gbhtg64.seq
 249800911     gbhtg65.seq
 249764876     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249978568     gbhtg69.seq
 249808376     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249764380     gbhtg72.seq
 223417343     gbhtg73.seq
 249931059     gbhtg74.seq
 249860417     gbhtg75.seq
 249999268     gbhtg76.seq
 249942533     gbhtg77.seq
 234936169     gbhtg78.seq
 249847337     gbhtg79.seq
 249827069     gbhtg8.seq
 249936222     gbhtg80.seq
 249825721     gbhtg81.seq
 249853414     gbhtg82.seq
 202266984     gbhtg83.seq
 249839026     gbhtg84.seq
 249926412     gbhtg85.seq
 249824350     gbhtg86.seq
 249844577     gbhtg87.seq
 205982515     gbhtg88.seq
 249846277     gbhtg89.seq
 249952738     gbhtg9.seq
 249834701     gbhtg90.seq
 249734978     gbhtg91.seq
 249850998     gbhtg92.seq
 194386745     gbhtg93.seq
 249945634     gbhtg94.seq
 249959350     gbhtg95.seq
 249865002     gbhtg96.seq
 249788493     gbhtg97.seq
 161658952     gbhtg98.seq
 249871186     gbhtg99.seq
 249997842     gbinv1.seq
 249996971     gbinv10.seq
 249999545     gbinv100.seq
 249995664     gbinv101.seq
 249998338     gbinv102.seq
 249793471     gbinv103.seq
 249981535     gbinv104.seq
 249997903     gbinv105.seq
 243824572     gbinv106.seq
  52925611     gbinv107.seq
 249973860     gbinv108.seq
 249946261     gbinv109.seq
 249999983     gbinv11.seq
 249988320     gbinv110.seq
 249999396     gbinv111.seq
  25043807     gbinv112.seq
 250000131     gbinv113.seq
 249997724     gbinv114.seq
  59918656     gbinv115.seq
 249998579     gbinv116.seq
 249999306     gbinv117.seq
 249997126     gbinv118.seq
 249995555     gbinv119.seq
 249997871     gbinv12.seq
 146988364     gbinv120.seq
 249995603     gbinv121.seq
 249999045     gbinv122.seq
 249999297     gbinv123.seq
 249999642     gbinv124.seq
 249998443     gbinv125.seq
 249999508     gbinv126.seq
 249999174     gbinv127.seq
   3539663     gbinv128.seq
  33967260     gbinv13.seq
 249997545     gbinv14.seq
 249999161     gbinv15.seq
 249998284     gbinv16.seq
 165140276     gbinv17.seq
 249998084     gbinv18.seq
 249478866     gbinv19.seq
 249859243     gbinv2.seq
 249997729     gbinv20.seq
 249999999     gbinv21.seq
 249998561     gbinv22.seq
   6322972     gbinv23.seq
 230023543     gbinv24.seq
 175506967     gbinv25.seq
 249996066     gbinv26.seq
 249999895     gbinv27.seq
 222776584     gbinv28.seq
 249997539     gbinv29.seq
 249866998     gbinv3.seq
 250000153     gbinv30.seq
 249997175     gbinv31.seq
 249996736     gbinv32.seq
 179281661     gbinv33.seq
 249999751     gbinv34.seq
 249996681     gbinv35.seq
 249998516     gbinv36.seq
 249996195     gbinv37.seq
 171032729     gbinv38.seq
 250000063     gbinv39.seq
 214629249     gbinv4.seq
 249996157     gbinv40.seq
 250000224     gbinv41.seq
 249997786     gbinv42.seq
 250000012     gbinv43.seq
 249996229     gbinv44.seq
 106009189     gbinv45.seq
 249998098     gbinv46.seq
 249998626     gbinv47.seq
 250000092     gbinv48.seq
 202781615     gbinv49.seq
 250000091     gbinv5.seq
 249949092     gbinv50.seq
 249993012     gbinv51.seq
 247563396     gbinv52.seq
 249910349     gbinv53.seq
 249932741     gbinv54.seq
 249796765     gbinv55.seq
 249978785     gbinv56.seq
 220286824     gbinv57.seq
 249997947     gbinv58.seq
 249993437     gbinv59.seq
 249997403     gbinv6.seq
 249995495     gbinv60.seq
 249997709     gbinv61.seq
  51747128     gbinv62.seq
 249996142     gbinv63.seq
 249961763     gbinv64.seq
 249996526     gbinv65.seq
 249990785     gbinv66.seq
 249983105     gbinv67.seq
 249977710     gbinv68.seq
 249994985     gbinv69.seq
 249977634     gbinv7.seq
 249998590     gbinv70.seq
 249999068     gbinv71.seq
 224842193     gbinv72.seq
 249989083     gbinv73.seq
 249979519     gbinv74.seq
 249994236     gbinv75.seq
 249996734     gbinv76.seq
 250000084     gbinv77.seq
 249999397     gbinv78.seq
 249994988     gbinv79.seq
 225999299     gbinv8.seq
 249998647     gbinv80.seq
  30318265     gbinv81.seq
 249955084     gbinv82.seq
 249996848     gbinv83.seq
 249991951     gbinv84.seq
 249976129     gbinv85.seq
 249999979     gbinv86.seq
 249983497     gbinv87.seq
 249996597     gbinv88.seq
  89129685     gbinv89.seq
 249997480     gbinv9.seq
 249973374     gbinv90.seq
 249899692     gbinv91.seq
 249979395     gbinv92.seq
 249998794     gbinv93.seq
 249994231     gbinv94.seq
 249966581     gbinv95.seq
 249983746     gbinv96.seq
 249995960     gbinv97.seq
 249994416     gbinv98.seq
 151414968     gbinv99.seq
 249698708     gbmam1.seq
 249997944     gbmam2.seq
 249992885     gbmam3.seq
 249938833     gbmam4.seq
 249999863     gbmam5.seq
 249999980     gbmam6.seq
 249994966     gbmam7.seq
 249999670     gbmam8.seq
 223278985     gbmam9.seq
  45993133     gbnew.txt
 249998906     gbpat1.seq
 249999603     gbpat10.seq
 249998996     gbpat100.seq
 249999065     gbpat101.seq
 249999793     gbpat102.seq
 149112469     gbpat103.seq
 249999880     gbpat104.seq
 249998929     gbpat105.seq
 249928220     gbpat106.seq
 249824879     gbpat107.seq
 249998856     gbpat108.seq
 192955043     gbpat109.seq
 179663077     gbpat11.seq
 249999682     gbpat110.seq
 249999688     gbpat111.seq
 249998933     gbpat112.seq
  80196259     gbpat113.seq
 249999940     gbpat114.seq
 249999564     gbpat115.seq
 249645590     gbpat116.seq
 250000129     gbpat117.seq
 249999583     gbpat118.seq
  67188949     gbpat119.seq
 249998469     gbpat12.seq
 249998923     gbpat120.seq
 250000184     gbpat121.seq
 249999601     gbpat122.seq
 249999810     gbpat123.seq
 160252740     gbpat124.seq
 249999692     gbpat125.seq
 250000171     gbpat126.seq
 234780519     gbpat127.seq
 249991536     gbpat128.seq
 249970935     gbpat129.seq
 249998831     gbpat13.seq
 249999745     gbpat130.seq
 249999400     gbpat131.seq
 249994345     gbpat132.seq
  66832984     gbpat133.seq
 249992315     gbpat134.seq
 249999844     gbpat135.seq
 250000121     gbpat136.seq
 250000131     gbpat137.seq
 249999522     gbpat138.seq
  18435141     gbpat139.seq
 250000227     gbpat14.seq
 249999655     gbpat140.seq
 249998828     gbpat141.seq
 249999803     gbpat142.seq
 249999630     gbpat143.seq
  46945926     gbpat144.seq
 250000154     gbpat145.seq
 249998813     gbpat146.seq
 249998963     gbpat147.seq
 234578566     gbpat148.seq
 249999624     gbpat149.seq
 249999491     gbpat15.seq
 249999668     gbpat150.seq
 250000026     gbpat151.seq
  86296194     gbpat152.seq
 249999922     gbpat153.seq
 249998210     gbpat154.seq
 249999334     gbpat155.seq
  63832714     gbpat156.seq
 249998297     gbpat157.seq
 249999222     gbpat158.seq
 249999308     gbpat159.seq
 249999417     gbpat16.seq
 249997833     gbpat160.seq
 249999035     gbpat161.seq
 249998951     gbpat162.seq
 223167897     gbpat163.seq
 250000249     gbpat164.seq
 249999893     gbpat165.seq
 249999893     gbpat166.seq
 220539897     gbpat167.seq
 249999753     gbpat168.seq
 249999618     gbpat169.seq
  75502818     gbpat17.seq
 249999708     gbpat170.seq
  12390141     gbpat171.seq
 249996105     gbpat172.seq
 249998216     gbpat173.seq
 249999685     gbpat174.seq
 249999815     gbpat175.seq
  90672276     gbpat176.seq
 249999432     gbpat177.seq
 249999105     gbpat178.seq
 249998633     gbpat179.seq
 250000027     gbpat18.seq
 250000180     gbpat180.seq
 249989940     gbpat181.seq
 249999793     gbpat182.seq
 218407779     gbpat183.seq
 250000095     gbpat184.seq
 249998159     gbpat185.seq
 249999350     gbpat186.seq
 249999120     gbpat187.seq
 214599232     gbpat188.seq
 249997921     gbpat189.seq
 249999209     gbpat19.seq
 249188775     gbpat190.seq
 249996690     gbpat191.seq
 249999025     gbpat192.seq
 181195953     gbpat193.seq
 249548891     gbpat194.seq
 248502767     gbpat195.seq
 249999679     gbpat196.seq
 249999536     gbpat197.seq
 249895085     gbpat198.seq
 249999237     gbpat199.seq
 249999669     gbpat2.seq
 249999254     gbpat20.seq
 217346363     gbpat200.seq
 249999980     gbpat201.seq
 250000152     gbpat202.seq
 249997781     gbpat203.seq
 249999654     gbpat204.seq
  66661864     gbpat205.seq
 249999561     gbpat206.seq
 250000169     gbpat207.seq
 249998713     gbpat208.seq
 249993527     gbpat209.seq
 249999509     gbpat21.seq
 249998452     gbpat210.seq
 243934539     gbpat211.seq
 250000102     gbpat212.seq
 249999282     gbpat213.seq
 249999929     gbpat214.seq
 249998669     gbpat215.seq
 249999447     gbpat216.seq
 249998298     gbpat217.seq
 110541848     gbpat218.seq
 249999438     gbpat219.seq
 186217890     gbpat22.seq
 250000099     gbpat220.seq
 250000099     gbpat221.seq
 249999759     gbpat222.seq
  70063961     gbpat223.seq
 250000078     gbpat23.seq
 249992508     gbpat24.seq
 249999224     gbpat25.seq
 249999540     gbpat26.seq
  71460465     gbpat27.seq
 249995744     gbpat28.seq
 250000229     gbpat29.seq
 249998526     gbpat3.seq
 249998395     gbpat30.seq
 249997880     gbpat31.seq
 249995754     gbpat32.seq
 179826181     gbpat33.seq
 250000210     gbpat34.seq
 249999033     gbpat35.seq
 249999777     gbpat36.seq
 249999766     gbpat37.seq
 249998949     gbpat38.seq
 249998692     gbpat39.seq
 249999637     gbpat4.seq
 148032134     gbpat40.seq
 249999325     gbpat41.seq
 249987505     gbpat42.seq
 249999714     gbpat43.seq
 249998537     gbpat44.seq
 249998858     gbpat45.seq
 249890663     gbpat46.seq
 249998717     gbpat47.seq
 249995879     gbpat48.seq
 171937585     gbpat49.seq
  71655067     gbpat5.seq
 249997717     gbpat50.seq
 249999740     gbpat51.seq
 250000064     gbpat52.seq
 250000038     gbpat53.seq
 222935237     gbpat54.seq
 249999057     gbpat55.seq
 249999847     gbpat56.seq
 249999517     gbpat57.seq
 164748972     gbpat58.seq
 249909703     gbpat59.seq
 249998966     gbpat6.seq
 249995801     gbpat60.seq
 249999826     gbpat61.seq
 249999344     gbpat62.seq
 135543467     gbpat63.seq
 249997659     gbpat64.seq
 249998123     gbpat65.seq
 249996994     gbpat66.seq
 249998077     gbpat67.seq
 250000144     gbpat68.seq
 249999240     gbpat69.seq
 250000141     gbpat7.seq
 144901242     gbpat70.seq
 249999880     gbpat71.seq
 249999899     gbpat72.seq
 249998837     gbpat73.seq
 244409107     gbpat74.seq
 248969005     gbpat75.seq
 244458666     gbpat76.seq
 247876384     gbpat77.seq
 249998988     gbpat78.seq
 160632775     gbpat79.seq
 249993543     gbpat8.seq
 250000121     gbpat80.seq
 249999657     gbpat81.seq
 249999470     gbpat82.seq
 249999644     gbpat83.seq
 249996988     gbpat84.seq
 249999137     gbpat85.seq
  99354265     gbpat86.seq
 249156968     gbpat87.seq
 249999089     gbpat88.seq
 249999867     gbpat89.seq
 249999815     gbpat9.seq
 249999384     gbpat90.seq
 249999113     gbpat91.seq
 249999495     gbpat92.seq
 145308021     gbpat93.seq
 249999867     gbpat94.seq
 249998960     gbpat95.seq
 249999939     gbpat96.seq
 250000257     gbpat97.seq
 196971900     gbpat98.seq
 249999051     gbpat99.seq
 249972436     gbphg1.seq
 235607418     gbphg2.seq
 249999054     gbpln1.seq
 143440506     gbpln10.seq
 249999623     gbpln100.seq
 249999309     gbpln101.seq
  73388881     gbpln102.seq
 249999624     gbpln103.seq
 250000073     gbpln104.seq
 249532464     gbpln105.seq
 241161954     gbpln106.seq
 240377573     gbpln107.seq
 231418530     gbpln108.seq
 230146972     gbpln109.seq
 249999395     gbpln11.seq
 229811710     gbpln110.seq
 249929399     gbpln111.seq
  70901137     gbpln112.seq
 249993854     gbpln12.seq
 249996435     gbpln13.seq
 249910133     gbpln14.seq
 217146458     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
 249765859     gbpln19.seq
 249999961     gbpln2.seq
 249812318     gbpln20.seq
 249158034     gbpln21.seq
 249858901     gbpln22.seq
  95621814     gbpln23.seq
 250000194     gbpln24.seq
 100237824     gbpln25.seq
 249997761     gbpln26.seq
 141221913     gbpln27.seq
 205635929     gbpln28.seq
  85568252     gbpln29.seq
 249852555     gbpln3.seq
 193636575     gbpln30.seq
 220248685     gbpln31.seq
 238613366     gbpln32.seq
 249133968     gbpln33.seq
 247513250     gbpln34.seq
 249326251     gbpln35.seq
 248954342     gbpln36.seq
 249849988     gbpln37.seq
 249059449     gbpln38.seq
 249995908     gbpln39.seq
 249859323     gbpln4.seq
 249875012     gbpln40.seq
 248313235     gbpln41.seq
 248963540     gbpln42.seq
 249901906     gbpln43.seq
  62792803     gbpln44.seq
  75057058     gbpln45.seq
 249999516     gbpln46.seq
 249999551     gbpln47.seq
 249999100     gbpln48.seq
 114814609     gbpln49.seq
 249947913     gbpln5.seq
 249999777     gbpln50.seq
 250000190     gbpln51.seq
 249999323     gbpln52.seq
 250000242     gbpln53.seq
 147514777     gbpln54.seq
 249996348     gbpln55.seq
 249998097     gbpln56.seq
 249994920     gbpln57.seq
 249846446     gbpln58.seq
 245038503     gbpln59.seq
 249870691     gbpln6.seq
 249952836     gbpln60.seq
 249998893     gbpln61.seq
  46902053     gbpln62.seq
 249998844     gbpln63.seq
  49261790     gbpln64.seq
 212596304     gbpln65.seq
 249003271     gbpln66.seq
 180235132     gbpln67.seq
 996342198     gbpln68.seq
  52531537     gbpln69.seq
 249938518     gbpln7.seq
 208513260     gbpln70.seq
 171793674     gbpln71.seq
 197245569     gbpln72.seq
 177950644     gbpln73.seq
 196456279     gbpln74.seq
 189037066     gbpln75.seq
 220764647     gbpln76.seq
 227204520     gbpln77.seq
 224027197     gbpln78.seq
 248372246     gbpln79.seq
 249986897     gbpln8.seq
 188484236     gbpln80.seq
 249997545     gbpln81.seq
 249999605     gbpln82.seq
  61667837     gbpln83.seq
 249999320     gbpln84.seq
 250000045     gbpln85.seq
 249998668     gbpln86.seq
 249998651     gbpln87.seq
 250000175     gbpln88.seq
  20884798     gbpln89.seq
 249999884     gbpln9.seq
 249998821     gbpln90.seq
 249997600     gbpln91.seq
 249998395     gbpln92.seq
 249998756     gbpln93.seq
  74812168     gbpln94.seq
 249998417     gbpln95.seq
 249895994     gbpln96.seq
 249998870     gbpln97.seq
 177186828     gbpln98.seq
 249998483     gbpln99.seq
 149174221     gbpri1.seq
 249870179     gbpri10.seq
 140165575     gbpri11.seq
 249958771     gbpri12.seq
 249890671     gbpri13.seq
 249893869     gbpri14.seq
 249943075     gbpri15.seq
 249865806     gbpri16.seq
 249867568     gbpri17.seq
 249757996     gbpri18.seq
 249922745     gbpri19.seq
 249612634     gbpri2.seq
 249959015     gbpri20.seq
 249969459     gbpri21.seq
 249989622     gbpri22.seq
 124791426     gbpri23.seq
 177369161     gbpri24.seq
 249998152     gbpri25.seq
 211437612     gbpri26.seq
 249970724     gbpri27.seq
 249937746     gbpri28.seq
 249764453     gbpri29.seq
 249812509     gbpri3.seq
 249875140     gbpri30.seq
 249885937     gbpri31.seq
 249971794     gbpri32.seq
 249965632     gbpri33.seq
 249981740     gbpri34.seq
  28302072     gbpri35.seq
 249994555     gbpri36.seq
 249995846     gbpri37.seq
 249570332     gbpri38.seq
 249998047     gbpri39.seq
 249880912     gbpri4.seq
 249997660     gbpri40.seq
 197091177     gbpri41.seq
 249998163     gbpri42.seq
 249992196     gbpri43.seq
 249997436     gbpri44.seq
 249989331     gbpri45.seq
 249964660     gbpri46.seq
 249999463     gbpri47.seq
 249866562     gbpri48.seq
  17973221     gbpri49.seq
 249775249     gbpri5.seq
 249823386     gbpri6.seq
 249889519     gbpri7.seq
 249890872     gbpri8.seq
 249765218     gbpri9.seq
    401177     gbrel.txt
 249814280     gbrod1.seq
 249757507     gbrod10.seq
  72893024     gbrod11.seq
 249871281     gbrod12.seq
 249783723     gbrod13.seq
 249992851     gbrod14.seq
 249651610     gbrod15.seq
 249953745     gbrod16.seq
 249885180     gbrod17.seq
 249943440     gbrod18.seq
 249999342     gbrod19.seq
 249822901     gbrod2.seq
   6190543     gbrod20.seq
 249986058     gbrod21.seq
 249769182     gbrod22.seq
 191022450     gbrod23.seq
 249999389     gbrod24.seq
 249997712     gbrod25.seq
 249828865     gbrod26.seq
 249849902     gbrod27.seq
 249998848     gbrod28.seq
 249994929     gbrod29.seq
 249797567     gbrod3.seq
 249996030     gbrod30.seq
 132807604     gbrod31.seq
 249821271     gbrod4.seq
 249939675     gbrod5.seq
 249982439     gbrod6.seq
 249996750     gbrod7.seq
 249985988     gbrod8.seq
 249811337     gbrod9.seq
 249998240     gbsts1.seq
 249997655     gbsts10.seq
 210923828     gbsts11.seq
 249996524     gbsts12.seq
 249997672     gbsts13.seq
 249998816     gbsts14.seq
 249998853     gbsts15.seq
  24513582     gbsts16.seq
 250000234     gbsts17.seq
 249997278     gbsts18.seq
 249998788     gbsts19.seq
 249999610     gbsts2.seq
 186860616     gbsts20.seq
 249999519     gbsts3.seq
 249996850     gbsts4.seq
  40369056     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249998172     gbsts9.seq
 247962709     gbsyn1.seq
 249992132     gbsyn2.seq
 249973379     gbsyn3.seq
 249990159     gbsyn4.seq
 249945129     gbsyn5.seq
 249963975     gbsyn6.seq
 249996634     gbsyn7.seq
 110182289     gbsyn8.seq
 249998376     gbtsa1.seq
  56875503     gbtsa10.seq
 249999901     gbtsa100.seq
 249996512     gbtsa101.seq
 249998037     gbtsa102.seq
 249998827     gbtsa103.seq
 107388155     gbtsa104.seq
 249999743     gbtsa105.seq
 249999340     gbtsa106.seq
 249999346     gbtsa107.seq
 249997672     gbtsa108.seq
 249999551     gbtsa109.seq
 249999071     gbtsa11.seq
 249999728     gbtsa110.seq
 228551248     gbtsa111.seq
 249998448     gbtsa112.seq
 249998116     gbtsa113.seq
 249999828     gbtsa114.seq
 249998570     gbtsa115.seq
 249997860     gbtsa116.seq
  16572847     gbtsa117.seq
 249998403     gbtsa118.seq
 249999879     gbtsa119.seq
 249997101     gbtsa12.seq
 249998407     gbtsa120.seq
 220818721     gbtsa121.seq
 249996276     gbtsa122.seq
 249997772     gbtsa123.seq
 249996247     gbtsa124.seq
 249999172     gbtsa125.seq
 249998638     gbtsa126.seq
 249994711     gbtsa127.seq
 173622176     gbtsa128.seq
 249999326     gbtsa129.seq
 249999445     gbtsa13.seq
 249997095     gbtsa130.seq
 249998452     gbtsa131.seq
 249997998     gbtsa132.seq
 249999141     gbtsa133.seq
 249999792     gbtsa134.seq
   8254827     gbtsa135.seq
 249999027     gbtsa136.seq
 249999626     gbtsa137.seq
 249999337     gbtsa138.seq
 249997377     gbtsa139.seq
 250000126     gbtsa14.seq
 136260650     gbtsa140.seq
 249998131     gbtsa141.seq
 249999514     gbtsa142.seq
 249997541     gbtsa143.seq
 249997718     gbtsa144.seq
  35878567     gbtsa145.seq
 249999033     gbtsa146.seq
 249999594     gbtsa147.seq
 249997728     gbtsa148.seq
 249999490     gbtsa149.seq
 209212004     gbtsa15.seq
 249998415     gbtsa150.seq
 249999441     gbtsa151.seq
 249999497     gbtsa152.seq
 249998320     gbtsa153.seq
  53889829     gbtsa154.seq
 249998344     gbtsa155.seq
 249998929     gbtsa156.seq
 249999098     gbtsa157.seq
 249998969     gbtsa158.seq
 249999158     gbtsa159.seq
 249997341     gbtsa16.seq
 249999520     gbtsa160.seq
  84675301     gbtsa161.seq
 249999569     gbtsa162.seq
 249998179     gbtsa163.seq
 249997593     gbtsa164.seq
 133634227     gbtsa165.seq
 250000051     gbtsa166.seq
 249997064     gbtsa167.seq
 249996807     gbtsa168.seq
 249995565     gbtsa169.seq
 250000210     gbtsa17.seq
 249999016     gbtsa170.seq
 249999347     gbtsa171.seq
 212464283     gbtsa172.seq
 249998503     gbtsa173.seq
 249999717     gbtsa174.seq
 249994474     gbtsa175.seq
 249997289     gbtsa176.seq
 249992154     gbtsa177.seq
 249997673     gbtsa178.seq
  81609335     gbtsa179.seq
 249999364     gbtsa18.seq
 249994982     gbtsa180.seq
 249995250     gbtsa181.seq
 250000162     gbtsa182.seq
 249998719     gbtsa183.seq
 249998754     gbtsa184.seq
 249995172     gbtsa185.seq
 249994852     gbtsa186.seq
 174648412     gbtsa187.seq
 249996669     gbtsa188.seq
 249995836     gbtsa189.seq
 249995880     gbtsa19.seq
 249999262     gbtsa190.seq
 249994334     gbtsa191.seq
 249996107     gbtsa192.seq
 250000155     gbtsa193.seq
 249997178     gbtsa194.seq
  11145852     gbtsa195.seq
 249998556     gbtsa2.seq
 187754869     gbtsa20.seq
 249999954     gbtsa21.seq
 249997556     gbtsa22.seq
 249999595     gbtsa23.seq
 249998944     gbtsa24.seq
 110336988     gbtsa25.seq
 249998989     gbtsa26.seq
 249996697     gbtsa27.seq
 250000178     gbtsa28.seq
 249998473     gbtsa29.seq
 249999903     gbtsa3.seq
 249995742     gbtsa30.seq
  14687257     gbtsa31.seq
 249999462     gbtsa32.seq
 249999810     gbtsa33.seq
 249999214     gbtsa34.seq
 249999548     gbtsa35.seq
 249999071     gbtsa36.seq
 249997727     gbtsa37.seq
  77824344     gbtsa38.seq
 249998838     gbtsa39.seq
 249999415     gbtsa4.seq
 249998049     gbtsa40.seq
 249998580     gbtsa41.seq
 249998509     gbtsa42.seq
 249998813     gbtsa43.seq
 249998265     gbtsa44.seq
 249999019     gbtsa45.seq
  35343531     gbtsa46.seq
 249996002     gbtsa47.seq
 249997840     gbtsa48.seq
 249998336     gbtsa49.seq
 151717742     gbtsa5.seq
 249998974     gbtsa50.seq
  77464426     gbtsa51.seq
 249999788     gbtsa52.seq
 249999066     gbtsa53.seq
 249996389     gbtsa54.seq
 249998945     gbtsa55.seq
 141892200     gbtsa56.seq
 250000009     gbtsa57.seq
 249999189     gbtsa58.seq
 249999159     gbtsa59.seq
 249997875     gbtsa6.seq
 249996244     gbtsa60.seq
 249998322     gbtsa61.seq
 249999017     gbtsa62.seq
 249997739     gbtsa63.seq
 246411734     gbtsa64.seq
 249999221     gbtsa65.seq
 249998419     gbtsa66.seq
 249998283     gbtsa67.seq
 249998268     gbtsa68.seq
 250000204     gbtsa69.seq
 249998005     gbtsa7.seq
 249998985     gbtsa70.seq
 232171452     gbtsa71.seq
 249998934     gbtsa72.seq
 249999138     gbtsa73.seq
 249998810     gbtsa74.seq
 249999063     gbtsa75.seq
 249998126     gbtsa76.seq
 249999007     gbtsa77.seq
 185899455     gbtsa78.seq
 249999580     gbtsa79.seq
 249999806     gbtsa8.seq
 249999459     gbtsa80.seq
 250000060     gbtsa81.seq
 249998829     gbtsa82.seq
 249995363     gbtsa83.seq
 111281403     gbtsa84.seq
 249998427     gbtsa85.seq
 249999836     gbtsa86.seq
 250000051     gbtsa87.seq
 249999626     gbtsa88.seq
 249998399     gbtsa89.seq
 249999617     gbtsa9.seq
  45211978     gbtsa90.seq
 249999089     gbtsa91.seq
 249999676     gbtsa92.seq
 249999794     gbtsa93.seq
 249999476     gbtsa94.seq
 249997211     gbtsa95.seq
 150721457     gbtsa96.seq
 249997456     gbtsa97.seq
 249998115     gbtsa98.seq
 249999348     gbtsa99.seq
    742384     gbuna1.seq
 249998736     gbvrl1.seq
 249997252     gbvrl10.seq
 250000237     gbvrl11.seq
 249757947     gbvrl12.seq
 249998225     gbvrl13.seq
 121545996     gbvrl14.seq
 249992547     gbvrl15.seq
 249998247     gbvrl16.seq
 249999060     gbvrl17.seq
 249988563     gbvrl18.seq
 224521702     gbvrl19.seq
 249998172     gbvrl2.seq
 249993202     gbvrl20.seq
 249995607     gbvrl21.seq
 249997167     gbvrl22.seq
 249998346     gbvrl23.seq
 141394541     gbvrl24.seq
 249997785     gbvrl25.seq
 249996534     gbvrl26.seq
 249993539     gbvrl27.seq
 249999486     gbvrl28.seq
 249998532     gbvrl29.seq
 249997166     gbvrl3.seq
  63304074     gbvrl30.seq
 249997730     gbvrl31.seq
 249995214     gbvrl32.seq
 249994192     gbvrl33.seq
 249989885     gbvrl34.seq
 249998152     gbvrl35.seq
 106614444     gbvrl36.seq
 249999911     gbvrl4.seq
 249997735     gbvrl5.seq
  71464642     gbvrl6.seq
 249999204     gbvrl7.seq
 249998152     gbvrl8.seq
 249996040     gbvrl9.seq
 249803827     gbvrt1.seq
 249933908     gbvrt10.seq
 249996481     gbvrt11.seq
 139897239     gbvrt12.seq
 249844676     gbvrt13.seq
 249962318     gbvrt14.seq
 249948275     gbvrt15.seq
 249999825     gbvrt16.seq
 249994788     gbvrt17.seq
 249998230     gbvrt18.seq
  63163840     gbvrt19.seq
 249752033     gbvrt2.seq
 249934895     gbvrt20.seq
 249998841     gbvrt21.seq
 249999837     gbvrt22.seq
 249997527     gbvrt23.seq
 249998292     gbvrt24.seq
 100259843     gbvrt25.seq
 249996583     gbvrt26.seq
 249999516     gbvrt27.seq
 249999229     gbvrt28.seq
 195443231     gbvrt29.seq
 249999018     gbvrt3.seq
 249999520     gbvrt30.seq
 249999860     gbvrt31.seq
  18983673     gbvrt32.seq
 249999152     gbvrt33.seq
 144470361     gbvrt34.seq
 249998398     gbvrt35.seq
 230395419     gbvrt36.seq
 233222558     gbvrt37.seq
 230861845     gbvrt38.seq
 231153151     gbvrt39.seq
 249883708     gbvrt4.seq
 247028462     gbvrt40.seq
 249722933     gbvrt41.seq
 249597937     gbvrt42.seq
 249998177     gbvrt43.seq
 248731149     gbvrt44.seq
 249999792     gbvrt45.seq
  22127631     gbvrt46.seq
 192111461     gbvrt5.seq
 249999812     gbvrt6.seq
 249992012     gbvrt7.seq
 249821257     gbvrt8.seq
 249773983     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63779      86302622
BCT10        6835       89807902
BCT100       27         104026474
BCT101       23         101240152
BCT102       22         102814540
BCT103       22         103958922
BCT104       23         107772772
BCT105       23         107938575
BCT106       21         101718555
BCT107       22         104582791
BCT108       33         114036316
BCT109       44         107015551
BCT11        66         116102654
BCT110       21         65508021
BCT111       47         108832878
BCT112       58         108199898
BCT113       58         113097442
BCT114       64         112527181
BCT115       42         113787451
BCT116       42         113479075
BCT117       58         109473527
BCT118       41         101844998
BCT119       43         115007355
BCT12        76         117341384
BCT120       52         118377598
BCT121       55         111353415
BCT122       43         110620865
BCT123       47         114456936
BCT124       25         111282746
BCT125       62         113745883
BCT126       47         110606950
BCT127       34         109380643
BCT128       31         120103946
BCT129       47         114711881
BCT13        108        113715487
BCT130       50         111091086
BCT131       10         7202171
BCT132       77         115031386
BCT133       40         109188736
BCT134       64         108276113
BCT135       62         113153052
BCT136       75         109871070
BCT137       41         107473952
BCT138       66         109035815
BCT139       36         103654653
BCT14        65         108986169
BCT140       27         73278044
BCT141       43         107046942
BCT142       55         110072119
BCT143       46         107398225
BCT144       39         110438277
BCT145       46         106680639
BCT146       54         108340057
BCT147       52         110521312
BCT148       87         103661893
BCT149       67         53668183
BCT15        62         118453054
BCT150       203        89845400
BCT151       325        25743984
BCT152       1589       2511877
BCT153       3180       5275358
BCT154       6346       7804817
BCT155       12647      15076261
BCT156       25619      27729952
BCT157       50573      54087651
BCT158       75884      77896731
BCT159       71361      76846375
BCT16        63         121483590
BCT160       10272      92080142
BCT161       5305       94797469
BCT162       3322       102665459
BCT163       126        98294245
BCT164       40         104398375
BCT165       213        102908149
BCT166       6604       95467851
BCT167       24608      93890821
BCT168       18164      17898398
BCT169       71159      73483301
BCT17        46         123494319
BCT170       3688       102658848
BCT171       3947       100740033
BCT172       6540       99510813
BCT173       3403       96868780
BCT174       18275      101051987
BCT175       75534      78756760
BCT176       69690      76053558
BCT177       75830      78634173
BCT178       72453      77374119
BCT179       72830      74044341
BCT18        16129      61841716
BCT180       70115      76405336
BCT181       72665      75008156
BCT182       35194      97055476
BCT183       3036       150957900
BCT184       1411       177681647
BCT185       4003       105986995
BCT186       6477       106967682
BCT187       24561      53509471
BCT19        53926      85358182
BCT2         29054      100906204
BCT20        79         109838518
BCT21        143        95924047
BCT22        58         112822895
BCT23        53         111392505
BCT24        46         112848420
BCT25        57         112994744
BCT26        66         108817610
BCT27        36         96325907
BCT28        40         106881287
BCT29        59         107430269
BCT3         48         110791450
BCT30        74         111675186
BCT31        55         110045255
BCT32        63         106845588
BCT33        55         109391288
BCT34        53         108650404
BCT35        46         110496749
BCT36        95         109522868
BCT37        58         106383657
BCT38        67         109486091
BCT39        125        110095720
BCT4         56         110933776
BCT40        37         71643089
BCT41        200        111474100
BCT42        54         111189650
BCT43        35         108859141
BCT44        59         107860764
BCT45        56         105257887
BCT46        45         109560296
BCT47        74         109517239
BCT48        63         108815938
BCT49        45         105399191
BCT5         27015      102573054
BCT50        59         110379618
BCT51        70         108888422
BCT52        77         109259381
BCT53        22         22714378
BCT54        67         109336234
BCT55        60         104664634
BCT56        53         102829098
BCT57        56         108908758
BCT58        58         105643854
BCT59        54         109754097
BCT6         11301      17020334
BCT60        72         109941269
BCT61        61         106056484
BCT62        62         107001009
BCT63        40         113733092
BCT64        79         111042894
BCT65        50         106161732
BCT66        55         111967167
BCT67        37         44997032
BCT68        43         109822487
BCT69        50         116699480
BCT7         38996      83794564
BCT70        66         111693041
BCT71        50         111462164
BCT72        53         109197672
BCT73        98         115985017
BCT74        73         111137910
BCT75        80         106445736
BCT76        63         114250996
BCT77        69         114803403
BCT78        45         117172941
BCT79        61         113527943
BCT8         5507       93831194
BCT80        55         114714637
BCT81        11         29093403
BCT82        49         118138501
BCT83        260        114988679
BCT84        54         113927076
BCT85        66         111220207
BCT86        290        114921020
BCT87        57         110428849
BCT88        72         106848579
BCT89        36         111746554
BCT9         13773      85408705
BCT90        63         105970837
BCT91        47         85733208
BCT92        53         115277313
BCT93        56         109244680
BCT94        49         112843796
BCT95        55         109177666
BCT96        37         105690562
BCT97        58         105322615
BCT98        46         109369353
BCT99        20         61451953
ENV1         92506      71782253
ENV10        86242      70378702
ENV11        93131      72874089
ENV12        82343      86633022
ENV13        21775      18632477
ENV14        84746      80842890
ENV15        118359     43036897
ENV16        89130      77094358
ENV17        96425      67758527
ENV18        96086      63230701
ENV19        109691     66837388
ENV2         95271      70016304
ENV20        122078     64555516
ENV21        61251      82695561
ENV22        70043      85928848
ENV23        90496      74782607
ENV24        126925     36733381
ENV25        122961     29000826
ENV26        82458      18953503
ENV27        123100     49757616
ENV28        97823      67180972
ENV29        115026     56512449
ENV3         92476      68875000
ENV30        135887     52804908
ENV31        109123     60800032
ENV32        94716      65368909
ENV33        18935      18562604
ENV34        62536      84995133
ENV35        88889      73354941
ENV36        102539     44135258
ENV37        96888      56110928
ENV38        70842      54884991
ENV39        111238     47249676
ENV4         80604      77397757
ENV40        100857     61106267
ENV41        107052     61681040
ENV42        63680      90621071
ENV43        72572      78918504
ENV44        62024      84273803
ENV45        13482      18338429
ENV46        70513      78327836
ENV47        108012     49626725
ENV48        112479     56249027
ENV49        104656     61487267
ENV5         65091      91733805
ENV50        80407      42440581
ENV51        100603     44032951
ENV52        42860      53350456
ENV53        41971      54594945
ENV54        57539      57100268
ENV55        96535      61576166
ENV56        34840      19391754
ENV57        95156      61927864
ENV58        77636      77125168
ENV59        83621      61006377
ENV6         90650      81656088
ENV60        86118      68783720
ENV61        103659     51672898
ENV62        43894      34355026
ENV63        109701     46049551
ENV64        90172      60793247
ENV65        101178     51582103
ENV66        94611      55626095
ENV67        79320      75838842
ENV68        28583      20164836
ENV69        79854      88231917
ENV7         94636      74503418
ENV70        84572      50047855
ENV71        85028      61548726
ENV72        60007      72385025
ENV73        106051     30783469
ENV74        53316      13472602
ENV75        80015      71734330
ENV76        93686      56887289
ENV77        103715     58645495
ENV78        115802     29301884
ENV79        92933      58136120
ENV8         15888      1644910
ENV80        100944     53370125
ENV81        84696      56104624
ENV9         131427     31031172
EST1         159501     61802328
EST10        168131     72499632
EST100       233361     141731312
EST101       238400     125264527
EST102       190936     104641035
EST103       184910     102281938
EST104       100999     70384171
EST105       160793     120288276
EST106       172958     105841260
EST107       135186     84886306
EST108       63933      23809062
EST109       63338      22261346
EST11        169726     73904111
EST110       63851      23132992
EST111       63869      26850121
EST112       64350      23029605
EST113       64591      24539240
EST114       63594      26973131
EST115       63768      26213075
EST116       64045      27336267
EST117       63900      25168291
EST118       61272      33467809
EST119       119843     61544013
EST12        168200     70573039
EST120       160573     85942985
EST121       189615     92740527
EST122       149919     96379209
EST123       158992     93728871
EST124       131584     85605113
EST125       188300     90242987
EST126       157127     83570901
EST127       157284     84379603
EST128       156794     84864711
EST129       152190     85264256
EST13        68154      33126765
EST130       173901     93299172
EST131       183550     117075539
EST132       202782     102629898
EST133       159853     87283510
EST134       163149     83096547
EST135       142619     83732195
EST136       145144     90477617
EST137       97181      51077988
EST138       172748     97644217
EST139       245760     113605059
EST14        217465     108980497
EST140       155117     83721453
EST141       167367     92315316
EST142       150974     88278160
EST143       134207     82206752
EST144       154878     96754908
EST145       156093     85766834
EST146       124155     63397440
EST147       121182     65056389
EST148       127705     57796205
EST149       127063     51155584
EST15        169623     105962598
EST150       128411     51186238
EST151       114334     42626814
EST152       164028     82739443
EST153       176886     74091293
EST154       162712     110598389
EST155       199595     122330435
EST156       213393     121236952
EST157       175155     97092286
EST158       154488     108166543
EST159       142636     95261577
EST16        180090     112926477
EST160       155175     96500634
EST161       157880     82737563
EST162       139692     78598285
EST163       168673     93763626
EST164       69620      43295944
EST165       150544     92148531
EST166       192311     110540155
EST167       146119     84110406
EST168       142943     72479371
EST169       150205     87624571
EST17        195782     114230297
EST170       191356     104936119
EST171       156731     96071723
EST172       168076     82946768
EST173       127354     86839768
EST174       171491     100606255
EST175       173548     100424093
EST176       121181     67842074
EST177       157544     90740619
EST178       30540      17729917
EST179       170569     103118617
EST18        193393     122013488
EST180       181352     119525150
EST181       143869     116885277
EST182       194606     99424147
EST183       153314     103352235
EST184       155014     101642197
EST185       141174     81725853
EST186       176783     71794238
EST187       150843     84453256
EST188       157510     99993210
EST189       156944     96488440
EST19        158044     113134086
EST190       141170     84221417
EST191       158750     95859072
EST192       146219     93549248
EST193       129684     90614026
EST194       144251     88226593
EST195       136422     88904162
EST196       130145     93052603
EST197       163839     87123681
EST198       174664     96029966
EST199       174063     96950341
EST2         162336     61672462
EST20        190025     100138222
EST200       172176     96115488
EST201       169383     95544294
EST202       172285     95594859
EST203       174056     95360030
EST204       174614     96169379
EST205       18192      9806345
EST206       189439     105532431
EST207       206003     105139262
EST208       172523     102457315
EST209       180704     102079826
EST21        218166     107405793
EST210       201448     122896862
EST211       195437     112781560
EST212       196076     124110079
EST213       139047     93825871
EST214       215315     137159749
EST215       234785     121807706
EST216       162060     105834928
EST217       182467     100785620
EST218       202172     98902302
EST219       131872     94592926
EST22        191819     63013771
EST220       148056     87975689
EST221       210730     116039745
EST222       162070     105565551
EST223       103041     107165153
EST224       153036     104041630
EST225       159123     95540678
EST226       143087     103228804
EST227       224748     104394263
EST228       137198     101032298
EST229       122400     86893084
EST23        139361     39653446
EST230       138080     98032667
EST231       122379     87636273
EST232       143941     89820432
EST233       129925     88657713
EST234       140448     105177767
EST235       131295     92855841
EST236       123871     83715900
EST237       143099     88217845
EST238       156381     120764229
EST239       127742     119645065
EST24        102655     27796607
EST240       139513     103533991
EST241       174676     105875512
EST242       167299     103778620
EST243       154942     99566822
EST244       86399      49526139
EST245       166831     125575861
EST246       143657     106135506
EST247       155628     100205321
EST248       212003     97622004
EST249       187814     112127223
EST25        123286     51224263
EST250       154188     86339471
EST251       221420     29212160
EST252       219206     88856943
EST253       163749     121659302
EST254       174652     102396000
EST255       162934     108183573
EST256       110532     68711646
EST257       155368     113535798
EST258       185151     112377008
EST259       188990     97757369
EST26        214445     97482243
EST260       176469     110386191
EST261       162929     111989164
EST262       231281     108567357
EST263       276335     121231303
EST264       192359     114808731
EST265       187999     36473632
EST266       258849     125835160
EST267       64241      39334516
EST268       153631     97963687
EST269       166524     102544125
EST27        219438     110315416
EST270       166634     114397240
EST271       197519     102828342
EST272       157178     106947791
EST273       195692     114706346
EST274       199330     48559108
EST275       207034     44719813
EST276       182455     102797253
EST277       174414     117243944
EST278       183142     115439060
EST279       121058     69230265
EST28        190678     88655908
EST280       175338     114186488
EST281       170991     74639030
EST282       133250     83086946
EST283       130673     85402074
EST284       155226     102506513
EST285       260789     27544541
EST286       264780     24331037
EST287       148854     104717005
EST288       169389     109531227
EST289       159092     101957862
EST29        158284     69028702
EST290       154841     91892106
EST291       155220     15355904
EST292       209882     74157353
EST293       165188     107770324
EST294       177006     106854910
EST295       154543     99111244
EST296       200239     108063220
EST297       154609     111064544
EST298       166476     100986975
EST299       187923     115268487
EST3         151289     53610136
EST30        171878     69740395
EST300       179023     103077754
EST301       185911     99050048
EST302       184133     64478898
EST303       126380     44800250
EST304       183962     71376099
EST305       184620     69630571
EST306       185716     96324960
EST307       182542     131140832
EST308       145709     84786443
EST309       152637     92423686
EST31        150282     63723777
EST310       131502     100547939
EST311       161203     97284875
EST312       171363     98119824
EST313       150422     96805176
EST314       168112     95423655
EST315       160481     107298150
EST316       101302     71395426
EST317       164695     107981403
EST318       157390     108957517
EST319       180399     152896251
EST32        168565     76261125
EST320       171135     111582545
EST321       141978     76220968
EST322       143525     97892272
EST323       146920     100677265
EST324       135020     91022583
EST325       149269     99733082
EST326       150384     101084939
EST327       178082     110213165
EST328       148938     83567722
EST329       149247     85384772
EST33        175866     68077597
EST330       63018      39093068
EST331       150726     108453615
EST332       161433     96993037
EST333       143720     91399307
EST334       141894     89358150
EST335       204429     111207938
EST336       137854     75276432
EST337       91327      54475828
EST338       130564     85970021
EST339       137591     87338606
EST34        118554     40808305
EST340       125592     80281551
EST341       160055     85546058
EST342       216910     84948948
EST343       170727     87580061
EST344       106431     63357223
EST345       165374     103535687
EST346       146644     89712561
EST347       133028     88608696
EST348       136195     88706170
EST349       186238     121797658
EST35        96368      29580245
EST350       160867     97464501
EST351       154072     78273476
EST352       187817     127440396
EST353       117958     81855759
EST354       73377      44172579
EST355       137023     75401961
EST356       130580     78255723
EST357       147705     58299403
EST358       158729     32304756
EST359       43500      8859618
EST36        96776      30249119
EST360       155456     43061619
EST361       191067     121237551
EST362       243167     115581625
EST363       252427     115279517
EST364       183317     102484169
EST365       142086     91656852
EST366       137812     87052274
EST367       156113     92137831
EST368       194069     119212047
EST369       224952     61436926
EST37        95688      29026091
EST370       182483     111432575
EST371       16143      8752750
EST372       214561     117780726
EST373       204566     121516207
EST374       197102     107585343
EST375       149159     72794734
EST376       182006     119846018
EST377       177231     111695669
EST378       149920     116303221
EST379       180950     145551899
EST38        97558      29501403
EST380       156070     90093091
EST381       164657     106690875
EST382       187879     106859048
EST383       112100     57550191
EST384       204569     116344128
EST385       184697     107483660
EST386       203623     125424651
EST387       182998     120043680
EST388       205939     138827552
EST389       226659     129890635
EST39        97712      30979802
EST390       201111     138195205
EST391       208896     169498630
EST392       216401     134161695
EST393       160406     99896489
EST394       83273      40088018
EST395       177054     80264693
EST396       169045     13147259
EST397       155235     13793946
EST398       158481     32283515
EST399       158991     31657786
EST4         171413     67335703
EST40        27908      7150182
EST400       158572     32655225
EST401       147475     93615055
EST402       188319     113614029
EST403       160832     109949603
EST404       166132     99293004
EST405       149849     103446604
EST406       142700     99533242
EST407       139086     88248726
EST408       174858     123028822
EST409       140120     94859542
EST41        101354     52983819
EST410       181454     107708748
EST411       169053     30211096
EST412       165465     63168077
EST413       155343     109844915
EST414       166812     104706512
EST415       156293     98061471
EST416       162116     93124290
EST417       187274     124627479
EST418       143681     94727764
EST419       132076     90460784
EST42        119679     50944607
EST420       145367     89637174
EST421       156350     93769968
EST422       175053     93672173
EST423       159716     96353184
EST424       166715     95912105
EST425       172945     106159810
EST426       139173     87840297
EST427       101811     72699610
EST428       80519      61900901
EST429       105373     69420148
EST43        166339     91994018
EST430       158008     86920679
EST431       126505     76899480
EST432       139132     91207292
EST433       141922     83478151
EST434       166039     97292072
EST435       36527      24351896
EST436       178690     94303302
EST437       171221     108272044
EST438       146397     94599588
EST439       176595     79542225
EST44        170746     72332979
EST440       191387     104634536
EST441       157134     84587157
EST442       166518     96123395
EST443       218981     129354283
EST444       156550     104501387
EST445       172770     104490415
EST446       141033     94647798
EST447       135953     92697983
EST448       51576      30777622
EST449       207803     75682466
EST45        167864     85191199
EST450       183637     85279437
EST451       206085     88601473
EST452       198075     82868337
EST453       182266     112066056
EST454       182116     109323313
EST455       189676     111824977
EST456       198907     118067662
EST457       192218     110988153
EST458       187741     86780037
EST459       151180     85167691
EST46        168592     86929194
EST460       216872     125709155
EST461       171274     104915921
EST462       186565     114032752
EST463       189148     112510547
EST464       139238     100475950
EST465       150130     92014158
EST466       187681     95286698
EST467       147756     82916339
EST468       158419     86890696
EST469       175515     89506133
EST47        163794     88097122
EST470       181065     113250361
EST471       146085     85938503
EST472       180757     122004360
EST473       181528     122574262
EST474       187444     115417537
EST475       178567     101755625
EST476       169237     60925336
EST477       168887     61714937
EST478       85643      32705273
EST48        162697     83123456
EST49        160240     91376559
EST5         169496     66371436
EST50        162253     88476914
EST51        157698     99202285
EST52        159905     70045524
EST53        147387     82633764
EST54        71452      47286422
EST55        167551     70093416
EST56        165237     74994967
EST57        165115     91163079
EST58        159315     97123080
EST59        156885     102269319
EST6         172144     67171295
EST60        165162     99269547
EST61        160367     108422686
EST62        172074     80429764
EST63        174092     93562916
EST64        155377     84277278
EST65        148849     81604063
EST66        159038     98475239
EST67        130937     74806590
EST68        150049     91956359
EST69        195899     108755039
EST7         170569     73073078
EST70        181358     95118943
EST71        222268     121811975
EST72        187088     111911239
EST73        203916     120914502
EST74        164720     90861392
EST75        132406     60407217
EST76        138087     68025374
EST77        158148     98320852
EST78        157444     97414796
EST79        142844     78771547
EST8         180022     73161863
EST80        45758      21298109
EST81        164120     100517016
EST82        212712     115152153
EST83        224809     124302995
EST84        200938     94556782
EST85        212097     93357559
EST86        161349     93009445
EST87        144192     87465270
EST88        164572     80938149
EST89        158892     80011622
EST9         169002     69440203
EST90        153684     102374026
EST91        151685     89027333
EST92        130895     84656704
EST93        156187     113020766
EST94        141252     103424425
EST95        142079     101607275
EST96        141264     97661140
EST97        147747     81861908
EST98        178941     111019364
EST99        223924     135684946
GSS1         200936     87992234
GSS10        132678     60725407
GSS100       145433     114443307
GSS101       141764     116180696
GSS102       143557     116922653
GSS103       168429     129374908
GSS104       146871     80681582
GSS105       192093     121268744
GSS106       168801     112804438
GSS107       198977     116657936
GSS108       205228     134836884
GSS109       209582     138196637
GSS11        137125     73873683
GSS110       207319     140855103
GSS111       206094     142303923
GSS112       205169     143521479
GSS113       204901     143984139
GSS114       202032     146594787
GSS115       182146     139160439
GSS116       16142      9749832
GSS117       133162     84221146
GSS118       170171     80215123
GSS119       183838     79340378
GSS12        148408     75887623
GSS120       170038     148151586
GSS121       177768     120688140
GSS122       180158     146212795
GSS123       187658     120758196
GSS124       186937     139012163
GSS125       192373     127295283
GSS126       191990     93430669
GSS127       167409     156248815
GSS128       163850     114227824
GSS129       60079      36198950
GSS13        145705     69122709
GSS130       170924     155391140
GSS131       172238     154355826
GSS132       172284     155048214
GSS133       173670     154060692
GSS134       171880     154915342
GSS135       180832     138740239
GSS136       178923     146931127
GSS137       165752     119153036
GSS138       190644     95939895
GSS139       258271     39824246
GSS14        171182     85474120
GSS140       258271     39805527
GSS141       93944      14434436
GSS142       255964     58806066
GSS143       260425     57449147
GSS144       191584     85669441
GSS145       196825     67708922
GSS146       186418     148660517
GSS147       182920     151520220
GSS148       168596     155735624
GSS149       171017     157772250
GSS15        161662     98215904
GSS150       237956     70702787
GSS151       226884     82530087
GSS152       129644     52239937
GSS153       209214     56380289
GSS154       157764     95866841
GSS155       180940     114424248
GSS156       136390     86959180
GSS157       166603     133350150
GSS158       184575     161567457
GSS159       194060     159479909
GSS16        173468     87346240
GSS160       191250     124782939
GSS161       217192     138226755
GSS162       221457     132894528
GSS163       158267     97771251
GSS164       149737     86096246
GSS165       42516      31039005
GSS166       212621     158651660
GSS167       189244     95373371
GSS168       175541     76343351
GSS169       207932     161379571
GSS17        184247     114474687
GSS170       210227     162878969
GSS171       207337     164918552
GSS172       125942     96510579
GSS173       87032      63853715
GSS174       83577      62785783
GSS175       103114     48365963
GSS176       68934      58596097
GSS177       8570       7691659
GSS178       68591      57924394
GSS179       69224      56650935
GSS18        192256     113979254
GSS180       69460      56187403
GSS181       71202      55998401
GSS182       68561      51865315
GSS183       75915      58209304
GSS184       86540      74277212
GSS185       81317      44384966
GSS186       92266      45108910
GSS187       65131      48539953
GSS188       77811      61666620
GSS189       70214      59194054
GSS19        108180     48451086
GSS190       68204      63291319
GSS191       62732      52926209
GSS192       94994      42346465
GSS193       19508      4537157
GSS194       112930     70870954
GSS195       830        565879
GSS196       23226      28867035
GSS197       109084     70678875
GSS198       84403      34582519
GSS199       35904      22282147
GSS2         182739     92537598
GSS20        181809     101785902
GSS200       103304     62490220
GSS201       102329     63761256
GSS202       104240     67638632
GSS203       82127      41294650
GSS204       83102      54651503
GSS205       95565      61249467
GSS206       107362     78589335
GSS207       106444     76728833
GSS208       106101     79982459
GSS209       104001     80014803
GSS21        166509     114370268
GSS210       75801      50678132
GSS211       105097     63619915
GSS212       109868     66415305
GSS213       105969     59182678
GSS214       68062      37223883
GSS215       69097      38525198
GSS216       38174      18339130
GSS217       85817      46213833
GSS218       97756      56282806
GSS219       94838      49467300
GSS22        170128     97970468
GSS220       96276      55952494
GSS221       41313      23149851
GSS222       114055     43442995
GSS223       116422     39251295
GSS224       108546     52732132
GSS225       108722     67128647
GSS226       101583     78242094
GSS227       57005      34059998
GSS228       96897      36918766
GSS229       96399      37676586
GSS23        187497     127407690
GSS230       97739      35452830
GSS231       95145      39751140
GSS232       33820      15967145
GSS233       103939     66277823
GSS234       94551      61190929
GSS235       95128      60357048
GSS236       94773      60868501
GSS237       75675      70017159
GSS238       80658      68522367
GSS239       36895      34939652
GSS24        195135     130446631
GSS240       83736      28233267
GSS241       84219      27346468
GSS242       84926      25909272
GSS243       14851      4422302
GSS244       16547      7508221
GSS245       94100      60580478
GSS246       97403      65501702
GSS247       96166      65715907
GSS248       87648      48537504
GSS249       97007      54104598
GSS25        177584     104711673
GSS250       89388      48757246
GSS251       35800      19549370
GSS252       90839      57016024
GSS253       89674      61866093
GSS254       88534      63668650
GSS255       89290      62493340
GSS256       9699       6996370
GSS257       87995      63795538
GSS258       90590      62742076
GSS259       94937      59925372
GSS26        187090     109213425
GSS260       74696      63777273
GSS261       84391      78676825
GSS262       82881      80793634
GSS263       69452      51663438
GSS264       114900     62956729
GSS265       108980     55519998
GSS266       107208     51972208
GSS267       99627      44671760
GSS268       109459     48915853
GSS269       97817      45815705
GSS27        169240     151422321
GSS270       73084      72182459
GSS271       77066      72626452
GSS272       92139      71206302
GSS273       25095      18901203
GSS274       92250      71055526
GSS275       85869      83025280
GSS276       83675      87061685
GSS277       82362      86366324
GSS278       87240      67099066
GSS279       90053      72027971
GSS28        190473     145242216
GSS280       91485      69770366
GSS281       92571      57565782
GSS282       29142      17573176
GSS283       94787      57200301
GSS284       93517      59081345
GSS285       93900      58510429
GSS286       94714      57307691
GSS287       83843      51265303
GSS288       103666     69242174
GSS289       104299     74321241
GSS29        152645     107768528
GSS290       109373     68331863
GSS291       106994     71135784
GSS292       38781      26571815
GSS293       111314     66044649
GSS294       97607      61004205
GSS295       106962     56654879
GSS296       93393      73041534
GSS297       54044      34129591
GSS3         175733     88087457
GSS30        192322     131420154
GSS31        10099      6711628
GSS32        196657     127651461
GSS33        217776     116759610
GSS34        219644     114213054
GSS35        220777     112664012
GSS36        214622     123365339
GSS37        199350     157076150
GSS38        195924     147428053
GSS39        191244     68588056
GSS4         167433     85324699
GSS40        185320     97984227
GSS41        190653     126753355
GSS42        171527     159228249
GSS43        6497       4268438
GSS44        184487     100551761
GSS45        173393     121982833
GSS46        183398     123609403
GSS47        188784     120860872
GSS48        73626      64601107
GSS49        172209     102210173
GSS5         51061      30412071
GSS50        168276     103464302
GSS51        168440     103094959
GSS52        182551     120349398
GSS53        184639     116541777
GSS54        181040     122102994
GSS55        185740     112533964
GSS56        190452     135709036
GSS57        178344     104340808
GSS58        193144     119077058
GSS59        179759     131771550
GSS6         161952     84629162
GSS60        6712       6101355
GSS61        173003     139048454
GSS62        162249     111944582
GSS63        162288     111955360
GSS64        157219     106551656
GSS65        156862     129149769
GSS66        170500     142784855
GSS67        179008     116491862
GSS68        202255     126812545
GSS69        193438     110331287
GSS7         165837     79603128
GSS70        244863     126495515
GSS71        161180     107090358
GSS72        159053     119304292
GSS73        162711     124583003
GSS74        162678     124641536
GSS75        175098     109043055
GSS76        190510     140135388
GSS77        14186      8545369
GSS78        196762     125014628
GSS79        169648     110732410
GSS8         165839     89011437
GSS80        199192     130537922
GSS81        210714     89134433
GSS82        190623     96690097
GSS83        132733     92786013
GSS84        146686     117794322
GSS85        139740     117085958
GSS86        142916     114007941
GSS87        144189     119963434
GSS88        141838     115726495
GSS89        108359     90342781
GSS9         138235     67304748
GSS90        149553     122345018
GSS91        147788     117792665
GSS92        144115     113155638
GSS93        142979     115531478
GSS94        144339     119769367
GSS95        148217     121718869
GSS96        147793     117902839
GSS97        146200     121153918
GSS98        146261     121035223
GSS99        146701     120155849
HTC1         25047      27029900
HTC10        70219      71332094
HTC11        72097      70032067
HTC12        26082      31658412
HTC13        67517      60542416
HTC14        69053      69673201
HTC15        43057      28337677
HTC2         16071      36202003
HTC3         16014      36607191
HTC4         16234      35514380
HTC5         15960      40329026
HTC6         16042      37386456
HTC7         53542      31186695
HTC8         31530      19965253
HTC9         60703      77599470
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1440       190168820
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1591       179505523
HTG121       1587       179611588
HTG122       1580       179575648
HTG123       1598       179580959
HTG124       1603       179513131
HTG125       1542       180762291
HTG126       1155       189970033
HTG127       1091       184872126
HTG128       169        26086980
HTG129       1554       186401663
HTG13        875        191786413
HTG130       1856       177940493
HTG131       987        187833605
HTG132       1084       193226449
HTG133       1091       193148700
HTG134       581        105816839
HTG135       1031       189469892
HTG136       1055       192678789
HTG137       1163       191852916
HTG138       1080       192395749
HTG139       1084       193090210
HTG14        753        191921309
HTG140       588        103686357
HTG141       1122       192519796
HTG142       1078       192373539
HTG143       1078       192352380
HTG144       1167       191892724
HTG145       2134       191533370
HTG146       1094       192430688
HTG147       1077       192067814
HTG148       1090       192459829
HTG149       1042       190287901
HTG15        745        191963148
HTG150       1450       183182344
HTG151       893        100716823
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1148       192593691
HTG77        1188       192551497
HTG78        1069       180930974
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93662      48158993
INV10        49240      92780983
INV100       96245      108547326
INV101       35892      166944993
INV102       23159      177277868
INV103       22654      170374262
INV104       4699       190767649
INV105       29376      152389625
INV106       55624      119361124
INV107       566        40635863
INV108       7358       190633905
INV109       51895      153104512
INV11        64900      83268618
INV110       5607       188059543
INV111       34363      163640891
INV112       2984       16792294
INV113       39813      159668855
INV114       62444      141571579
INV115       19462      30223725
INV116       104664     106635585
INV117       74560      120851052
INV118       12142      167716435
INV119       18305      163703565
INV12        77607      62102284
INV120       13722      94083137
INV121       29262      155753563
INV122       38610      149060814
INV123       51684      139700572
INV124       70877      126444377
INV125       97323      108082698
INV126       125942     86452766
INV127       48615      121911511
INV128       552        2016124
INV13        10931      10152008
INV14        84562      65966922
INV15        80747      66715255
INV16        78495      66798193
INV17        49709      46769413
INV18        36729      122051397
INV19        402        149997547
INV2         58597      92464992
INV20        48287      104818284
INV21        77113      55495204
INV22        72336      62200818
INV23        1622       1055215
INV24        23067      127290476
INV25        6          133712559
INV26        57250      101120596
INV27        74171      50163762
INV28        68924      50087316
INV29        76848      54958299
INV3         1378       188275133
INV30        75554      57248521
INV31        77035      57472881
INV32        73175      53597304
INV33        54187      35872029
INV34        78922      56764183
INV35        75009      55695814
INV36        73958      60921743
INV37        77553      57828082
INV38        51042      33987486
INV39        77381      56510499
INV4         844        132406167
INV40        72976      49330487
INV41        76220      57763364
INV42        76973      62621443
INV43        75619      57825660
INV44        33766      138992575
INV45        26734      60279124
INV46        81389      126096485
INV47        100278     109585057
INV48        115844     96029576
INV49        101752     71107727
INV5         26842      110606968
INV50        35238      166584902
INV51        30754      171611440
INV52        27714      170892418
INV53        2597       191028659
INV54        6185       191114217
INV55        17831      180089188
INV56        15380      184775278
INV57        6834       166792726
INV58        8875       189509571
INV59        15662      184182101
INV6         78891      70584101
INV60        30722      171526293
INV61        65600      142208408
INV62        21638      22670137
INV63        50224      153584896
INV64        4095       191102716
INV65        11177      184659675
INV66        29153      168751324
INV67        3317       189349389
INV68        6330       186171285
INV69        12367      180474553
INV7         53351      95724352
INV70        39596      157268982
INV71        60755      142074593
INV72        67983      110944176
INV73        93001      114614617
INV74        56274      146052731
INV75        16688      171579078
INV76        33874      156329130
INV77        82253      117982423
INV78        24999      174542393
INV79        32599      158648520
INV8         42140      87577264
INV80        60222      139121472
INV81        13267      12603878
INV82        41258      162193552
INV83        8649       189035299
INV84        14549      181577331
INV85        5295       188760704
INV86        18509      176900436
INV87        34351      158679406
INV88        14344      172158272
INV89        23577      45955779
INV9         80257      71495334
INV90        16795      180349455
INV91        21027      172501512
INV92        4891       191046501
INV93        26084      174037919
INV94        14547      181030545
INV95        44397      155376448
INV96        27112      171621394
INV97        19370      174154051
INV98        49371      138775955
INV99        29055      84543185
MAM1         20905      154868880
MAM2         14190      164586058
MAM3         62759      79799234
MAM4         3321       188145561
MAM5         79629      74790096
MAM6         45612      132513562
MAM7         75980      62034312
MAM8         67953      72597518
MAM9         65621      67894177
PAT1         222548     70105342
PAT10        124322     102575460
PAT100       178342     3388498
PAT101       178198     3385762
PAT102       178185     3385515
PAT103       132610     2848492
PAT104       342935     8573375
PAT105       188806     88519660
PAT106       111348     132068608
PAT107       3850       194703659
PAT108       131292     110979300
PAT109       158599     54826034
PAT11        98803      64115358
PAT110       224683     34110505
PAT111       250080     15844313
PAT112       180715     63634516
PAT113       51660      26091791
PAT114       114159     110461510
PAT115       137605     83239536
PAT116       164281     98991133
PAT117       158392     103578951
PAT118       137596     115028387
PAT119       42621      28098514
PAT12        141823     62675490
PAT120       193712     81686401
PAT121       150218     108404223
PAT122       356051     11379519
PAT123       257211     57607676
PAT124       138160     48226316
PAT125       322021     22795469
PAT126       155642     102753966
PAT127       132724     110696205
PAT128       128341     121313309
PAT129       21664      184390005
PAT13        103920     59414540
PAT130       144889     112900617
PAT131       171997     96405634
PAT132       44617      171215968
PAT133       9167       47581637
PAT134       33645      178334734
PAT135       153558     109675196
PAT136       178705     90913377
PAT137       136050     115324192
PAT138       120392     123343236
PAT139       8526       8991488
PAT14        102702     49416619
PAT140       155429     101473147
PAT141       184764     88815933
PAT142       182409     85292093
PAT143       174403     93928365
PAT144       28829      20461016
PAT145       147930     108545990
PAT146       160944     101973644
PAT147       185311     90980420
PAT148       231649     49265020
PAT149       203453     47671833
PAT15        120393     52442671
PAT150       277718     9685390
PAT151       220395     46464785
PAT152       107052     2889467
PAT153       270386     21672571
PAT154       186661     61148963
PAT155       109670     106103253
PAT156       47737      9594840
PAT157       87232      88030023
PAT158       78294      95533764
PAT159       144758     77952429
PAT16        108618     62704182
PAT160       167855     71111024
PAT161       121186     93109397
PAT162       103351     85110802
PAT163       165796     46410559
PAT164       270022     5130418
PAT165       269978     5129582
PAT166       269978     5129582
PAT167       237888     4519872
PAT168       269396     5118524
PAT169       235452     25553900
PAT17        47563      17033875
PAT170       203754     47175351
PAT171       12041      422841
PAT172       165316     74866922
PAT173       91679      126646066
PAT174       172390     71672457
PAT175       213580     66903016
PAT176       42483      48681309
PAT177       235138     59544089
PAT178       123750     125093767
PAT179       217504     66591902
PAT18        146771     52594264
PAT180       198097     84199370
PAT181       187033     87662261
PAT182       157755     102456509
PAT183       116020     59908826
PAT184       93157      87260581
PAT185       91770      79984604
PAT186       83820      91635531
PAT187       108650     54245888
PAT188       101001     56603951
PAT189       150190     24637668
PAT19        153714     78039687
PAT190       93816      82452709
PAT191       26010      162900357
PAT192       113946     65760783
PAT193       81611      28133789
PAT194       3631       191518875
PAT195       84408      78157905
PAT196       145071     26290709
PAT197       76948      99954094
PAT198       95311      71448513
PAT199       129838     31394819
PAT2         194517     84674262
PAT20        104716     118087764
PAT200       116133     69646799
PAT201       86792      129976571
PAT202       158938     78754527
PAT203       213426     47111724
PAT204       169384     66565400
PAT205       59689      8581571
PAT206       161905     78473868
PAT207       120026     100582130
PAT208       86577      129095405
PAT209       38001      167167739
PAT21        133761     95343709
PAT210       35946      168679432
PAT211       75275      137685601
PAT212       252335     29172288
PAT213       137369     91929888
PAT214       148425     82281945
PAT215       141868     75215522
PAT216       139421     87027134
PAT217       157100     89033977
PAT218       90260      21568529
PAT219       247922     16367460
PAT22        84657      79565674
PAT220       258799     3881985
PAT221       258799     3881985
PAT222       253579     6414973
PAT223       47679      19393216
PAT23        123528     103394407
PAT24        119450     105667379
PAT25        145328     86638387
PAT26        175054     64324029
PAT27        71640      1791000
PAT28        102171     77387698
PAT29        93980      87617309
PAT3         171995     95902275
PAT30        119889     61644742
PAT31        96742      79002686
PAT32        128237     54967065
PAT33        92116      51076110
PAT34        117830     69179507
PAT35        119665     35931240
PAT36        105591     75805097
PAT37        138309     27003208
PAT38        157987     27518620
PAT39        114532     50390997
PAT4         153753     106058537
PAT40        54087      54771273
PAT41        95722      83166454
PAT42        100233     70850169
PAT43        136071     39459525
PAT44        143790     35448301
PAT45        123791     64454002
PAT46        104420     81144657
PAT47        93184      74505377
PAT48        113241     66578708
PAT49        65502      54898921
PAT5         57124      23909671
PAT50        135191     107998311
PAT51        167082     97033437
PAT52        116397     127556980
PAT53        196343     76723060
PAT54        80303      127991082
PAT55        27631      180872621
PAT56        185409     93066654
PAT57        274258     6856450
PAT58        129447     31627433
PAT59        161320     77719729
PAT6         170645     91912459
PAT60        92699      89235124
PAT61        106282     74880945
PAT62        122366     64032100
PAT63        67768      30366526
PAT64        70748      109764944
PAT65        87946      82759037
PAT66        92971      78935157
PAT67        93164      72444136
PAT68        93383      75087244
PAT69        115770     60532287
PAT7         154906     88273196
PAT70        102747     9942058
PAT71        175927     10547425
PAT72        171510     10872561
PAT73        171496     10866737
PAT74        99865      86225427
PAT75        99         196466297
PAT76        67         192869889
PAT77        103        195600591
PAT78        1132       196318332
PAT79        97604      5772661
PAT8         131094     97005778
PAT80        151009     9636510
PAT81        151022     9621259
PAT82        151024     9622125
PAT83        151021     9620837
PAT84        94629      88051226
PAT85        92253      94522898
PAT86        37564      34676781
PAT87        83459      93185861
PAT88        15566      180450125
PAT89        164892     19209750
PAT9         129315     100989625
PAT90        178944     3399936
PAT91        177434     3371246
PAT92        175305     3330795
PAT93        101401     1926619
PAT94        169166     12412151
PAT95        178699     3395281
PAT96        178691     3395129
PAT97        178677     3394863
PAT98        140785     2674915
PAT99        178683     3394977
PHG1         5836       104098962
PHG2         3751       99878310
PLN1         59786      93430546
PLN10        43865      42707122
PLN100       70100      71209972
PLN101       66939      71813004
PLN102       19455      20993107
PLN103       71414      70946713
PLN104       68535      74890036
PLN105       32925      100361631
PLN106       5184       172239099
PLN107       81         188747955
PLN108       31330      134371407
PLN109       6          180795696
PLN11        72949      75690016
PLN110       2433       177406711
PLN111       29563      142982429
PLN112       12507      26990084
PLN12        37373      49225383
PLN13        40063      65306359
PLN14        22815      122999448
PLN15        21116      101069881
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        24729      127753568
PLN2         74491      77807265
PLN20        5972       146407780
PLN21        1288       168147499
PLN22        1448       166987774
PLN23        19866      32698923
PLN24        66917      69766215
PLN25        30153      32300694
PLN26        76722      76347545
PLN27        37900      42606449
PLN28        57312      72149903
PLN29        28690      28924739
PLN3         32186      109871598
PLN30        2644       102424140
PLN31        3          73585790
PLN32        30         105815221
PLN33        280        132295101
PLN34        98         127134784
PLN35        273        129899901
PLN36        164        128757324
PLN37        161        128823798
PLN38        154        127292285
PLN39        141        129447248
PLN4         1380       180292771
PLN40        199        128881074
PLN41        103        138729545
PLN42        178        173011032
PLN43        1138       160904841
PLN44        8779       33452977
PLN45        14346      29953091
PLN46        18817      133832647
PLN47        77710      74585542
PLN48        96190      58917550
PLN49        34993      32420948
PLN5         1869       187192658
PLN50        80196      71485511
PLN51        77557      75763634
PLN52        80125      70260738
PLN53        81840      75279294
PLN54        59314      33208653
PLN55        98816      55134235
PLN56        82261      68336358
PLN57        44776      98722392
PLN58        5209       153457560
PLN59        11881      164673953
PLN6         1859       194260128
PLN60        29507      120345978
PLN61        54857      102804882
PLN62        16262      12268937
PLN63        80889      72355708
PLN64        17304      12750568
PLN65        49499      72634818
PLN66        25058      110561902
PLN67        13240      89527309
PLN68        1          774434471
PLN69        6917       27344998
PLN7         1683       194205328
PLN70        1330       148321462
PLN71        2          135217911
PLN72        2          155188403
PLN73        2          140023111
PLN74        2          154604167
PLN75        2          148753627
PLN76        3          173772618
PLN77        3          178836778
PLN78        3          176344173
PLN79        3          195539469
PLN8         1865       193393867
PLN80        12243      129343271
PLN81        81846      65487110
PLN82        92727      57821887
PLN83        22408      15406426
PLN84        77302      71099379
PLN85        70011      84296472
PLN86        76629      67742392
PLN87        71909      76937083
PLN88        79639      65370973
PLN89        6322       5900437
PLN9         54711      96831778
PLN90        78148      63276293
PLN91        74967      69302645
PLN92        83816      55532631
PLN93        81245      58325794
PLN94        18915      22918898
PLN95        73707      62776253
PLN96        70793      72271451
PLN97        63578      83431261
PLN98        46873      54828172
PLN99        97483      48706359
PRI1         23031      59758996
PRI10        1255       179098563
PRI11        840        101415529
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         20499      146514167
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2081       192786782
PRI23        19303      61974568
PRI24        31502      84572862
PRI25        61939      78158734
PRI26        31359      70668943
PRI27        8758       172032991
PRI28        2265       191511011
PRI29        1665       190764297
PRI3         1437       174649408
PRI30        2074       192160303
PRI31        2195       191150383
PRI32        13091      162158575
PRI33        2067       170809233
PRI34        58140      87752535
PRI35        5452       11400673
PRI36        32171      63567574
PRI37        20510      119034274
PRI38        19005      150428992
PRI39        67639      85444075
PRI4         1278       185835047
PRI40        50057      89385039
PRI41        41906      81732908
PRI42        47251      95807193
PRI43        26932      100943982
PRI44        28712      109077177
PRI45        22957      105408480
PRI46        30346      98739211
PRI47        37085      110969297
PRI48        64535      92638497
PRI49        1101       12383170
PRI5         1331       184399475
PRI6         1181       179841321
PRI7         1229       180333268
PRI8         1223       178978627
PRI9         1370       174869466
ROD1         35926      135063906
ROD10        988        181626798
ROD11        278        52591059
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15458      158988425
ROD2         909        175671113
ROD20        1358       2500688
ROD21        20403      157183388
ROD22        1220       193673930
ROD23        937        147781632
ROD24        15479      168700346
ROD25        37932      68967800
ROD26        20945      110596383
ROD27        1537       193206645
ROD28        146055     23767313
ROD29        77909      76170128
ROD3         909        173264505
ROD30        83631      53561519
ROD31        36382      42361531
ROD4         900        173560454
ROD5         919        174617121
ROD6         965        177760544
ROD7         974        179667688
ROD8         974        181293382
ROD9         996        181705058
STS1         85261      36747230
STS10        57907      44420216
STS11        48911      37504044
STS12        57924      43637361
STS13        64261      42840817
STS14        93611      34190212
STS15        104286     26516497
STS16        10134      2745596
STS17        103700     27504029
STS18        97659      33613124
STS19        96666      34556610
STS2         84144      49927974
STS20        70929      25054830
STS3         66821      26222585
STS4         77318      37022077
STS5         8716       5116696
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55715      37766563
SYN1         52772      69985922
SYN2         44043      79768116
SYN3         22368      130002743
SYN4         4592       176439412
SYN5         4587       176341416
SYN6         4594       176342109
SYN7         12813      156887130
SYN8         19638      34339871
TSA1         120229     38175118
TSA10        18501      20932212
TSA100       76657      52703162
TSA101       66691      66814426
TSA102       63923      75927225
TSA103       87101      55421144
TSA104       51519      27724057
TSA105       74245      86358066
TSA106       80229      75622518
TSA107       84814      72313292
TSA108       77875      83688591
TSA109       94381      51984420
TSA11        134181     34620238
TSA110       99152      69095062
TSA111       59222      97215857
TSA112       109175     49378845
TSA113       63354      68310026
TSA114       80812      88891396
TSA115       70537      71912951
TSA116       57870      119429113
TSA117       5002       6820454
TSA118       106689     67779914
TSA119       93410      83369889
TSA12        60167      20022990
TSA120       98615      76609458
TSA121       88033      68056906
TSA122       84942      58892567
TSA123       77788      62304293
TSA124       82123      76299805
TSA125       98279      60530129
TSA126       94510      42626248
TSA127       76643      54394541
TSA128       42620      39901874
TSA129       59626      61176103
TSA13        64386      59430252
TSA130       59047      61657426
TSA131       59168      62167042
TSA132       71956      78379950
TSA133       87818      51643326
TSA134       63336      64766777
TSA135       2563       1147163
TSA136       77745      34626570
TSA137       74689      66831444
TSA138       81079      78598444
TSA139       74692      64675647
TSA14        92644      61562171
TSA140       41882      34789042
TSA141       87600      70235611
TSA142       89003      68194525
TSA143       84656      77065314
TSA144       76791      81310397
TSA145       12038      10028761
TSA146       104187     53670971
TSA147       81024      61412061
TSA148       69807      78230935
TSA149       73068      68063462
TSA15        86754      43106045
TSA150       87167      75197912
TSA151       89965      70421878
TSA152       62321      102799580
TSA153       95551      74305126
TSA154       20005      13967517
TSA155       83185      63773173
TSA156       83474      63810105
TSA157       78951      73455247
TSA158       76902      76048404
TSA159       93313      58447060
TSA16        76033      85960467
TSA160       101578     67502243
TSA161       33761      23520959
TSA162       103445     64539230
TSA163       94920      75734700
TSA164       80355      64233867
TSA165       30552      47121787
TSA166       51839      98295419
TSA167       46917      107683976
TSA168       44952      111436512
TSA169       42000      117073120
TSA17        78962      72486729
TSA170       39479      121890914
TSA171       37678      125330444
TSA172       30670      109097872
TSA173       61889      78211718
TSA174       58174      84931281
TSA175       51344      17434473
TSA176       37758      28296656
TSA177       36221      35142785
TSA178       37353      30081115
TSA179       10796      16074102
TSA18        86040      43851121
TSA180       31457      56460469
TSA181       31138      57882583
TSA182       38922      23006295
TSA183       40001      18171317
TSA184       40684      15114565
TSA185       41078      13347697
TSA186       41316      12282925
TSA187       28939      8244759
TSA188       41513      11403438
TSA189       41557      11205961
TSA19        74055      87962158
TSA190       41604      10999246
TSA191       41673      10683394
TSA192       41718      10482972
TSA193       41763      10285761
TSA194       41838      9933685
TSA195       1870       419860
TSA2         112872     41354278
TSA20        67086      51961908
TSA21        82965      81648433
TSA22        61261      86379011
TSA23        94379      71517063
TSA24        98108      46353806
TSA25        45487      15808388
TSA26        85797      70106183
TSA27        120080     38852195
TSA28        135073     34045322
TSA29        52643      68389480
TSA3         109738     40819744
TSA30        47693      62712379
TSA31        2568       4358627
TSA32        60987      81840924
TSA33        92737      66827498
TSA34        109036     50276621
TSA35        106046     49573939
TSA36        101812     53917765
TSA37        104283     47753136
TSA38        25389      16338232
TSA39        66195      59263498
TSA4         110871     47429155
TSA40        92195      67722162
TSA41        92732      62207585
TSA42        79993      85992869
TSA43        99500      49867771
TSA44        113591     34204106
TSA45        95201      67568206
TSA46        13667      8496844
TSA47        94357      35367985
TSA48        77411      35911168
TSA49        106331     43403838
TSA5         76764      23186803
TSA50        113811     45490224
TSA51        29818      20489582
TSA52        105735     50140224
TSA53        100655     54491793
TSA54        94817      63356575
TSA55        83277      83596257
TSA56        63297      25469672
TSA57        90365      71288560
TSA58        97490      54396288
TSA59        60102      105473410
TSA6         111583     58975350
TSA60        86943      65053367
TSA61        78610      70648120
TSA62        83052      72225685
TSA63        82797      72051274
TSA64        69027      90930325
TSA65        90777      66753345
TSA66        75897      84474971
TSA67        71863      73184540
TSA68        68804      60806651
TSA69        84938      78092730
TSA7         87421      57901423
TSA70        85242      78226283
TSA71        70135      97561426
TSA72        85540      69665112
TSA73        84998      51586540
TSA74        102004     68493695
TSA75        87257      58729411
TSA76        103898     56923600
TSA77        73354      73067084
TSA78        79195      44938733
TSA79        87334      79220475
TSA8         104450     72517643
TSA80        91719      69206004
TSA81        78362      53147378
TSA82        78400      56954579
TSA83        97317      60069251
TSA84        38937      36173906
TSA85        89257      76980939
TSA86        95080      55375897
TSA87        110845     44819727
TSA88        97242      58062674
TSA89        65162      96953486
TSA9         109298     60842426
TSA90        15114      14610282
TSA91        101297     55494442
TSA92        91074      53960295
TSA93        93807      43529224
TSA94        85784      74014953
TSA95        73184      72093947
TSA96        39931      46731303
TSA97        77259      80455187
TSA98        77387      55249328
TSA99        84120      38668910
UNA1         323        187511
VRL1         64977      70749665
VRL10        44383      73006980
VRL11        62534      71930448
VRL12        68795      66062011
VRL13        61132      73153744
VRL14        25422      35326676
VRL15        62755      70854323
VRL16        57151      72655039
VRL17        62956      64157427
VRL18        56386      73507648
VRL19        51530      65676779
VRL2         67261      65583479
VRL20        54663      72259324
VRL21        58416      71306860
VRL22        56163      73171272
VRL23        55228      73814779
VRL24        28061      45649402
VRL25        52576      75064615
VRL26        37923      81631376
VRL27        47711      74887187
VRL28        48066      74047916
VRL29        48363      77333634
VRL3         71211      62173011
VRL30        11917      20514696
VRL31        51128      79602032
VRL32        43549      82439391
VRL33        43482      81410312
VRL34        45038      79635039
VRL35        32630      102822406
VRL36        30730      28420078
VRL4         70044      65026309
VRL5         68656      68125380
VRL6         15090      21154164
VRL7         47972      77211294
VRL8         46524      71648148
VRL9         43799      71197228
VRT1         65325      81962427
VRT10        1318       193340001
VRT11        8958       180825154
VRT12        3157       104392224
VRT13        13368      172113838
VRT14        5823       185035611
VRT15        3792       188749995
VRT16        49335      115779316
VRT17        79326      69300576
VRT18        77291      66375819
VRT19        20393      15119759
VRT2         1230       194209320
VRT20        71489      76486944
VRT21        44961      123029221
VRT22        77271      63213829
VRT23        79067      62160300
VRT24        81768      57870053
VRT25        32568      22633913
VRT26        102794     66138253
VRT27        81205      56303432
VRT28        85575      58112975
VRT29        61475      46244561
VRT3         54067      112231551
VRT30        90929      53880587
VRT31        75935      57593377
VRT32        5360       4872700
VRT33        74806      57636573
VRT34        42300      33747682
VRT35        80748      57115417
VRT36        66203      71255090
VRT37        11         183561233
VRT38        8          181722496
VRT39        11         181953570
VRT4         19811      157518670
VRT40        10         194440740
VRT41        178        196497394
VRT42        341        196290430
VRT43        2226       194989304
VRT44        2544       193718317
VRT45        14303      177284360
VRT46        6265       6546541
VRT5         39183      77268016
VRT6         72952      66693490
VRT7         31771      63578393
VRT8         30505      114095376
VRT9         1266       193362319

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 208.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

21844744 17754380521   Homo sapiens
9728295   9999200391   Mus musculus
2193917   6526257110   Rattus norvegicus
2227329   5410531831   Bos taurus
4177319   5201794153   Zea mays
3297169   4895363628   Sus scrofa
1346484   3221512179   Hordeum vulgare subsp. vulgare
1727891   3144091862   Danio rerio
1796985   1928870492   Triticum aestivum
204857    1835874550   Cyprinus carpio
744582    1743591963   Solanum lycopersicum
258060    1435468217   Strongylocentrotus purpuratus
456985    1297465892   Macaca mulatta
1376446   1265888078   Oryza sativa Japonica Group
489946    1264026592   Spirometra erinaceieuropaei
1587996   1249270365   Xenopus (Silurana) tropicalis
2578836   1202194378   Arabidopsis thaliana
1778908   1200529976   Nicotiana tabacum
1270134   1158458524   Drosophila melanogaster
814830    1075319384   Vitis vinifera

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled, as time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          June 15 2015

                NCBI-GenBank Flat File Release 208.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ04).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


   Benson DA, Clark K, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW.
   GenBank. Nucleic Acids Res. 42(Database issue):D32-7 (2014)

   DOI:  10.1093/nar/gkt1030
   PMID: 24217914

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 42(Database issue), D32-7 (2014)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 208.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
	Larry Chlumsky, Brenda Chow, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Irene Fang, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, J. Bradley Holmes,
	Jonathan Kans, Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh,
	Jim Ostell, Vasuki Palanigobu, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov,
	Elena Starchenko, Hanzhen Sun, Tatiana Tatusova, Kamen Todorov,
	Eugene Yaschenko, Sergey Zhdanov, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
	Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center