Release Notes For GenBank Release 212

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2016

               NCBI-GenBank Flat File Release 212.0

                    Distribution Release Notes

 190250235 loci, 207018196067 bases, from 190250235 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 212.0
1.2 Cutoff Date
1.3 Important Changes in Release 212.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 212.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 212.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 212.0, incorporates data processed by the INSDC databases
as of Saturday, February 13, 2016 at approximately 1:33am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 212.0

1.3.1 Organizational changes

The total number of sequence data files increased by 29 with this release:

  - the BCT division is now composed of 224 files (+10)
  - the CON division is now composed of 330 files (+3)
  - the ENV division is now composed of  89 files (+1)
  - the EST division is now composed of 480 files (+2)
  - the INV division is now composed of 136 files (+1)
  - the PAT division is now composed of 246 files (+4)
  - the PLN division is now composed of 125 files (+3)
  - the PRI division is now composed of  54 files (+4)
  - the ROD division is now composed of  31 files (-1)
  - the VRL division is now composed of  40 files (+1)
  - the VRT division is now composed of  61 files (+1)

Note: The 'loss' of gbrod32.seq is due to improved packaging of
sequence records, which resulted in one less file for that division.

Note: The increase in the number of BCT division files reported
in the GenBank 211.0 release notes was slightly inaccurate. There
were eight additional files, but that yielded a total of 214 BCT
files, not the 216 which were reported.

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 127
of the GSS flatfiles in Release 212.0. Consider gbgss173.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2016

                NCBI-GenBank Flat File Release 212.0

                           GSS Sequences (Part 1)

   87032 loci,    63853715 bases, from    87032 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "173" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats
      and FASTA header to be simplified

  As of September 15 2016, the integer sequence identifiers known as "GIs" will
no longer be included in the GenBank, GenPept, and FASTA formats for GenBank
Release and GenBank Update products. The FASTA header will be further simplified,
to report only the sequence Accession.Version for records that originate within
the International Sequence Database Collaboration (INSDC).

  September 15th is now the earliest date by which these changes will take
place (rather than June 15th, previously announced). But if the format changes
prove to be a hardship for GenBank users, the implementation date might be
postponed further.

  As first described in the Release Notes for GenBank 199.0 in December 2013,
NCBI is in the process of moving to storage solutions which utilize only
Accession.Version identifiers. See Section 1.4.2 of these release notes for
additional background information about those developments.

  Given this shift to non-GI-based systems, the importance of using
Accession.Version identifiers cannot be overstated. NCBI plans to cease the
display of GI identifiers in the flatfile and FASTA views of all nucleotide
and protein sequence records in September 2016, so any processes solely
dependent on GIs will need to be adjusted before that time or they will
cease to work.  

  Previously-assigned GI sequence identifiers will continue to exist
'behind the scenes', and NCBI services which accept GIs as inputs will
continue to be supported. NCBI will be adding support for Accession.Version
identifiers to any services that currently do not support them. As NCBI
makes this transition, we encourage any users who have workflows that
depend on GIs to begin planning to use Accession.Version identifiers instead.

  The FASTA format will also be changed for all sequence records originating
within the INSDC, to report only the Accession.Version and the record title.
This will improve compatibility with other file types provided by NCBI and
others, including GFF3, Gene, and dbSNP download files. This FASTA format
change has already been made for the redesigned genomes FTP site based on
user requests to have a single consistent sequence identifier for both GFF3
and FASTA formats.

  At this time, we plan to continue to provide database source information in
the FASTA header/definition line for non-INSDC source of sequence data,
including UniProt, PDB structures, PIR, and Patent sequences.

Example 1 : An INSDC nucleotide record

  In the sample record below, nucleotide sequence AF123456 was assigned a
GI of 6633795, and the protein translated from its coding region feature
was assigned a GI of 6633796 :

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2  GI:6633795
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /db_xref="GI:6633796"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  After September 15 2016, the Accession.Version will be the sole sequence
version identifier. The GI value on the VERSION line and the GI /db_xref
qualifier for the coding region feature will no longer be visible:

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

Example 2 : A GenPept record for an INSDC sequence

The current GenPept display format includes GI identifiers in the VERSION lines
(note that the coding region feature for GenPept has never included the display
of GI identifiers) :

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1  GI:6633796
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

After September 15 2016, the VERSION line will no longer include the GI value:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

Example 3: FASTA format for an INSDC nucleotide and protein sequence

The current FASTA display, for most products, includes GI and database
source information (eg, 'gb' for GenBank, 'emb' for ENA, 'dbj' for
DDBJ), using the '|' character as a delimiter:

>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE


As of September 15 2016, just the Accession.Version will be provided:

>AF123456.2 Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>AAF19666.1 doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

Please direct any inquiries about these changes to the NCBI Service Desk:

  info@ncbi.nlm.nih.gov

1.4.2 GI sequence identifiers are being phased out at NCBI

  The numeric GI sequence identifier that NCBI used to assign to all
nucleotide and protein sequences was first introduced for GenBank Release
products as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for over 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who
utilize GIs in their own information systems and analysis pipelines, so it is
being implemented gradually. Unannotated WGS projects consisting of millions
of contigs and scaffolds, and unannotated TSA projects, are the first two
classes of records for which GIs are no longer being assigned. But the practice
will ultimately expand to include other classes of records.

  If GIs are central to your operations, NCBI strongly urges that you begin
planning a switch to the use of Accession.Version identifiers instead.

  The contigs and scaffolds of the ALWZ04 WGS project are good examples of
sequences that lack GIs. Below are excerpts from the flatfile representation
of the first ALWZ04 contig, and the 'singleton scaffold' which is constructed
from it. Note the absence of a GI value on the VERSION line of these two
records:

LOCUS       ALWZ040000001           1191 bp    DNA     linear   PLN 13-MAR-2015
DEFINITION  Picea glauca, whole genome shotgun sequence.
ACCESSION   ALWZ040000001 ALWZ040000000
VERSION     ALWZ040000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
ORIGIN      
        1 ctataatacc cctatgccaa acgaacccaa ttgtaaatgt aaatgcaaat gtacttaggc
       61 tggttagttg tttaatatca ttttttgtat gcaccttcca tggtataatg cgcacatgta
      121 tagcgcacta aaattatgaa gtgtgcccat tccaagatat tgcgcgtaaa aaacttaagt
      181 gtgcatgatt ttgagactag ggagactttg tgtatatgtt gtgttttata tgctggagag
      241 acaattatta ttagttagga ggattatgtt ttgtactagg caagagagcc tagatgttaa
      301 aggctagtga gcctattttt gtatatgtct catcattaat ataatacatc attgtgtgta
....
      901 ttgttgggaa ttgatttcct gaatgtgtta aactgcattg atagggatct gagaattcct
      961 ttctggccta ttgctgaagc tttggaaggg aggtggggca accgagggac tgttgagaag
     1021 agaagggtca cacttcctgg ggtgggacaa gcatgtgggg aattagggat tgcaggatgt
     1081 tagtttgaat tggcacctat gacagagtct ttcctattgt ctgagatatg tcagcttggt
     1141 taggaaaccc tttacctggg tagagtttag tcccagctcg ggggtgaccc a
//

LOCUS       ALWZ04S0000001          1191 bp    DNA     linear   CON 13-MAR-2015
DEFINITION  Picea glauca Pg-01r141201s0000001, whole genome shotgun sequence.
ACCESSION   ALWZ04S0000001 ALWZ0400000000
VERSION     ALWZ04S0000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
CONTIG      join(ALWZ040000001.1:1..1191)
//

Sample URLs from which ALWZ04 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.*.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.*.gbff.gz

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2548 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct23.seq - Bacterial sequence entries, part 23.
142. gbbct24.seq - Bacterial sequence entries, part 24.
143. gbbct25.seq - Bacterial sequence entries, part 25.
144. gbbct26.seq - Bacterial sequence entries, part 26.
145. gbbct27.seq - Bacterial sequence entries, part 27.
146. gbbct28.seq - Bacterial sequence entries, part 28.
147. gbbct29.seq - Bacterial sequence entries, part 29.
148. gbbct3.seq - Bacterial sequence entries, part 3.
149. gbbct30.seq - Bacterial sequence entries, part 30.
150. gbbct31.seq - Bacterial sequence entries, part 31.
151. gbbct32.seq - Bacterial sequence entries, part 32.
152. gbbct33.seq - Bacterial sequence entries, part 33.
153. gbbct34.seq - Bacterial sequence entries, part 34.
154. gbbct35.seq - Bacterial sequence entries, part 35.
155. gbbct36.seq - Bacterial sequence entries, part 36.
156. gbbct37.seq - Bacterial sequence entries, part 37.
157. gbbct38.seq - Bacterial sequence entries, part 38.
158. gbbct39.seq - Bacterial sequence entries, part 39.
159. gbbct4.seq - Bacterial sequence entries, part 4.
160. gbbct40.seq - Bacterial sequence entries, part 40.
161. gbbct41.seq - Bacterial sequence entries, part 41.
162. gbbct42.seq - Bacterial sequence entries, part 42.
163. gbbct43.seq - Bacterial sequence entries, part 43.
164. gbbct44.seq - Bacterial sequence entries, part 44.
165. gbbct45.seq - Bacterial sequence entries, part 45.
166. gbbct46.seq - Bacterial sequence entries, part 46.
167. gbbct47.seq - Bacterial sequence entries, part 47.
168. gbbct48.seq - Bacterial sequence entries, part 48.
169. gbbct49.seq - Bacterial sequence entries, part 49.
170. gbbct5.seq - Bacterial sequence entries, part 5.
171. gbbct50.seq - Bacterial sequence entries, part 50.
172. gbbct51.seq - Bacterial sequence entries, part 51.
173. gbbct52.seq - Bacterial sequence entries, part 52.
174. gbbct53.seq - Bacterial sequence entries, part 53.
175. gbbct54.seq - Bacterial sequence entries, part 54.
176. gbbct55.seq - Bacterial sequence entries, part 55.
177. gbbct56.seq - Bacterial sequence entries, part 56.
178. gbbct57.seq - Bacterial sequence entries, part 57.
179. gbbct58.seq - Bacterial sequence entries, part 58.
180. gbbct59.seq - Bacterial sequence entries, part 59.
181. gbbct6.seq - Bacterial sequence entries, part 6.
182. gbbct60.seq - Bacterial sequence entries, part 60.
183. gbbct61.seq - Bacterial sequence entries, part 61.
184. gbbct62.seq - Bacterial sequence entries, part 62.
185. gbbct63.seq - Bacterial sequence entries, part 63.
186. gbbct64.seq - Bacterial sequence entries, part 64.
187. gbbct65.seq - Bacterial sequence entries, part 65.
188. gbbct66.seq - Bacterial sequence entries, part 66.
189. gbbct67.seq - Bacterial sequence entries, part 67.
190. gbbct68.seq - Bacterial sequence entries, part 68.
191. gbbct69.seq - Bacterial sequence entries, part 69.
192. gbbct7.seq - Bacterial sequence entries, part 7.
193. gbbct70.seq - Bacterial sequence entries, part 70.
194. gbbct71.seq - Bacterial sequence entries, part 71.
195. gbbct72.seq - Bacterial sequence entries, part 72.
196. gbbct73.seq - Bacterial sequence entries, part 73.
197. gbbct74.seq - Bacterial sequence entries, part 74.
198. gbbct75.seq - Bacterial sequence entries, part 75.
199. gbbct76.seq - Bacterial sequence entries, part 76.
200. gbbct77.seq - Bacterial sequence entries, part 77.
201. gbbct78.seq - Bacterial sequence entries, part 78.
202. gbbct79.seq - Bacterial sequence entries, part 79.
203. gbbct8.seq - Bacterial sequence entries, part 8.
204. gbbct80.seq - Bacterial sequence entries, part 80.
205. gbbct81.seq - Bacterial sequence entries, part 81.
206. gbbct82.seq - Bacterial sequence entries, part 82.
207. gbbct83.seq - Bacterial sequence entries, part 83.
208. gbbct84.seq - Bacterial sequence entries, part 84.
209. gbbct85.seq - Bacterial sequence entries, part 85.
210. gbbct86.seq - Bacterial sequence entries, part 86.
211. gbbct87.seq - Bacterial sequence entries, part 87.
212. gbbct88.seq - Bacterial sequence entries, part 88.
213. gbbct89.seq - Bacterial sequence entries, part 89.
214. gbbct9.seq - Bacterial sequence entries, part 9.
215. gbbct90.seq - Bacterial sequence entries, part 90.
216. gbbct91.seq - Bacterial sequence entries, part 91.
217. gbbct92.seq - Bacterial sequence entries, part 92.
218. gbbct93.seq - Bacterial sequence entries, part 93.
219. gbbct94.seq - Bacterial sequence entries, part 94.
220. gbbct95.seq - Bacterial sequence entries, part 95.
221. gbbct96.seq - Bacterial sequence entries, part 96.
222. gbbct97.seq - Bacterial sequence entries, part 97.
223. gbbct98.seq - Bacterial sequence entries, part 98.
224. gbbct99.seq - Bacterial sequence entries, part 99.
225. gbchg.txt - Accession numbers of entries updated since the previous release.
226. gbcon1.seq - Constructed sequence entries, part 1.
227. gbcon10.seq - Constructed sequence entries, part 10.
228. gbcon100.seq - Constructed sequence entries, part 100.
229. gbcon101.seq - Constructed sequence entries, part 101.
230. gbcon102.seq - Constructed sequence entries, part 102.
231. gbcon103.seq - Constructed sequence entries, part 103.
232. gbcon104.seq - Constructed sequence entries, part 104.
233. gbcon105.seq - Constructed sequence entries, part 105.
234. gbcon106.seq - Constructed sequence entries, part 106.
235. gbcon107.seq - Constructed sequence entries, part 107.
236. gbcon108.seq - Constructed sequence entries, part 108.
237. gbcon109.seq - Constructed sequence entries, part 109.
238. gbcon11.seq - Constructed sequence entries, part 11.
239. gbcon110.seq - Constructed sequence entries, part 110.
240. gbcon111.seq - Constructed sequence entries, part 111.
241. gbcon112.seq - Constructed sequence entries, part 112.
242. gbcon113.seq - Constructed sequence entries, part 113.
243. gbcon114.seq - Constructed sequence entries, part 114.
244. gbcon115.seq - Constructed sequence entries, part 115.
245. gbcon116.seq - Constructed sequence entries, part 116.
246. gbcon117.seq - Constructed sequence entries, part 117.
247. gbcon118.seq - Constructed sequence entries, part 118.
248. gbcon119.seq - Constructed sequence entries, part 119.
249. gbcon12.seq - Constructed sequence entries, part 12.
250. gbcon120.seq - Constructed sequence entries, part 120.
251. gbcon121.seq - Constructed sequence entries, part 121.
252. gbcon122.seq - Constructed sequence entries, part 122.
253. gbcon123.seq - Constructed sequence entries, part 123.
254. gbcon124.seq - Constructed sequence entries, part 124.
255. gbcon125.seq - Constructed sequence entries, part 125.
256. gbcon126.seq - Constructed sequence entries, part 126.
257. gbcon127.seq - Constructed sequence entries, part 127.
258. gbcon128.seq - Constructed sequence entries, part 128.
259. gbcon129.seq - Constructed sequence entries, part 129.
260. gbcon13.seq - Constructed sequence entries, part 13.
261. gbcon130.seq - Constructed sequence entries, part 130.
262. gbcon131.seq - Constructed sequence entries, part 131.
263. gbcon132.seq - Constructed sequence entries, part 132.
264. gbcon133.seq - Constructed sequence entries, part 133.
265. gbcon134.seq - Constructed sequence entries, part 134.
266. gbcon135.seq - Constructed sequence entries, part 135.
267. gbcon136.seq - Constructed sequence entries, part 136.
268. gbcon137.seq - Constructed sequence entries, part 137.
269. gbcon138.seq - Constructed sequence entries, part 138.
270. gbcon139.seq - Constructed sequence entries, part 139.
271. gbcon14.seq - Constructed sequence entries, part 14.
272. gbcon140.seq - Constructed sequence entries, part 140.
273. gbcon141.seq - Constructed sequence entries, part 141.
274. gbcon142.seq - Constructed sequence entries, part 142.
275. gbcon143.seq - Constructed sequence entries, part 143.
276. gbcon144.seq - Constructed sequence entries, part 144.
277. gbcon145.seq - Constructed sequence entries, part 145.
278. gbcon146.seq - Constructed sequence entries, part 146.
279. gbcon147.seq - Constructed sequence entries, part 147.
280. gbcon148.seq - Constructed sequence entries, part 148.
281. gbcon149.seq - Constructed sequence entries, part 149.
282. gbcon15.seq - Constructed sequence entries, part 15.
283. gbcon150.seq - Constructed sequence entries, part 150.
284. gbcon151.seq - Constructed sequence entries, part 151.
285. gbcon152.seq - Constructed sequence entries, part 152.
286. gbcon153.seq - Constructed sequence entries, part 153.
287. gbcon154.seq - Constructed sequence entries, part 154.
288. gbcon155.seq - Constructed sequence entries, part 155.
289. gbcon156.seq - Constructed sequence entries, part 156.
290. gbcon157.seq - Constructed sequence entries, part 157.
291. gbcon158.seq - Constructed sequence entries, part 158.
292. gbcon159.seq - Constructed sequence entries, part 159.
293. gbcon16.seq - Constructed sequence entries, part 16.
294. gbcon160.seq - Constructed sequence entries, part 160.
295. gbcon161.seq - Constructed sequence entries, part 161.
296. gbcon162.seq - Constructed sequence entries, part 162.
297. gbcon163.seq - Constructed sequence entries, part 163.
298. gbcon164.seq - Constructed sequence entries, part 164.
299. gbcon165.seq - Constructed sequence entries, part 165.
300. gbcon166.seq - Constructed sequence entries, part 166.
301. gbcon167.seq - Constructed sequence entries, part 167.
302. gbcon168.seq - Constructed sequence entries, part 168.
303. gbcon169.seq - Constructed sequence entries, part 169.
304. gbcon17.seq - Constructed sequence entries, part 17.
305. gbcon170.seq - Constructed sequence entries, part 170.
306. gbcon171.seq - Constructed sequence entries, part 171.
307. gbcon172.seq - Constructed sequence entries, part 172.
308. gbcon173.seq - Constructed sequence entries, part 173.
309. gbcon174.seq - Constructed sequence entries, part 174.
310. gbcon175.seq - Constructed sequence entries, part 175.
311. gbcon176.seq - Constructed sequence entries, part 176.
312. gbcon177.seq - Constructed sequence entries, part 177.
313. gbcon178.seq - Constructed sequence entries, part 178.
314. gbcon179.seq - Constructed sequence entries, part 179.
315. gbcon18.seq - Constructed sequence entries, part 18.
316. gbcon180.seq - Constructed sequence entries, part 180.
317. gbcon181.seq - Constructed sequence entries, part 181.
318. gbcon182.seq - Constructed sequence entries, part 182.
319. gbcon183.seq - Constructed sequence entries, part 183.
320. gbcon184.seq - Constructed sequence entries, part 184.
321. gbcon185.seq - Constructed sequence entries, part 185.
322. gbcon186.seq - Constructed sequence entries, part 186.
323. gbcon187.seq - Constructed sequence entries, part 187.
324. gbcon188.seq - Constructed sequence entries, part 188.
325. gbcon189.seq - Constructed sequence entries, part 189.
326. gbcon19.seq - Constructed sequence entries, part 19.
327. gbcon190.seq - Constructed sequence entries, part 190.
328. gbcon191.seq - Constructed sequence entries, part 191.
329. gbcon192.seq - Constructed sequence entries, part 192.
330. gbcon193.seq - Constructed sequence entries, part 193.
331. gbcon194.seq - Constructed sequence entries, part 194.
332. gbcon195.seq - Constructed sequence entries, part 195.
333. gbcon196.seq - Constructed sequence entries, part 196.
334. gbcon197.seq - Constructed sequence entries, part 197.
335. gbcon198.seq - Constructed sequence entries, part 198.
336. gbcon199.seq - Constructed sequence entries, part 199.
337. gbcon2.seq - Constructed sequence entries, part 2.
338. gbcon20.seq - Constructed sequence entries, part 20.
339. gbcon200.seq - Constructed sequence entries, part 200.
340. gbcon201.seq - Constructed sequence entries, part 201.
341. gbcon202.seq - Constructed sequence entries, part 202.
342. gbcon203.seq - Constructed sequence entries, part 203.
343. gbcon204.seq - Constructed sequence entries, part 204.
344. gbcon205.seq - Constructed sequence entries, part 205.
345. gbcon206.seq - Constructed sequence entries, part 206.
346. gbcon207.seq - Constructed sequence entries, part 207.
347. gbcon208.seq - Constructed sequence entries, part 208.
348. gbcon209.seq - Constructed sequence entries, part 209.
349. gbcon21.seq - Constructed sequence entries, part 21.
350. gbcon210.seq - Constructed sequence entries, part 210.
351. gbcon211.seq - Constructed sequence entries, part 211.
352. gbcon212.seq - Constructed sequence entries, part 212.
353. gbcon213.seq - Constructed sequence entries, part 213.
354. gbcon214.seq - Constructed sequence entries, part 214.
355. gbcon215.seq - Constructed sequence entries, part 215.
356. gbcon216.seq - Constructed sequence entries, part 216.
357. gbcon217.seq - Constructed sequence entries, part 217.
358. gbcon218.seq - Constructed sequence entries, part 218.
359. gbcon219.seq - Constructed sequence entries, part 219.
360. gbcon22.seq - Constructed sequence entries, part 22.
361. gbcon220.seq - Constructed sequence entries, part 220.
362. gbcon221.seq - Constructed sequence entries, part 221.
363. gbcon222.seq - Constructed sequence entries, part 222.
364. gbcon223.seq - Constructed sequence entries, part 223.
365. gbcon224.seq - Constructed sequence entries, part 224.
366. gbcon225.seq - Constructed sequence entries, part 225.
367. gbcon226.seq - Constructed sequence entries, part 226.
368. gbcon227.seq - Constructed sequence entries, part 227.
369. gbcon228.seq - Constructed sequence entries, part 228.
370. gbcon229.seq - Constructed sequence entries, part 229.
371. gbcon23.seq - Constructed sequence entries, part 23.
372. gbcon230.seq - Constructed sequence entries, part 230.
373. gbcon231.seq - Constructed sequence entries, part 231.
374. gbcon232.seq - Constructed sequence entries, part 232.
375. gbcon233.seq - Constructed sequence entries, part 233.
376. gbcon234.seq - Constructed sequence entries, part 234.
377. gbcon235.seq - Constructed sequence entries, part 235.
378. gbcon236.seq - Constructed sequence entries, part 236.
379. gbcon237.seq - Constructed sequence entries, part 237.
380. gbcon238.seq - Constructed sequence entries, part 238.
381. gbcon239.seq - Constructed sequence entries, part 239.
382. gbcon24.seq - Constructed sequence entries, part 24.
383. gbcon240.seq - Constructed sequence entries, part 240.
384. gbcon241.seq - Constructed sequence entries, part 241.
385. gbcon242.seq - Constructed sequence entries, part 242.
386. gbcon243.seq - Constructed sequence entries, part 243.
387. gbcon244.seq - Constructed sequence entries, part 244.
388. gbcon245.seq - Constructed sequence entries, part 245.
389. gbcon246.seq - Constructed sequence entries, part 246.
390. gbcon247.seq - Constructed sequence entries, part 247.
391. gbcon248.seq - Constructed sequence entries, part 248.
392. gbcon249.seq - Constructed sequence entries, part 249.
393. gbcon25.seq - Constructed sequence entries, part 25.
394. gbcon250.seq - Constructed sequence entries, part 250.
395. gbcon251.seq - Constructed sequence entries, part 251.
396. gbcon252.seq - Constructed sequence entries, part 252.
397. gbcon253.seq - Constructed sequence entries, part 253.
398. gbcon254.seq - Constructed sequence entries, part 254.
399. gbcon255.seq - Constructed sequence entries, part 255.
400. gbcon256.seq - Constructed sequence entries, part 256.
401. gbcon257.seq - Constructed sequence entries, part 257.
402. gbcon258.seq - Constructed sequence entries, part 258.
403. gbcon259.seq - Constructed sequence entries, part 259.
404. gbcon26.seq - Constructed sequence entries, part 26.
405. gbcon260.seq - Constructed sequence entries, part 260.
406. gbcon261.seq - Constructed sequence entries, part 261.
407. gbcon262.seq - Constructed sequence entries, part 262.
408. gbcon263.seq - Constructed sequence entries, part 263.
409. gbcon264.seq - Constructed sequence entries, part 264.
410. gbcon265.seq - Constructed sequence entries, part 265.
411. gbcon266.seq - Constructed sequence entries, part 266.
412. gbcon267.seq - Constructed sequence entries, part 267.
413. gbcon268.seq - Constructed sequence entries, part 268.
414. gbcon269.seq - Constructed sequence entries, part 269.
415. gbcon27.seq - Constructed sequence entries, part 27.
416. gbcon270.seq - Constructed sequence entries, part 270.
417. gbcon271.seq - Constructed sequence entries, part 271.
418. gbcon272.seq - Constructed sequence entries, part 272.
419. gbcon273.seq - Constructed sequence entries, part 273.
420. gbcon274.seq - Constructed sequence entries, part 274.
421. gbcon275.seq - Constructed sequence entries, part 275.
422. gbcon276.seq - Constructed sequence entries, part 276.
423. gbcon277.seq - Constructed sequence entries, part 277.
424. gbcon278.seq - Constructed sequence entries, part 278.
425. gbcon279.seq - Constructed sequence entries, part 279.
426. gbcon28.seq - Constructed sequence entries, part 28.
427. gbcon280.seq - Constructed sequence entries, part 280.
428. gbcon281.seq - Constructed sequence entries, part 281.
429. gbcon282.seq - Constructed sequence entries, part 282.
430. gbcon283.seq - Constructed sequence entries, part 283.
431. gbcon284.seq - Constructed sequence entries, part 284.
432. gbcon285.seq - Constructed sequence entries, part 285.
433. gbcon286.seq - Constructed sequence entries, part 286.
434. gbcon287.seq - Constructed sequence entries, part 287.
435. gbcon288.seq - Constructed sequence entries, part 288.
436. gbcon289.seq - Constructed sequence entries, part 289.
437. gbcon29.seq - Constructed sequence entries, part 29.
438. gbcon290.seq - Constructed sequence entries, part 290.
439. gbcon291.seq - Constructed sequence entries, part 291.
440. gbcon292.seq - Constructed sequence entries, part 292.
441. gbcon293.seq - Constructed sequence entries, part 293.
442. gbcon294.seq - Constructed sequence entries, part 294.
443. gbcon295.seq - Constructed sequence entries, part 295.
444. gbcon296.seq - Constructed sequence entries, part 296.
445. gbcon297.seq - Constructed sequence entries, part 297.
446. gbcon298.seq - Constructed sequence entries, part 298.
447. gbcon299.seq - Constructed sequence entries, part 299.
448. gbcon3.seq - Constructed sequence entries, part 3.
449. gbcon30.seq - Constructed sequence entries, part 30.
450. gbcon300.seq - Constructed sequence entries, part 300.
451. gbcon301.seq - Constructed sequence entries, part 301.
452. gbcon302.seq - Constructed sequence entries, part 302.
453. gbcon303.seq - Constructed sequence entries, part 303.
454. gbcon304.seq - Constructed sequence entries, part 304.
455. gbcon305.seq - Constructed sequence entries, part 305.
456. gbcon306.seq - Constructed sequence entries, part 306.
457. gbcon307.seq - Constructed sequence entries, part 307.
458. gbcon308.seq - Constructed sequence entries, part 308.
459. gbcon309.seq - Constructed sequence entries, part 309.
460. gbcon31.seq - Constructed sequence entries, part 31.
461. gbcon310.seq - Constructed sequence entries, part 310.
462. gbcon311.seq - Constructed sequence entries, part 311.
463. gbcon312.seq - Constructed sequence entries, part 312.
464. gbcon313.seq - Constructed sequence entries, part 313.
465. gbcon314.seq - Constructed sequence entries, part 314.
466. gbcon315.seq - Constructed sequence entries, part 315.
467. gbcon316.seq - Constructed sequence entries, part 316.
468. gbcon317.seq - Constructed sequence entries, part 317.
469. gbcon318.seq - Constructed sequence entries, part 318.
470. gbcon319.seq - Constructed sequence entries, part 319.
471. gbcon32.seq - Constructed sequence entries, part 32.
472. gbcon320.seq - Constructed sequence entries, part 320.
473. gbcon321.seq - Constructed sequence entries, part 321.
474. gbcon322.seq - Constructed sequence entries, part 322.
475. gbcon323.seq - Constructed sequence entries, part 323.
476. gbcon324.seq - Constructed sequence entries, part 324.
477. gbcon325.seq - Constructed sequence entries, part 325.
478. gbcon326.seq - Constructed sequence entries, part 326.
479. gbcon327.seq - Constructed sequence entries, part 327.
480. gbcon328.seq - Constructed sequence entries, part 328.
481. gbcon329.seq - Constructed sequence entries, part 329.
482. gbcon33.seq - Constructed sequence entries, part 33.
483. gbcon330.seq - Constructed sequence entries, part 330.
484. gbcon34.seq - Constructed sequence entries, part 34.
485. gbcon35.seq - Constructed sequence entries, part 35.
486. gbcon36.seq - Constructed sequence entries, part 36.
487. gbcon37.seq - Constructed sequence entries, part 37.
488. gbcon38.seq - Constructed sequence entries, part 38.
489. gbcon39.seq - Constructed sequence entries, part 39.
490. gbcon4.seq - Constructed sequence entries, part 4.
491. gbcon40.seq - Constructed sequence entries, part 40.
492. gbcon41.seq - Constructed sequence entries, part 41.
493. gbcon42.seq - Constructed sequence entries, part 42.
494. gbcon43.seq - Constructed sequence entries, part 43.
495. gbcon44.seq - Constructed sequence entries, part 44.
496. gbcon45.seq - Constructed sequence entries, part 45.
497. gbcon46.seq - Constructed sequence entries, part 46.
498. gbcon47.seq - Constructed sequence entries, part 47.
499. gbcon48.seq - Constructed sequence entries, part 48.
500. gbcon49.seq - Constructed sequence entries, part 49.
501. gbcon5.seq - Constructed sequence entries, part 5.
502. gbcon50.seq - Constructed sequence entries, part 50.
503. gbcon51.seq - Constructed sequence entries, part 51.
504. gbcon52.seq - Constructed sequence entries, part 52.
505. gbcon53.seq - Constructed sequence entries, part 53.
506. gbcon54.seq - Constructed sequence entries, part 54.
507. gbcon55.seq - Constructed sequence entries, part 55.
508. gbcon56.seq - Constructed sequence entries, part 56.
509. gbcon57.seq - Constructed sequence entries, part 57.
510. gbcon58.seq - Constructed sequence entries, part 58.
511. gbcon59.seq - Constructed sequence entries, part 59.
512. gbcon6.seq - Constructed sequence entries, part 6.
513. gbcon60.seq - Constructed sequence entries, part 60.
514. gbcon61.seq - Constructed sequence entries, part 61.
515. gbcon62.seq - Constructed sequence entries, part 62.
516. gbcon63.seq - Constructed sequence entries, part 63.
517. gbcon64.seq - Constructed sequence entries, part 64.
518. gbcon65.seq - Constructed sequence entries, part 65.
519. gbcon66.seq - Constructed sequence entries, part 66.
520. gbcon67.seq - Constructed sequence entries, part 67.
521. gbcon68.seq - Constructed sequence entries, part 68.
522. gbcon69.seq - Constructed sequence entries, part 69.
523. gbcon7.seq - Constructed sequence entries, part 7.
524. gbcon70.seq - Constructed sequence entries, part 70.
525. gbcon71.seq - Constructed sequence entries, part 71.
526. gbcon72.seq - Constructed sequence entries, part 72.
527. gbcon73.seq - Constructed sequence entries, part 73.
528. gbcon74.seq - Constructed sequence entries, part 74.
529. gbcon75.seq - Constructed sequence entries, part 75.
530. gbcon76.seq - Constructed sequence entries, part 76.
531. gbcon77.seq - Constructed sequence entries, part 77.
532. gbcon78.seq - Constructed sequence entries, part 78.
533. gbcon79.seq - Constructed sequence entries, part 79.
534. gbcon8.seq - Constructed sequence entries, part 8.
535. gbcon80.seq - Constructed sequence entries, part 80.
536. gbcon81.seq - Constructed sequence entries, part 81.
537. gbcon82.seq - Constructed sequence entries, part 82.
538. gbcon83.seq - Constructed sequence entries, part 83.
539. gbcon84.seq - Constructed sequence entries, part 84.
540. gbcon85.seq - Constructed sequence entries, part 85.
541. gbcon86.seq - Constructed sequence entries, part 86.
542. gbcon87.seq - Constructed sequence entries, part 87.
543. gbcon88.seq - Constructed sequence entries, part 88.
544. gbcon89.seq - Constructed sequence entries, part 89.
545. gbcon9.seq - Constructed sequence entries, part 9.
546. gbcon90.seq - Constructed sequence entries, part 90.
547. gbcon91.seq - Constructed sequence entries, part 91.
548. gbcon92.seq - Constructed sequence entries, part 92.
549. gbcon93.seq - Constructed sequence entries, part 93.
550. gbcon94.seq - Constructed sequence entries, part 94.
551. gbcon95.seq - Constructed sequence entries, part 95.
552. gbcon96.seq - Constructed sequence entries, part 96.
553. gbcon97.seq - Constructed sequence entries, part 97.
554. gbcon98.seq - Constructed sequence entries, part 98.
555. gbcon99.seq - Constructed sequence entries, part 99.
556. gbdel.txt - Accession numbers of entries deleted since the previous release.
557. gbenv1.seq - Environmental sampling sequence entries, part 1.
558. gbenv10.seq - Environmental sampling sequence entries, part 10.
559. gbenv11.seq - Environmental sampling sequence entries, part 11.
560. gbenv12.seq - Environmental sampling sequence entries, part 12.
561. gbenv13.seq - Environmental sampling sequence entries, part 13.
562. gbenv14.seq - Environmental sampling sequence entries, part 14.
563. gbenv15.seq - Environmental sampling sequence entries, part 15.
564. gbenv16.seq - Environmental sampling sequence entries, part 16.
565. gbenv17.seq - Environmental sampling sequence entries, part 17.
566. gbenv18.seq - Environmental sampling sequence entries, part 18.
567. gbenv19.seq - Environmental sampling sequence entries, part 19.
568. gbenv2.seq - Environmental sampling sequence entries, part 2.
569. gbenv20.seq - Environmental sampling sequence entries, part 20.
570. gbenv21.seq - Environmental sampling sequence entries, part 21.
571. gbenv22.seq - Environmental sampling sequence entries, part 22.
572. gbenv23.seq - Environmental sampling sequence entries, part 23.
573. gbenv24.seq - Environmental sampling sequence entries, part 24.
574. gbenv25.seq - Environmental sampling sequence entries, part 25.
575. gbenv26.seq - Environmental sampling sequence entries, part 26.
576. gbenv27.seq - Environmental sampling sequence entries, part 27.
577. gbenv28.seq - Environmental sampling sequence entries, part 28.
578. gbenv29.seq - Environmental sampling sequence entries, part 29.
579. gbenv3.seq - Environmental sampling sequence entries, part 3.
580. gbenv30.seq - Environmental sampling sequence entries, part 30.
581. gbenv31.seq - Environmental sampling sequence entries, part 31.
582. gbenv32.seq - Environmental sampling sequence entries, part 32.
583. gbenv33.seq - Environmental sampling sequence entries, part 33.
584. gbenv34.seq - Environmental sampling sequence entries, part 34.
585. gbenv35.seq - Environmental sampling sequence entries, part 35.
586. gbenv36.seq - Environmental sampling sequence entries, part 36.
587. gbenv37.seq - Environmental sampling sequence entries, part 37.
588. gbenv38.seq - Environmental sampling sequence entries, part 38.
589. gbenv39.seq - Environmental sampling sequence entries, part 39.
590. gbenv4.seq - Environmental sampling sequence entries, part 4.
591. gbenv40.seq - Environmental sampling sequence entries, part 40.
592. gbenv41.seq - Environmental sampling sequence entries, part 41.
593. gbenv42.seq - Environmental sampling sequence entries, part 42.
594. gbenv43.seq - Environmental sampling sequence entries, part 43.
595. gbenv44.seq - Environmental sampling sequence entries, part 44.
596. gbenv45.seq - Environmental sampling sequence entries, part 45.
597. gbenv46.seq - Environmental sampling sequence entries, part 46.
598. gbenv47.seq - Environmental sampling sequence entries, part 47.
599. gbenv48.seq - Environmental sampling sequence entries, part 48.
600. gbenv49.seq - Environmental sampling sequence entries, part 49.
601. gbenv5.seq - Environmental sampling sequence entries, part 5.
602. gbenv50.seq - Environmental sampling sequence entries, part 50.
603. gbenv51.seq - Environmental sampling sequence entries, part 51.
604. gbenv52.seq - Environmental sampling sequence entries, part 52.
605. gbenv53.seq - Environmental sampling sequence entries, part 53.
606. gbenv54.seq - Environmental sampling sequence entries, part 54.
607. gbenv55.seq - Environmental sampling sequence entries, part 55.
608. gbenv56.seq - Environmental sampling sequence entries, part 56.
609. gbenv57.seq - Environmental sampling sequence entries, part 57.
610. gbenv58.seq - Environmental sampling sequence entries, part 58.
611. gbenv59.seq - Environmental sampling sequence entries, part 59.
612. gbenv6.seq - Environmental sampling sequence entries, part 6.
613. gbenv60.seq - Environmental sampling sequence entries, part 60.
614. gbenv61.seq - Environmental sampling sequence entries, part 61.
615. gbenv62.seq - Environmental sampling sequence entries, part 62.
616. gbenv63.seq - Environmental sampling sequence entries, part 63.
617. gbenv64.seq - Environmental sampling sequence entries, part 64.
618. gbenv65.seq - Environmental sampling sequence entries, part 65.
619. gbenv66.seq - Environmental sampling sequence entries, part 66.
620. gbenv67.seq - Environmental sampling sequence entries, part 67.
621. gbenv68.seq - Environmental sampling sequence entries, part 68.
622. gbenv69.seq - Environmental sampling sequence entries, part 69.
623. gbenv7.seq - Environmental sampling sequence entries, part 7.
624. gbenv70.seq - Environmental sampling sequence entries, part 70.
625. gbenv71.seq - Environmental sampling sequence entries, part 71.
626. gbenv72.seq - Environmental sampling sequence entries, part 72.
627. gbenv73.seq - Environmental sampling sequence entries, part 73.
628. gbenv74.seq - Environmental sampling sequence entries, part 74.
629. gbenv75.seq - Environmental sampling sequence entries, part 75.
630. gbenv76.seq - Environmental sampling sequence entries, part 76.
631. gbenv77.seq - Environmental sampling sequence entries, part 77.
632. gbenv78.seq - Environmental sampling sequence entries, part 78.
633. gbenv79.seq - Environmental sampling sequence entries, part 79.
634. gbenv8.seq - Environmental sampling sequence entries, part 8.
635. gbenv80.seq - Environmental sampling sequence entries, part 80.
636. gbenv81.seq - Environmental sampling sequence entries, part 81.
637. gbenv82.seq - Environmental sampling sequence entries, part 82.
638. gbenv83.seq - Environmental sampling sequence entries, part 83.
639. gbenv84.seq - Environmental sampling sequence entries, part 84.
640. gbenv85.seq - Environmental sampling sequence entries, part 85.
641. gbenv86.seq - Environmental sampling sequence entries, part 86.
642. gbenv87.seq - Environmental sampling sequence entries, part 87.
643. gbenv88.seq - Environmental sampling sequence entries, part 88.
644. gbenv89.seq - Environmental sampling sequence entries, part 89.
645. gbenv9.seq - Environmental sampling sequence entries, part 9.
646. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
647. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
648. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
649. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
650. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
651. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
652. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
653. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
654. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
655. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
656. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
657. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
658. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
659. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
660. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
661. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
662. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
663. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
664. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
665. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
666. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
667. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
668. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
669. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
670. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
671. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
672. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
673. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
674. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
675. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
676. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
677. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
678. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
679. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
680. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
681. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
682. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
683. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
684. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
685. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
686. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
687. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
688. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
689. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
690. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
691. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
692. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
693. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
694. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
695. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
696. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
697. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
698. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
699. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
700. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
701. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
702. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
703. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
704. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
705. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
706. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
707. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
708. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
709. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
710. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
711. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
712. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
713. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
714. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
715. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
716. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
717. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
718. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
719. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
720. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
721. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
722. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
723. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
724. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
725. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
726. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
727. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
728. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
729. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
730. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
731. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
732. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
733. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
734. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
735. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
736. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
737. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
738. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
739. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
740. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
741. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
742. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
743. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
744. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
745. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
746. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
747. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
748. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
749. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
750. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
751. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
752. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
753. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
754. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
755. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
756. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
757. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
758. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
759. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
760. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
761. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
762. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
763. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
764. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
765. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
766. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
767. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
768. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
769. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
770. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
771. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
772. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
773. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
774. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
775. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
776. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
777. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
778. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
779. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
780. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
781. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
782. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
783. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
784. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
785. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
786. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
787. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
788. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
789. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
790. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
791. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
792. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
793. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
794. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
795. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
796. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
797. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
798. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
799. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
800. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
801. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
802. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
803. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
804. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
805. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
806. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
807. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
808. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
809. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
810. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
811. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
812. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
813. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
814. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
815. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
816. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
817. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
818. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
819. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
820. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
821. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
822. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
823. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
824. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
825. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
826. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
827. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
828. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
829. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
830. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
831. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
832. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
833. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
834. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
835. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
836. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
837. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
838. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
839. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
840. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
841. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
842. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
843. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
844. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
845. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
846. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
847. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
848. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
849. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
850. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
851. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
852. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
853. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
854. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
855. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
856. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
857. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
858. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
859. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
860. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
861. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
862. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
863. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
864. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
865. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
866. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
867. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
868. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
869. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
870. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
871. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
872. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
873. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
874. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
875. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
876. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
877. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
878. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
879. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
880. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
881. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
882. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
883. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
884. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
885. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
886. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
887. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
888. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
889. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
890. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
891. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
892. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
893. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
894. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
895. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
896. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
897. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
898. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
899. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
900. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
901. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
902. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
903. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
904. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
905. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
906. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
907. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
908. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
909. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
910. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
911. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
912. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
913. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
914. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
915. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
916. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
917. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
918. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
919. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
920. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
921. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
922. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
923. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
924. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
925. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
926. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
927. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
928. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
929. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
930. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
931. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
932. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
933. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
934. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
935. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
936. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
937. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
938. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
939. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
940. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
941. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
942. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
943. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
944. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
945. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
946. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
947. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
948. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
949. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
950. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
951. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
952. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
953. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
954. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
955. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
956. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
957. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
958. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
959. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
960. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
961. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
962. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
963. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
964. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
965. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
966. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
967. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
968. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
969. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
970. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
971. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
972. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
973. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
974. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
975. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
976. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
977. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
978. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
979. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
980. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
981. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
982. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
983. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
984. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
985. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
986. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
987. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
988. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
989. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
990. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
991. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
992. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
993. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
994. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
995. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
996. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
997. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
998. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
999. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1000. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1001. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1002. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1003. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1004. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1005. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1006. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1007. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1008. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1009. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1010. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1011. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1012. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1013. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1014. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1015. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1016. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1017. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1018. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1019. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1020. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1021. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1022. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1023. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1024. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1025. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1026. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1027. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1028. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1029. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1030. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1031. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1032. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1033. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1034. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1035. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1036. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1037. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1038. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1039. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1040. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1041. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1042. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1043. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1044. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1045. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1046. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1047. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1048. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1049. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1050. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1051. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1052. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1053. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1054. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1055. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1056. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1057. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1058. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1059. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1060. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1061. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1062. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1063. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1064. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1065. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1066. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1067. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1068. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1069. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1070. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1071. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1072. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1073. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1074. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1075. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1076. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1077. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1078. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1079. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1080. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1081. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1082. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1083. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1084. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1085. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1086. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1087. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1088. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1089. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1090. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1091. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1092. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1093. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1094. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1095. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1096. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1097. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1098. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1099. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1100. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1101. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1102. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1103. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1104. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1105. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1106. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1107. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1108. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1109. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1110. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1111. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1112. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1113. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1114. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1115. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1116. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1117. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1118. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1119. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1120. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1121. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1122. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1123. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1124. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1125. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1126. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1127. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1128. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1129. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1130. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1131. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1132. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1133. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1134. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1135. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1136. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1137. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1138. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1139. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1140. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1141. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1142. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1143. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1144. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1145. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1146. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1147. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1148. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1149. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1150. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1151. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1152. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1153. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1154. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1155. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1156. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1157. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1158. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1159. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1160. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1161. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1162. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1163. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1164. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1165. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1166. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1167. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1168. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1169. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1170. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1171. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1172. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1173. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1174. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1175. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1176. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1177. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1178. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1179. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1180. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1181. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1182. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1183. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1184. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1185. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1186. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1187. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1188. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1189. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1190. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1191. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1192. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1193. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1194. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1195. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1196. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1197. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1198. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1199. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1200. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1201. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1202. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1203. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1204. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1205. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1206. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1207. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1208. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1209. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1210. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1211. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1212. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1213. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1214. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1215. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1216. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1217. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1218. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1219. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1220. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1221. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1222. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1223. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1224. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1225. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1226. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1227. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1228. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1229. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1230. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1231. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1232. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1233. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1234. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1235. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1236. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1237. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1238. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1239. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1240. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1241. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1242. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1243. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1244. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1245. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1246. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1247. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1248. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1249. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1250. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1251. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1252. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1253. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1254. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1255. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1256. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1257. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1258. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1259. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1260. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1261. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1262. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1263. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1264. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1265. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1266. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1267. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1268. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1269. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1270. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1271. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1272. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1273. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1274. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1275. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1276. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1277. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1278. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1279. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1280. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1281. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1282. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1283. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1284. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1285. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1286. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1287. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1288. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1289. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1290. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1291. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1292. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1293. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1294. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1295. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1296. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1297. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1298. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1299. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1300. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1301. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1302. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1303. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1304. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1305. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1306. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1307. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1308. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1309. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1310. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1311. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1312. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1313. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1314. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1315. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1316. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1317. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1318. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1319. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1320. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1321. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1322. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1323. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1324. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1325. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1326. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1327. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1328. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1329. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1330. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1331. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1332. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1333. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1334. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1335. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1336. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1337. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1338. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1339. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1340. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1341. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1342. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1343. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1344. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1345. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1346. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1347. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1348. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1349. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1350. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1351. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1352. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1353. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1354. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1355. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1356. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1357. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1358. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1359. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1360. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1361. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1362. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1363. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1364. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1365. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1366. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1367. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1368. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1369. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1370. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1371. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1372. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1373. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1374. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1375. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1376. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1377. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1378. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1379. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1380. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1381. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1382. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1383. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1384. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1385. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1386. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1387. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1388. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1389. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1390. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1391. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1392. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1393. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1394. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1395. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1396. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1397. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1398. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1399. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1400. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1401. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1402. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1403. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1404. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1405. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1406. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1407. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1408. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1409. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1410. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1411. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1412. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1413. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1414. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1415. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1416. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1417. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1418. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1419. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1420. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1421. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1422. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1423. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1424. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1425. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1426. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1427. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1428. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1429. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1430. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1431. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1432. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1433. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1434. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1435. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1436. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1437. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1438. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1439. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1440. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1441. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1442. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1443. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1444. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1445. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1446. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1447. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1448. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1449. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1450. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1451. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1452. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1453. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1454. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1455. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1456. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1457. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1458. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1459. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1460. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1461. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1462. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1463. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1464. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1465. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1466. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1467. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1468. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1469. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1470. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1471. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1472. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1473. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1474. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1475. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1476. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1477. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1478. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1479. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1480. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1481. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1482. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1483. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1484. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1485. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1486. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1487. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1488. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1489. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1490. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1491. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1492. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1493. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1494. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1495. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1496. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1497. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1498. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1499. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1500. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1501. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1502. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1503. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1504. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1505. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1506. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1507. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1508. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1509. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1510. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1511. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1512. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1513. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1514. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1515. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1516. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1517. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1518. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1519. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1520. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1521. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1522. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1523. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1524. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1525. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1526. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1527. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1528. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1529. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1530. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1531. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1532. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1533. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1534. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1535. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1536. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1537. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1538. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1539. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1540. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1541. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1542. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1543. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1544. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1545. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1546. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1547. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1548. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1549. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1550. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1551. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1552. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1553. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1554. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1555. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1556. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1557. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1558. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1559. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1560. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1561. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1562. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1563. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1564. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1565. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1566. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1567. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1568. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1569. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1570. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1571. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1572. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1573. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1574. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1575. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1576. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1577. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1578. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1579. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1580. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1581. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1582. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1583. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1584. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1585. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1586. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1587. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1588. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1589. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1590. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1591. gbinv1.seq - Invertebrate sequence entries, part 1.
1592. gbinv10.seq - Invertebrate sequence entries, part 10.
1593. gbinv100.seq - Invertebrate sequence entries, part 100.
1594. gbinv101.seq - Invertebrate sequence entries, part 101.
1595. gbinv102.seq - Invertebrate sequence entries, part 102.
1596. gbinv103.seq - Invertebrate sequence entries, part 103.
1597. gbinv104.seq - Invertebrate sequence entries, part 104.
1598. gbinv105.seq - Invertebrate sequence entries, part 105.
1599. gbinv106.seq - Invertebrate sequence entries, part 106.
1600. gbinv107.seq - Invertebrate sequence entries, part 107.
1601. gbinv108.seq - Invertebrate sequence entries, part 108.
1602. gbinv109.seq - Invertebrate sequence entries, part 109.
1603. gbinv11.seq - Invertebrate sequence entries, part 11.
1604. gbinv110.seq - Invertebrate sequence entries, part 110.
1605. gbinv111.seq - Invertebrate sequence entries, part 111.
1606. gbinv112.seq - Invertebrate sequence entries, part 112.
1607. gbinv113.seq - Invertebrate sequence entries, part 113.
1608. gbinv114.seq - Invertebrate sequence entries, part 114.
1609. gbinv115.seq - Invertebrate sequence entries, part 115.
1610. gbinv116.seq - Invertebrate sequence entries, part 116.
1611. gbinv117.seq - Invertebrate sequence entries, part 117.
1612. gbinv118.seq - Invertebrate sequence entries, part 118.
1613. gbinv119.seq - Invertebrate sequence entries, part 119.
1614. gbinv12.seq - Invertebrate sequence entries, part 12.
1615. gbinv120.seq - Invertebrate sequence entries, part 120.
1616. gbinv121.seq - Invertebrate sequence entries, part 121.
1617. gbinv122.seq - Invertebrate sequence entries, part 122.
1618. gbinv123.seq - Invertebrate sequence entries, part 123.
1619. gbinv124.seq - Invertebrate sequence entries, part 124.
1620. gbinv125.seq - Invertebrate sequence entries, part 125.
1621. gbinv126.seq - Invertebrate sequence entries, part 126.
1622. gbinv127.seq - Invertebrate sequence entries, part 127.
1623. gbinv128.seq - Invertebrate sequence entries, part 128.
1624. gbinv129.seq - Invertebrate sequence entries, part 129.
1625. gbinv13.seq - Invertebrate sequence entries, part 13.
1626. gbinv130.seq - Invertebrate sequence entries, part 130.
1627. gbinv131.seq - Invertebrate sequence entries, part 131.
1628. gbinv132.seq - Invertebrate sequence entries, part 132.
1629. gbinv133.seq - Invertebrate sequence entries, part 133.
1630. gbinv134.seq - Invertebrate sequence entries, part 134.
1631. gbinv135.seq - Invertebrate sequence entries, part 135.
1632. gbinv136.seq - Invertebrate sequence entries, part 136.
1633. gbinv14.seq - Invertebrate sequence entries, part 14.
1634. gbinv15.seq - Invertebrate sequence entries, part 15.
1635. gbinv16.seq - Invertebrate sequence entries, part 16.
1636. gbinv17.seq - Invertebrate sequence entries, part 17.
1637. gbinv18.seq - Invertebrate sequence entries, part 18.
1638. gbinv19.seq - Invertebrate sequence entries, part 19.
1639. gbinv2.seq - Invertebrate sequence entries, part 2.
1640. gbinv20.seq - Invertebrate sequence entries, part 20.
1641. gbinv21.seq - Invertebrate sequence entries, part 21.
1642. gbinv22.seq - Invertebrate sequence entries, part 22.
1643. gbinv23.seq - Invertebrate sequence entries, part 23.
1644. gbinv24.seq - Invertebrate sequence entries, part 24.
1645. gbinv25.seq - Invertebrate sequence entries, part 25.
1646. gbinv26.seq - Invertebrate sequence entries, part 26.
1647. gbinv27.seq - Invertebrate sequence entries, part 27.
1648. gbinv28.seq - Invertebrate sequence entries, part 28.
1649. gbinv29.seq - Invertebrate sequence entries, part 29.
1650. gbinv3.seq - Invertebrate sequence entries, part 3.
1651. gbinv30.seq - Invertebrate sequence entries, part 30.
1652. gbinv31.seq - Invertebrate sequence entries, part 31.
1653. gbinv32.seq - Invertebrate sequence entries, part 32.
1654. gbinv33.seq - Invertebrate sequence entries, part 33.
1655. gbinv34.seq - Invertebrate sequence entries, part 34.
1656. gbinv35.seq - Invertebrate sequence entries, part 35.
1657. gbinv36.seq - Invertebrate sequence entries, part 36.
1658. gbinv37.seq - Invertebrate sequence entries, part 37.
1659. gbinv38.seq - Invertebrate sequence entries, part 38.
1660. gbinv39.seq - Invertebrate sequence entries, part 39.
1661. gbinv4.seq - Invertebrate sequence entries, part 4.
1662. gbinv40.seq - Invertebrate sequence entries, part 40.
1663. gbinv41.seq - Invertebrate sequence entries, part 41.
1664. gbinv42.seq - Invertebrate sequence entries, part 42.
1665. gbinv43.seq - Invertebrate sequence entries, part 43.
1666. gbinv44.seq - Invertebrate sequence entries, part 44.
1667. gbinv45.seq - Invertebrate sequence entries, part 45.
1668. gbinv46.seq - Invertebrate sequence entries, part 46.
1669. gbinv47.seq - Invertebrate sequence entries, part 47.
1670. gbinv48.seq - Invertebrate sequence entries, part 48.
1671. gbinv49.seq - Invertebrate sequence entries, part 49.
1672. gbinv5.seq - Invertebrate sequence entries, part 5.
1673. gbinv50.seq - Invertebrate sequence entries, part 50.
1674. gbinv51.seq - Invertebrate sequence entries, part 51.
1675. gbinv52.seq - Invertebrate sequence entries, part 52.
1676. gbinv53.seq - Invertebrate sequence entries, part 53.
1677. gbinv54.seq - Invertebrate sequence entries, part 54.
1678. gbinv55.seq - Invertebrate sequence entries, part 55.
1679. gbinv56.seq - Invertebrate sequence entries, part 56.
1680. gbinv57.seq - Invertebrate sequence entries, part 57.
1681. gbinv58.seq - Invertebrate sequence entries, part 58.
1682. gbinv59.seq - Invertebrate sequence entries, part 59.
1683. gbinv6.seq - Invertebrate sequence entries, part 6.
1684. gbinv60.seq - Invertebrate sequence entries, part 60.
1685. gbinv61.seq - Invertebrate sequence entries, part 61.
1686. gbinv62.seq - Invertebrate sequence entries, part 62.
1687. gbinv63.seq - Invertebrate sequence entries, part 63.
1688. gbinv64.seq - Invertebrate sequence entries, part 64.
1689. gbinv65.seq - Invertebrate sequence entries, part 65.
1690. gbinv66.seq - Invertebrate sequence entries, part 66.
1691. gbinv67.seq - Invertebrate sequence entries, part 67.
1692. gbinv68.seq - Invertebrate sequence entries, part 68.
1693. gbinv69.seq - Invertebrate sequence entries, part 69.
1694. gbinv7.seq - Invertebrate sequence entries, part 7.
1695. gbinv70.seq - Invertebrate sequence entries, part 70.
1696. gbinv71.seq - Invertebrate sequence entries, part 71.
1697. gbinv72.seq - Invertebrate sequence entries, part 72.
1698. gbinv73.seq - Invertebrate sequence entries, part 73.
1699. gbinv74.seq - Invertebrate sequence entries, part 74.
1700. gbinv75.seq - Invertebrate sequence entries, part 75.
1701. gbinv76.seq - Invertebrate sequence entries, part 76.
1702. gbinv77.seq - Invertebrate sequence entries, part 77.
1703. gbinv78.seq - Invertebrate sequence entries, part 78.
1704. gbinv79.seq - Invertebrate sequence entries, part 79.
1705. gbinv8.seq - Invertebrate sequence entries, part 8.
1706. gbinv80.seq - Invertebrate sequence entries, part 80.
1707. gbinv81.seq - Invertebrate sequence entries, part 81.
1708. gbinv82.seq - Invertebrate sequence entries, part 82.
1709. gbinv83.seq - Invertebrate sequence entries, part 83.
1710. gbinv84.seq - Invertebrate sequence entries, part 84.
1711. gbinv85.seq - Invertebrate sequence entries, part 85.
1712. gbinv86.seq - Invertebrate sequence entries, part 86.
1713. gbinv87.seq - Invertebrate sequence entries, part 87.
1714. gbinv88.seq - Invertebrate sequence entries, part 88.
1715. gbinv89.seq - Invertebrate sequence entries, part 89.
1716. gbinv9.seq - Invertebrate sequence entries, part 9.
1717. gbinv90.seq - Invertebrate sequence entries, part 90.
1718. gbinv91.seq - Invertebrate sequence entries, part 91.
1719. gbinv92.seq - Invertebrate sequence entries, part 92.
1720. gbinv93.seq - Invertebrate sequence entries, part 93.
1721. gbinv94.seq - Invertebrate sequence entries, part 94.
1722. gbinv95.seq - Invertebrate sequence entries, part 95.
1723. gbinv96.seq - Invertebrate sequence entries, part 96.
1724. gbinv97.seq - Invertebrate sequence entries, part 97.
1725. gbinv98.seq - Invertebrate sequence entries, part 98.
1726. gbinv99.seq - Invertebrate sequence entries, part 99.
1727. gbmam1.seq - Other mammalian sequence entries, part 1.
1728. gbmam10.seq - Other mammalian sequence entries, part 10.
1729. gbmam11.seq - Other mammalian sequence entries, part 11.
1730. gbmam12.seq - Other mammalian sequence entries, part 12.
1731. gbmam13.seq - Other mammalian sequence entries, part 13.
1732. gbmam14.seq - Other mammalian sequence entries, part 14.
1733. gbmam15.seq - Other mammalian sequence entries, part 15.
1734. gbmam16.seq - Other mammalian sequence entries, part 16.
1735. gbmam17.seq - Other mammalian sequence entries, part 17.
1736. gbmam18.seq - Other mammalian sequence entries, part 18.
1737. gbmam19.seq - Other mammalian sequence entries, part 19.
1738. gbmam2.seq - Other mammalian sequence entries, part 2.
1739. gbmam20.seq - Other mammalian sequence entries, part 20.
1740. gbmam21.seq - Other mammalian sequence entries, part 21.
1741. gbmam22.seq - Other mammalian sequence entries, part 22.
1742. gbmam23.seq - Other mammalian sequence entries, part 23.
1743. gbmam24.seq - Other mammalian sequence entries, part 24.
1744. gbmam25.seq - Other mammalian sequence entries, part 25.
1745. gbmam26.seq - Other mammalian sequence entries, part 26.
1746. gbmam27.seq - Other mammalian sequence entries, part 27.
1747. gbmam28.seq - Other mammalian sequence entries, part 28.
1748. gbmam29.seq - Other mammalian sequence entries, part 29.
1749. gbmam3.seq - Other mammalian sequence entries, part 3.
1750. gbmam30.seq - Other mammalian sequence entries, part 30.
1751. gbmam31.seq - Other mammalian sequence entries, part 31.
1752. gbmam32.seq - Other mammalian sequence entries, part 32.
1753. gbmam33.seq - Other mammalian sequence entries, part 33.
1754. gbmam34.seq - Other mammalian sequence entries, part 34.
1755. gbmam35.seq - Other mammalian sequence entries, part 35.
1756. gbmam36.seq - Other mammalian sequence entries, part 36.
1757. gbmam37.seq - Other mammalian sequence entries, part 37.
1758. gbmam4.seq - Other mammalian sequence entries, part 4.
1759. gbmam5.seq - Other mammalian sequence entries, part 5.
1760. gbmam6.seq - Other mammalian sequence entries, part 6.
1761. gbmam7.seq - Other mammalian sequence entries, part 7.
1762. gbmam8.seq - Other mammalian sequence entries, part 8.
1763. gbmam9.seq - Other mammalian sequence entries, part 9.
1764. gbnew.txt - Accession numbers of entries new since the previous release.
1765. gbpat1.seq - Patent sequence entries, part 1.
1766. gbpat10.seq - Patent sequence entries, part 10.
1767. gbpat100.seq - Patent sequence entries, part 100.
1768. gbpat101.seq - Patent sequence entries, part 101.
1769. gbpat102.seq - Patent sequence entries, part 102.
1770. gbpat103.seq - Patent sequence entries, part 103.
1771. gbpat104.seq - Patent sequence entries, part 104.
1772. gbpat105.seq - Patent sequence entries, part 105.
1773. gbpat106.seq - Patent sequence entries, part 106.
1774. gbpat107.seq - Patent sequence entries, part 107.
1775. gbpat108.seq - Patent sequence entries, part 108.
1776. gbpat109.seq - Patent sequence entries, part 109.
1777. gbpat11.seq - Patent sequence entries, part 11.
1778. gbpat110.seq - Patent sequence entries, part 110.
1779. gbpat111.seq - Patent sequence entries, part 111.
1780. gbpat112.seq - Patent sequence entries, part 112.
1781. gbpat113.seq - Patent sequence entries, part 113.
1782. gbpat114.seq - Patent sequence entries, part 114.
1783. gbpat115.seq - Patent sequence entries, part 115.
1784. gbpat116.seq - Patent sequence entries, part 116.
1785. gbpat117.seq - Patent sequence entries, part 117.
1786. gbpat118.seq - Patent sequence entries, part 118.
1787. gbpat119.seq - Patent sequence entries, part 119.
1788. gbpat12.seq - Patent sequence entries, part 12.
1789. gbpat120.seq - Patent sequence entries, part 120.
1790. gbpat121.seq - Patent sequence entries, part 121.
1791. gbpat122.seq - Patent sequence entries, part 122.
1792. gbpat123.seq - Patent sequence entries, part 123.
1793. gbpat124.seq - Patent sequence entries, part 124.
1794. gbpat125.seq - Patent sequence entries, part 125.
1795. gbpat126.seq - Patent sequence entries, part 126.
1796. gbpat127.seq - Patent sequence entries, part 127.
1797. gbpat128.seq - Patent sequence entries, part 128.
1798. gbpat129.seq - Patent sequence entries, part 129.
1799. gbpat13.seq - Patent sequence entries, part 13.
1800. gbpat130.seq - Patent sequence entries, part 130.
1801. gbpat131.seq - Patent sequence entries, part 131.
1802. gbpat132.seq - Patent sequence entries, part 132.
1803. gbpat133.seq - Patent sequence entries, part 133.
1804. gbpat134.seq - Patent sequence entries, part 134.
1805. gbpat135.seq - Patent sequence entries, part 135.
1806. gbpat136.seq - Patent sequence entries, part 136.
1807. gbpat137.seq - Patent sequence entries, part 137.
1808. gbpat138.seq - Patent sequence entries, part 138.
1809. gbpat139.seq - Patent sequence entries, part 139.
1810. gbpat14.seq - Patent sequence entries, part 14.
1811. gbpat140.seq - Patent sequence entries, part 140.
1812. gbpat141.seq - Patent sequence entries, part 141.
1813. gbpat142.seq - Patent sequence entries, part 142.
1814. gbpat143.seq - Patent sequence entries, part 143.
1815. gbpat144.seq - Patent sequence entries, part 144.
1816. gbpat145.seq - Patent sequence entries, part 145.
1817. gbpat146.seq - Patent sequence entries, part 146.
1818. gbpat147.seq - Patent sequence entries, part 147.
1819. gbpat148.seq - Patent sequence entries, part 148.
1820. gbpat149.seq - Patent sequence entries, part 149.
1821. gbpat15.seq - Patent sequence entries, part 15.
1822. gbpat150.seq - Patent sequence entries, part 150.
1823. gbpat151.seq - Patent sequence entries, part 151.
1824. gbpat152.seq - Patent sequence entries, part 152.
1825. gbpat153.seq - Patent sequence entries, part 153.
1826. gbpat154.seq - Patent sequence entries, part 154.
1827. gbpat155.seq - Patent sequence entries, part 155.
1828. gbpat156.seq - Patent sequence entries, part 156.
1829. gbpat157.seq - Patent sequence entries, part 157.
1830. gbpat158.seq - Patent sequence entries, part 158.
1831. gbpat159.seq - Patent sequence entries, part 159.
1832. gbpat16.seq - Patent sequence entries, part 16.
1833. gbpat160.seq - Patent sequence entries, part 160.
1834. gbpat161.seq - Patent sequence entries, part 161.
1835. gbpat162.seq - Patent sequence entries, part 162.
1836. gbpat163.seq - Patent sequence entries, part 163.
1837. gbpat164.seq - Patent sequence entries, part 164.
1838. gbpat165.seq - Patent sequence entries, part 165.
1839. gbpat166.seq - Patent sequence entries, part 166.
1840. gbpat167.seq - Patent sequence entries, part 167.
1841. gbpat168.seq - Patent sequence entries, part 168.
1842. gbpat169.seq - Patent sequence entries, part 169.
1843. gbpat17.seq - Patent sequence entries, part 17.
1844. gbpat170.seq - Patent sequence entries, part 170.
1845. gbpat171.seq - Patent sequence entries, part 171.
1846. gbpat172.seq - Patent sequence entries, part 172.
1847. gbpat173.seq - Patent sequence entries, part 173.
1848. gbpat174.seq - Patent sequence entries, part 174.
1849. gbpat175.seq - Patent sequence entries, part 175.
1850. gbpat176.seq - Patent sequence entries, part 176.
1851. gbpat177.seq - Patent sequence entries, part 177.
1852. gbpat178.seq - Patent sequence entries, part 178.
1853. gbpat179.seq - Patent sequence entries, part 179.
1854. gbpat18.seq - Patent sequence entries, part 18.
1855. gbpat180.seq - Patent sequence entries, part 180.
1856. gbpat181.seq - Patent sequence entries, part 181.
1857. gbpat182.seq - Patent sequence entries, part 182.
1858. gbpat183.seq - Patent sequence entries, part 183.
1859. gbpat184.seq - Patent sequence entries, part 184.
1860. gbpat185.seq - Patent sequence entries, part 185.
1861. gbpat186.seq - Patent sequence entries, part 186.
1862. gbpat187.seq - Patent sequence entries, part 187.
1863. gbpat188.seq - Patent sequence entries, part 188.
1864. gbpat189.seq - Patent sequence entries, part 189.
1865. gbpat19.seq - Patent sequence entries, part 19.
1866. gbpat190.seq - Patent sequence entries, part 190.
1867. gbpat191.seq - Patent sequence entries, part 191.
1868. gbpat192.seq - Patent sequence entries, part 192.
1869. gbpat193.seq - Patent sequence entries, part 193.
1870. gbpat194.seq - Patent sequence entries, part 194.
1871. gbpat195.seq - Patent sequence entries, part 195.
1872. gbpat196.seq - Patent sequence entries, part 196.
1873. gbpat197.seq - Patent sequence entries, part 197.
1874. gbpat198.seq - Patent sequence entries, part 198.
1875. gbpat199.seq - Patent sequence entries, part 199.
1876. gbpat2.seq - Patent sequence entries, part 2.
1877. gbpat20.seq - Patent sequence entries, part 20.
1878. gbpat200.seq - Patent sequence entries, part 200.
1879. gbpat201.seq - Patent sequence entries, part 201.
1880. gbpat202.seq - Patent sequence entries, part 202.
1881. gbpat203.seq - Patent sequence entries, part 203.
1882. gbpat204.seq - Patent sequence entries, part 204.
1883. gbpat205.seq - Patent sequence entries, part 205.
1884. gbpat206.seq - Patent sequence entries, part 206.
1885. gbpat207.seq - Patent sequence entries, part 207.
1886. gbpat208.seq - Patent sequence entries, part 208.
1887. gbpat209.seq - Patent sequence entries, part 209.
1888. gbpat21.seq - Patent sequence entries, part 21.
1889. gbpat210.seq - Patent sequence entries, part 210.
1890. gbpat211.seq - Patent sequence entries, part 211.
1891. gbpat212.seq - Patent sequence entries, part 212.
1892. gbpat213.seq - Patent sequence entries, part 213.
1893. gbpat214.seq - Patent sequence entries, part 214.
1894. gbpat215.seq - Patent sequence entries, part 215.
1895. gbpat216.seq - Patent sequence entries, part 216.
1896. gbpat217.seq - Patent sequence entries, part 217.
1897. gbpat218.seq - Patent sequence entries, part 218.
1898. gbpat219.seq - Patent sequence entries, part 219.
1899. gbpat22.seq - Patent sequence entries, part 22.
1900. gbpat220.seq - Patent sequence entries, part 220.
1901. gbpat221.seq - Patent sequence entries, part 221.
1902. gbpat222.seq - Patent sequence entries, part 222.
1903. gbpat223.seq - Patent sequence entries, part 223.
1904. gbpat224.seq - Patent sequence entries, part 224.
1905. gbpat225.seq - Patent sequence entries, part 225.
1906. gbpat226.seq - Patent sequence entries, part 226.
1907. gbpat227.seq - Patent sequence entries, part 227.
1908. gbpat228.seq - Patent sequence entries, part 228.
1909. gbpat229.seq - Patent sequence entries, part 229.
1910. gbpat23.seq - Patent sequence entries, part 23.
1911. gbpat230.seq - Patent sequence entries, part 230.
1912. gbpat231.seq - Patent sequence entries, part 231.
1913. gbpat232.seq - Patent sequence entries, part 232.
1914. gbpat233.seq - Patent sequence entries, part 233.
1915. gbpat234.seq - Patent sequence entries, part 234.
1916. gbpat235.seq - Patent sequence entries, part 235.
1917. gbpat236.seq - Patent sequence entries, part 236.
1918. gbpat237.seq - Patent sequence entries, part 237.
1919. gbpat238.seq - Patent sequence entries, part 238.
1920. gbpat239.seq - Patent sequence entries, part 239.
1921. gbpat24.seq - Patent sequence entries, part 24.
1922. gbpat240.seq - Patent sequence entries, part 240.
1923. gbpat241.seq - Patent sequence entries, part 241.
1924. gbpat242.seq - Patent sequence entries, part 242.
1925. gbpat243.seq - Patent sequence entries, part 243.
1926. gbpat244.seq - Patent sequence entries, part 244.
1927. gbpat245.seq - Patent sequence entries, part 245.
1928. gbpat246.seq - Patent sequence entries, part 246.
1929. gbpat25.seq - Patent sequence entries, part 25.
1930. gbpat26.seq - Patent sequence entries, part 26.
1931. gbpat27.seq - Patent sequence entries, part 27.
1932. gbpat28.seq - Patent sequence entries, part 28.
1933. gbpat29.seq - Patent sequence entries, part 29.
1934. gbpat3.seq - Patent sequence entries, part 3.
1935. gbpat30.seq - Patent sequence entries, part 30.
1936. gbpat31.seq - Patent sequence entries, part 31.
1937. gbpat32.seq - Patent sequence entries, part 32.
1938. gbpat33.seq - Patent sequence entries, part 33.
1939. gbpat34.seq - Patent sequence entries, part 34.
1940. gbpat35.seq - Patent sequence entries, part 35.
1941. gbpat36.seq - Patent sequence entries, part 36.
1942. gbpat37.seq - Patent sequence entries, part 37.
1943. gbpat38.seq - Patent sequence entries, part 38.
1944. gbpat39.seq - Patent sequence entries, part 39.
1945. gbpat4.seq - Patent sequence entries, part 4.
1946. gbpat40.seq - Patent sequence entries, part 40.
1947. gbpat41.seq - Patent sequence entries, part 41.
1948. gbpat42.seq - Patent sequence entries, part 42.
1949. gbpat43.seq - Patent sequence entries, part 43.
1950. gbpat44.seq - Patent sequence entries, part 44.
1951. gbpat45.seq - Patent sequence entries, part 45.
1952. gbpat46.seq - Patent sequence entries, part 46.
1953. gbpat47.seq - Patent sequence entries, part 47.
1954. gbpat48.seq - Patent sequence entries, part 48.
1955. gbpat49.seq - Patent sequence entries, part 49.
1956. gbpat5.seq - Patent sequence entries, part 5.
1957. gbpat50.seq - Patent sequence entries, part 50.
1958. gbpat51.seq - Patent sequence entries, part 51.
1959. gbpat52.seq - Patent sequence entries, part 52.
1960. gbpat53.seq - Patent sequence entries, part 53.
1961. gbpat54.seq - Patent sequence entries, part 54.
1962. gbpat55.seq - Patent sequence entries, part 55.
1963. gbpat56.seq - Patent sequence entries, part 56.
1964. gbpat57.seq - Patent sequence entries, part 57.
1965. gbpat58.seq - Patent sequence entries, part 58.
1966. gbpat59.seq - Patent sequence entries, part 59.
1967. gbpat6.seq - Patent sequence entries, part 6.
1968. gbpat60.seq - Patent sequence entries, part 60.
1969. gbpat61.seq - Patent sequence entries, part 61.
1970. gbpat62.seq - Patent sequence entries, part 62.
1971. gbpat63.seq - Patent sequence entries, part 63.
1972. gbpat64.seq - Patent sequence entries, part 64.
1973. gbpat65.seq - Patent sequence entries, part 65.
1974. gbpat66.seq - Patent sequence entries, part 66.
1975. gbpat67.seq - Patent sequence entries, part 67.
1976. gbpat68.seq - Patent sequence entries, part 68.
1977. gbpat69.seq - Patent sequence entries, part 69.
1978. gbpat7.seq - Patent sequence entries, part 7.
1979. gbpat70.seq - Patent sequence entries, part 70.
1980. gbpat71.seq - Patent sequence entries, part 71.
1981. gbpat72.seq - Patent sequence entries, part 72.
1982. gbpat73.seq - Patent sequence entries, part 73.
1983. gbpat74.seq - Patent sequence entries, part 74.
1984. gbpat75.seq - Patent sequence entries, part 75.
1985. gbpat76.seq - Patent sequence entries, part 76.
1986. gbpat77.seq - Patent sequence entries, part 77.
1987. gbpat78.seq - Patent sequence entries, part 78.
1988. gbpat79.seq - Patent sequence entries, part 79.
1989. gbpat8.seq - Patent sequence entries, part 8.
1990. gbpat80.seq - Patent sequence entries, part 80.
1991. gbpat81.seq - Patent sequence entries, part 81.
1992. gbpat82.seq - Patent sequence entries, part 82.
1993. gbpat83.seq - Patent sequence entries, part 83.
1994. gbpat84.seq - Patent sequence entries, part 84.
1995. gbpat85.seq - Patent sequence entries, part 85.
1996. gbpat86.seq - Patent sequence entries, part 86.
1997. gbpat87.seq - Patent sequence entries, part 87.
1998. gbpat88.seq - Patent sequence entries, part 88.
1999. gbpat89.seq - Patent sequence entries, part 89.
2000. gbpat9.seq - Patent sequence entries, part 9.
2001. gbpat90.seq - Patent sequence entries, part 90.
2002. gbpat91.seq - Patent sequence entries, part 91.
2003. gbpat92.seq - Patent sequence entries, part 92.
2004. gbpat93.seq - Patent sequence entries, part 93.
2005. gbpat94.seq - Patent sequence entries, part 94.
2006. gbpat95.seq - Patent sequence entries, part 95.
2007. gbpat96.seq - Patent sequence entries, part 96.
2008. gbpat97.seq - Patent sequence entries, part 97.
2009. gbpat98.seq - Patent sequence entries, part 98.
2010. gbpat99.seq - Patent sequence entries, part 99.
2011. gbphg1.seq - Phage sequence entries, part 1.
2012. gbphg2.seq - Phage sequence entries, part 2.
2013. gbphg3.seq - Phage sequence entries, part 3.
2014. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2015. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2016. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2017. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2018. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2019. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2020. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2021. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2022. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2023. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2024. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2025. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2026. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2027. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2028. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2029. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2030. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2031. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2032. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2033. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2034. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2035. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2036. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2037. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2038. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2039. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2040. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2041. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2042. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2043. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2044. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2045. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2046. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2047. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2048. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2049. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2050. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2051. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2052. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2053. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2054. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2055. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2056. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2057. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2058. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2059. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2060. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2061. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2062. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2063. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2064. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2065. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2066. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2067. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2068. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2069. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2070. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2071. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2072. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2073. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2074. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2075. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2076. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2077. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2078. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2079. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2080. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2081. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2082. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2083. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2084. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2085. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2086. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2087. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2088. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2089. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2090. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2091. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2092. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2093. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2094. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2095. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2096. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2097. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2098. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2099. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2100. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2101. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2102. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2103. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2104. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2105. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2106. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2107. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2108. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2109. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2110. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2111. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2112. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2113. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2114. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2115. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2116. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2117. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2118. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2119. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2120. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2121. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2122. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2123. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2124. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2125. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2126. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2127. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2128. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2129. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2130. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2131. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2132. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2133. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2134. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2135. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2136. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2137. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2138. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2139. gbpri1.seq - Primate sequence entries, part 1.
2140. gbpri10.seq - Primate sequence entries, part 10.
2141. gbpri11.seq - Primate sequence entries, part 11.
2142. gbpri12.seq - Primate sequence entries, part 12.
2143. gbpri13.seq - Primate sequence entries, part 13.
2144. gbpri14.seq - Primate sequence entries, part 14.
2145. gbpri15.seq - Primate sequence entries, part 15.
2146. gbpri16.seq - Primate sequence entries, part 16.
2147. gbpri17.seq - Primate sequence entries, part 17.
2148. gbpri18.seq - Primate sequence entries, part 18.
2149. gbpri19.seq - Primate sequence entries, part 19.
2150. gbpri2.seq - Primate sequence entries, part 2.
2151. gbpri20.seq - Primate sequence entries, part 20.
2152. gbpri21.seq - Primate sequence entries, part 21.
2153. gbpri22.seq - Primate sequence entries, part 22.
2154. gbpri23.seq - Primate sequence entries, part 23.
2155. gbpri24.seq - Primate sequence entries, part 24.
2156. gbpri25.seq - Primate sequence entries, part 25.
2157. gbpri26.seq - Primate sequence entries, part 26.
2158. gbpri27.seq - Primate sequence entries, part 27.
2159. gbpri28.seq - Primate sequence entries, part 28.
2160. gbpri29.seq - Primate sequence entries, part 29.
2161. gbpri3.seq - Primate sequence entries, part 3.
2162. gbpri30.seq - Primate sequence entries, part 30.
2163. gbpri31.seq - Primate sequence entries, part 31.
2164. gbpri32.seq - Primate sequence entries, part 32.
2165. gbpri33.seq - Primate sequence entries, part 33.
2166. gbpri34.seq - Primate sequence entries, part 34.
2167. gbpri35.seq - Primate sequence entries, part 35.
2168. gbpri36.seq - Primate sequence entries, part 36.
2169. gbpri37.seq - Primate sequence entries, part 37.
2170. gbpri38.seq - Primate sequence entries, part 38.
2171. gbpri39.seq - Primate sequence entries, part 39.
2172. gbpri4.seq - Primate sequence entries, part 4.
2173. gbpri40.seq - Primate sequence entries, part 40.
2174. gbpri41.seq - Primate sequence entries, part 41.
2175. gbpri42.seq - Primate sequence entries, part 42.
2176. gbpri43.seq - Primate sequence entries, part 43.
2177. gbpri44.seq - Primate sequence entries, part 44.
2178. gbpri45.seq - Primate sequence entries, part 45.
2179. gbpri46.seq - Primate sequence entries, part 46.
2180. gbpri47.seq - Primate sequence entries, part 47.
2181. gbpri48.seq - Primate sequence entries, part 48.
2182. gbpri49.seq - Primate sequence entries, part 49.
2183. gbpri5.seq - Primate sequence entries, part 5.
2184. gbpri50.seq - Primate sequence entries, part 50.
2185. gbpri51.seq - Primate sequence entries, part 51.
2186. gbpri52.seq - Primate sequence entries, part 52.
2187. gbpri53.seq - Primate sequence entries, part 53.
2188. gbpri54.seq - Primate sequence entries, part 54.
2189. gbpri6.seq - Primate sequence entries, part 6.
2190. gbpri7.seq - Primate sequence entries, part 7.
2191. gbpri8.seq - Primate sequence entries, part 8.
2192. gbpri9.seq - Primate sequence entries, part 9.
2193. gbrel.txt - Release notes (this document).
2194. gbrod1.seq - Rodent sequence entries, part 1.
2195. gbrod10.seq - Rodent sequence entries, part 10.
2196. gbrod11.seq - Rodent sequence entries, part 11.
2197. gbrod12.seq - Rodent sequence entries, part 12.
2198. gbrod13.seq - Rodent sequence entries, part 13.
2199. gbrod14.seq - Rodent sequence entries, part 14.
2200. gbrod15.seq - Rodent sequence entries, part 15.
2201. gbrod16.seq - Rodent sequence entries, part 16.
2202. gbrod17.seq - Rodent sequence entries, part 17.
2203. gbrod18.seq - Rodent sequence entries, part 18.
2204. gbrod19.seq - Rodent sequence entries, part 19.
2205. gbrod2.seq - Rodent sequence entries, part 2.
2206. gbrod20.seq - Rodent sequence entries, part 20.
2207. gbrod21.seq - Rodent sequence entries, part 21.
2208. gbrod22.seq - Rodent sequence entries, part 22.
2209. gbrod23.seq - Rodent sequence entries, part 23.
2210. gbrod24.seq - Rodent sequence entries, part 24.
2211. gbrod25.seq - Rodent sequence entries, part 25.
2212. gbrod26.seq - Rodent sequence entries, part 26.
2213. gbrod27.seq - Rodent sequence entries, part 27.
2214. gbrod28.seq - Rodent sequence entries, part 28.
2215. gbrod29.seq - Rodent sequence entries, part 29.
2216. gbrod3.seq - Rodent sequence entries, part 3.
2217. gbrod30.seq - Rodent sequence entries, part 30.
2218. gbrod31.seq - Rodent sequence entries, part 31.
2219. gbrod4.seq - Rodent sequence entries, part 4.
2220. gbrod5.seq - Rodent sequence entries, part 5.
2221. gbrod6.seq - Rodent sequence entries, part 6.
2222. gbrod7.seq - Rodent sequence entries, part 7.
2223. gbrod8.seq - Rodent sequence entries, part 8.
2224. gbrod9.seq - Rodent sequence entries, part 9.
2225. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2226. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2227. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2228. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2229. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2230. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2231. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2232. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2233. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2234. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2235. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2236. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2237. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2238. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2239. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2240. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2241. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2242. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2243. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2244. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2245. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2246. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2247. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2248. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2249. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2250. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2251. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2252. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2253. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2254. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2255. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2256. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2257. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2258. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2259. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2260. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2261. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2262. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2263. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2264. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2265. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2266. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2267. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2268. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2269. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2270. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2271. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2272. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2273. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2274. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2275. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2276. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2277. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2278. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2279. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2280. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2281. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2282. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2283. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2284. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2285. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2286. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2287. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2288. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2289. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2290. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2291. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2292. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2293. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2294. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2295. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2296. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2297. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2298. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2299. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2300. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2301. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2302. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2303. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2304. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2305. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2306. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2307. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2308. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2309. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2310. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2311. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2312. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2313. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2314. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2315. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2316. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2317. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2318. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2319. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2320. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2321. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2322. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2323. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2324. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2325. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2326. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2327. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2328. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2329. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2330. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2331. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2332. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2333. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2334. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2335. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2336. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2337. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2338. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2339. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2340. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2341. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2342. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2343. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2344. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2345. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2346. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2347. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2348. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2349. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2350. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2351. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2352. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2353. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2354. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2355. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2356. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2357. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2358. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2359. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2360. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2361. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2362. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2363. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2364. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2365. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2366. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2367. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2368. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2369. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2370. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2371. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2372. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2373. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2374. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2375. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2376. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2377. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2378. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2379. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2380. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2381. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2382. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2383. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2384. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2385. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2386. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2387. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2388. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2389. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2390. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2391. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2392. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2393. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2394. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2395. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2396. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2397. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2398. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2399. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2400. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2401. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2402. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2403. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2404. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2405. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2406. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2407. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2408. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2409. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2410. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2411. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2412. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2413. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2414. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2415. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2416. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2417. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2418. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2419. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2420. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2421. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2422. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2423. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2424. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2425. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2426. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2427. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2428. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2429. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2430. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2431. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2432. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2433. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2434. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2435. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2436. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2437. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2438. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2439. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2440. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2441. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2442. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2443. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2444. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2445. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2446. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2447. gbuna1.seq - Unannotated sequence entries, part 1.
2448. gbvrl1.seq - Viral sequence entries, part 1.
2449. gbvrl10.seq - Viral sequence entries, part 10.
2450. gbvrl11.seq - Viral sequence entries, part 11.
2451. gbvrl12.seq - Viral sequence entries, part 12.
2452. gbvrl13.seq - Viral sequence entries, part 13.
2453. gbvrl14.seq - Viral sequence entries, part 14.
2454. gbvrl15.seq - Viral sequence entries, part 15.
2455. gbvrl16.seq - Viral sequence entries, part 16.
2456. gbvrl17.seq - Viral sequence entries, part 17.
2457. gbvrl18.seq - Viral sequence entries, part 18.
2458. gbvrl19.seq - Viral sequence entries, part 19.
2459. gbvrl2.seq - Viral sequence entries, part 2.
2460. gbvrl20.seq - Viral sequence entries, part 20.
2461. gbvrl21.seq - Viral sequence entries, part 21.
2462. gbvrl22.seq - Viral sequence entries, part 22.
2463. gbvrl23.seq - Viral sequence entries, part 23.
2464. gbvrl24.seq - Viral sequence entries, part 24.
2465. gbvrl25.seq - Viral sequence entries, part 25.
2466. gbvrl26.seq - Viral sequence entries, part 26.
2467. gbvrl27.seq - Viral sequence entries, part 27.
2468. gbvrl28.seq - Viral sequence entries, part 28.
2469. gbvrl29.seq - Viral sequence entries, part 29.
2470. gbvrl3.seq - Viral sequence entries, part 3.
2471. gbvrl30.seq - Viral sequence entries, part 30.
2472. gbvrl31.seq - Viral sequence entries, part 31.
2473. gbvrl32.seq - Viral sequence entries, part 32.
2474. gbvrl33.seq - Viral sequence entries, part 33.
2475. gbvrl34.seq - Viral sequence entries, part 34.
2476. gbvrl35.seq - Viral sequence entries, part 35.
2477. gbvrl36.seq - Viral sequence entries, part 36.
2478. gbvrl37.seq - Viral sequence entries, part 37.
2479. gbvrl38.seq - Viral sequence entries, part 38.
2480. gbvrl39.seq - Viral sequence entries, part 39.
2481. gbvrl4.seq - Viral sequence entries, part 4.
2482. gbvrl40.seq - Viral sequence entries, part 40.
2483. gbvrl5.seq - Viral sequence entries, part 5.
2484. gbvrl6.seq - Viral sequence entries, part 6.
2485. gbvrl7.seq - Viral sequence entries, part 7.
2486. gbvrl8.seq - Viral sequence entries, part 8.
2487. gbvrl9.seq - Viral sequence entries, part 9.
2488. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2489. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2490. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2491. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2492. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2493. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2494. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2495. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2496. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2497. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2498. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2499. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2500. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2501. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2502. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2503. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2504. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2505. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2506. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2507. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2508. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2509. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2510. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2511. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2512. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2513. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2514. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2515. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2516. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2517. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2518. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2519. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2520. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2521. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2522. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2523. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2524. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2525. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2526. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2527. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2528. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2529. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2530. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2531. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2532. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2533. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2534. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2535. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2536. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2537. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2538. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2539. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2540. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2541. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2542. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2543. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2544. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2545. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2546. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2547. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2548. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 212.0 flatfiles require roughly 756 GB (sequence
files only) or 756 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249999227     gbbct1.seq
 239181940     gbbct10.seq
 242709943     gbbct100.seq
  60338329     gbbct101.seq
 249320864     gbbct102.seq
 241008006     gbbct103.seq
 238916098     gbbct104.seq
 245593426     gbbct105.seq
 240293922     gbbct106.seq
 248575957     gbbct107.seq
 242501058     gbbct108.seq
 248904841     gbbct109.seq
 247930745     gbbct11.seq
 248590589     gbbct110.seq
 242646239     gbbct111.seq
 208159980     gbbct112.seq
 239878777     gbbct113.seq
 246570707     gbbct114.seq
 247975521     gbbct115.seq
 247276576     gbbct116.seq
 248296165     gbbct117.seq
 247225747     gbbct118.seq
 246147177     gbbct119.seq
 248751972     gbbct12.seq
 245709561     gbbct120.seq
 203945168     gbbct121.seq
 247757172     gbbct122.seq
 240369157     gbbct123.seq
 247504144     gbbct124.seq
 245258572     gbbct125.seq
 245521739     gbbct126.seq
 239375194     gbbct127.seq
 241732140     gbbct128.seq
 249781498     gbbct129.seq
 246719452     gbbct13.seq
 247780239     gbbct130.seq
 245622298     gbbct131.seq
 244344262     gbbct132.seq
 243259795     gbbct133.seq
 160983030     gbbct134.seq
 245174530     gbbct135.seq
 242083908     gbbct136.seq
 237846761     gbbct137.seq
 248077825     gbbct138.seq
 246440265     gbbct139.seq
 233391424     gbbct14.seq
 248736771     gbbct140.seq
 243945604     gbbct141.seq
 245941354     gbbct142.seq
 245484738     gbbct143.seq
 248592780     gbbct144.seq
 245185619     gbbct145.seq
 247285253     gbbct146.seq
 242066895     gbbct147.seq
 246341311     gbbct148.seq
 239438288     gbbct149.seq
 249871895     gbbct15.seq
 249513967     gbbct150.seq
 245718739     gbbct151.seq
 246853627     gbbct152.seq
 249756760     gbbct153.seq
 235444944     gbbct154.seq
 225905098     gbbct155.seq
 243577494     gbbct156.seq
 238252174     gbbct157.seq
 245976127     gbbct158.seq
 246060380     gbbct159.seq
 248033385     gbbct16.seq
 249763599     gbbct160.seq
 244872713     gbbct161.seq
 245548032     gbbct162.seq
 249426970     gbbct163.seq
 134146001     gbbct164.seq
 246305877     gbbct165.seq
 248265555     gbbct166.seq
 245790280     gbbct167.seq
 247451362     gbbct168.seq
 241513091     gbbct169.seq
 231029867     gbbct17.seq
 245963013     gbbct170.seq
 246655374     gbbct171.seq
  53291300     gbbct172.seq
 249314601     gbbct173.seq
 246516627     gbbct174.seq
 247170531     gbbct175.seq
 247611204     gbbct176.seq
 241507913     gbbct177.seq
 246062270     gbbct178.seq
 249647702     gbbct179.seq
 248359384     gbbct18.seq
  79648433     gbbct180.seq
 237090061     gbbct181.seq
  73334217     gbbct182.seq
   6910989     gbbct183.seq
  14292564     gbbct184.seq
  23069750     gbbct185.seq
  45120557     gbbct186.seq
  87866203     gbbct187.seq
 170543727     gbbct188.seq
 249998234     gbbct189.seq
 187280568     gbbct19.seq
 249996283     gbbct190.seq
 248174930     gbbct191.seq
 246537240     gbbct192.seq
 240232837     gbbct193.seq
 246347700     gbbct194.seq
 245955256     gbbct195.seq
 246736584     gbbct196.seq
 244127827     gbbct197.seq
 249997106     gbbct198.seq
  62359397     gbbct199.seq
 241970696     gbbct2.seq
 243180957     gbbct20.seq
 244617371     gbbct200.seq
 244118869     gbbct201.seq
 248170113     gbbct202.seq
 247041833     gbbct203.seq
 246339355     gbbct204.seq
 249997827     gbbct205.seq
 249998227     gbbct206.seq
 247557392     gbbct207.seq
 249999274     gbbct208.seq
 249998744     gbbct209.seq
 249659789     gbbct21.seq
 249998723     gbbct210.seq
  44479986     gbbct211.seq
 249998597     gbbct212.seq
 249998344     gbbct213.seq
 249832722     gbbct214.seq
 247053741     gbbct215.seq
 249922081     gbbct216.seq
 249655416     gbbct217.seq
 249983140     gbbct218.seq
 237759550     gbbct219.seq
 247391711     gbbct22.seq
 234560061     gbbct220.seq
 238780125     gbbct221.seq
 249997136     gbbct222.seq
  80117717     gbbct223.seq
 134960897     gbbct224.seq
 249354243     gbbct23.seq
 248384841     gbbct24.seq
 245177157     gbbct25.seq
 242877047     gbbct26.seq
 239673957     gbbct27.seq
 217808722     gbbct28.seq
 242805033     gbbct29.seq
 246558062     gbbct3.seq
 245839033     gbbct30.seq
 248681312     gbbct31.seq
 247878465     gbbct32.seq
 249069285     gbbct33.seq
 244434767     gbbct34.seq
 247334054     gbbct35.seq
 249972588     gbbct36.seq
 249765466     gbbct37.seq
 240923088     gbbct38.seq
 244794918     gbbct39.seq
 249854943     gbbct4.seq
 249643784     gbbct40.seq
 165336500     gbbct41.seq
 247445592     gbbct42.seq
 246940367     gbbct43.seq
 248190786     gbbct44.seq
 246578692     gbbct45.seq
 241883498     gbbct46.seq
 246672065     gbbct47.seq
 249202579     gbbct48.seq
 246112039     gbbct49.seq
 249998702     gbbct5.seq
 239781955     gbbct50.seq
 248869867     gbbct51.seq
 248937342     gbbct52.seq
 245188960     gbbct53.seq
  49416023     gbbct54.seq
 244556609     gbbct55.seq
 245263155     gbbct56.seq
 239711933     gbbct57.seq
 247755476     gbbct58.seq
 239866960     gbbct59.seq
  60070273     gbbct6.seq
 247439976     gbbct60.seq
 249952726     gbbct61.seq
 247308502     gbbct62.seq
 238422885     gbbct63.seq
 244739876     gbbct64.seq
 247474935     gbbct65.seq
 238999366     gbbct66.seq
 246692737     gbbct67.seq
 100528900     gbbct68.seq
 248766157     gbbct69.seq
 249583317     gbbct7.seq
 248624065     gbbct70.seq
 249954025     gbbct71.seq
 246771287     gbbct72.seq
 240224090     gbbct73.seq
 249692759     gbbct74.seq
 249423126     gbbct75.seq
 244707475     gbbct76.seq
 245854948     gbbct77.seq
 245591751     gbbct78.seq
 249680254     gbbct79.seq
 249887279     gbbct8.seq
 244841926     gbbct80.seq
 249484489     gbbct81.seq
  61286465     gbbct82.seq
 241500703     gbbct83.seq
 249981140     gbbct84.seq
 246448112     gbbct85.seq
 249666060     gbbct86.seq
 248500137     gbbct87.seq
 237204733     gbbct88.seq
 243027614     gbbct89.seq
 244994118     gbbct9.seq
 248532392     gbbct90.seq
 246015112     gbbct91.seq
 238162549     gbbct92.seq
 249007201     gbbct93.seq
 245856840     gbbct94.seq
 247742316     gbbct95.seq
 247940090     gbbct96.seq
 249518280     gbbct97.seq
 240753354     gbbct98.seq
 242954182     gbbct99.seq
   5951774     gbchg.txt
 249075840     gbcon1.seq
 249996041     gbcon10.seq
 249996185     gbcon100.seq
 249995145     gbcon101.seq
 249998953     gbcon102.seq
  32427016     gbcon103.seq
 249994975     gbcon104.seq
 249999581     gbcon105.seq
 249997722     gbcon106.seq
 249997541     gbcon107.seq
 208220377     gbcon108.seq
 249992153     gbcon109.seq
 249495675     gbcon11.seq
 249998787     gbcon110.seq
 249995953     gbcon111.seq
 249999393     gbcon112.seq
 250000027     gbcon113.seq
 143584215     gbcon114.seq
 249995301     gbcon115.seq
 249999496     gbcon116.seq
 249998124     gbcon117.seq
 249999708     gbcon118.seq
 249996885     gbcon119.seq
 249964555     gbcon12.seq
 166460579     gbcon120.seq
 249995504     gbcon121.seq
 249997107     gbcon122.seq
 249999227     gbcon123.seq
 242947298     gbcon124.seq
 174526309     gbcon125.seq
 249996492     gbcon126.seq
 249999710     gbcon127.seq
  49729084     gbcon128.seq
 249999943     gbcon129.seq
 247611667     gbcon13.seq
 249975767     gbcon130.seq
 208854824     gbcon131.seq
 200839757     gbcon132.seq
 249999480     gbcon133.seq
 249799408     gbcon134.seq
 249912471     gbcon135.seq
 249996286     gbcon136.seq
 249997211     gbcon137.seq
 248386908     gbcon138.seq
 249997581     gbcon139.seq
 249208651     gbcon14.seq
 249492030     gbcon140.seq
 246625249     gbcon141.seq
 244014257     gbcon142.seq
 249999386     gbcon143.seq
 249915891     gbcon144.seq
 249994308     gbcon145.seq
  93611697     gbcon146.seq
 249999281     gbcon147.seq
 249963912     gbcon148.seq
 249042821     gbcon149.seq
 245299171     gbcon15.seq
 250000037     gbcon150.seq
 249996807     gbcon151.seq
 249959666     gbcon152.seq
 249297879     gbcon153.seq
 249998527     gbcon154.seq
 119075055     gbcon155.seq
 249999343     gbcon156.seq
 249999238     gbcon157.seq
 249999766     gbcon158.seq
 249999825     gbcon159.seq
 248997966     gbcon16.seq
 183761987     gbcon160.seq
 249999179     gbcon161.seq
 249999369     gbcon162.seq
 250000259     gbcon163.seq
 249994993     gbcon164.seq
 249998127     gbcon165.seq
 249933263     gbcon166.seq
 249998986     gbcon167.seq
 249991663     gbcon168.seq
  94149502     gbcon169.seq
 249669286     gbcon17.seq
 249999124     gbcon170.seq
 249997295     gbcon171.seq
 249999222     gbcon172.seq
 249998010     gbcon173.seq
 201769902     gbcon174.seq
 249997190     gbcon175.seq
 249719798     gbcon176.seq
 249993447     gbcon177.seq
 249879242     gbcon178.seq
 249966040     gbcon179.seq
 249889602     gbcon18.seq
 249995623     gbcon180.seq
 249977491     gbcon181.seq
 249991704     gbcon182.seq
 249999543     gbcon183.seq
 226753070     gbcon184.seq
 249999971     gbcon185.seq
 249992304     gbcon186.seq
 249998480     gbcon187.seq
 249998387     gbcon188.seq
 249999288     gbcon189.seq
 249999359     gbcon19.seq
 249998309     gbcon190.seq
  71955869     gbcon191.seq
 249999394     gbcon192.seq
 249998502     gbcon193.seq
 249277893     gbcon194.seq
 249999689     gbcon195.seq
 244155732     gbcon196.seq
 249999877     gbcon197.seq
 249999556     gbcon198.seq
 249998718     gbcon199.seq
 249754832     gbcon2.seq
 110789619     gbcon20.seq
 249999387     gbcon200.seq
 249998382     gbcon201.seq
 249997774     gbcon202.seq
 249992064     gbcon203.seq
 249999286     gbcon204.seq
 117805304     gbcon205.seq
 249999259     gbcon206.seq
 249999298     gbcon207.seq
 249996283     gbcon208.seq
 249998745     gbcon209.seq
 249993022     gbcon21.seq
 205607173     gbcon210.seq
 249996001     gbcon211.seq
 249998524     gbcon212.seq
 249999955     gbcon213.seq
 249998250     gbcon214.seq
 163866121     gbcon215.seq
 249999418     gbcon216.seq
 249998892     gbcon217.seq
 250000159     gbcon218.seq
 249259516     gbcon219.seq
 249999866     gbcon22.seq
 249999343     gbcon220.seq
 248657308     gbcon221.seq
 249999302     gbcon222.seq
 249999789     gbcon223.seq
 250000107     gbcon224.seq
 249998812     gbcon225.seq
 249997899     gbcon226.seq
 249997780     gbcon227.seq
 190751028     gbcon228.seq
 249998617     gbcon229.seq
 249990234     gbcon23.seq
 249992409     gbcon230.seq
 249996646     gbcon231.seq
 249999995     gbcon232.seq
 221814990     gbcon233.seq
 249998954     gbcon234.seq
 249976049     gbcon235.seq
 249998913     gbcon236.seq
 249997911     gbcon237.seq
 188892453     gbcon238.seq
 249999979     gbcon239.seq
 249998301     gbcon24.seq
 249998872     gbcon240.seq
 249967077     gbcon241.seq
 249999035     gbcon242.seq
 249998236     gbcon243.seq
 212808333     gbcon244.seq
 249994742     gbcon245.seq
 249445565     gbcon246.seq
 249998250     gbcon247.seq
 247565288     gbcon248.seq
 249842866     gbcon249.seq
 249998298     gbcon25.seq
 244552878     gbcon250.seq
 249997505     gbcon251.seq
 244669359     gbcon252.seq
 249997798     gbcon253.seq
 249999152     gbcon254.seq
 249949308     gbcon255.seq
 249998934     gbcon256.seq
 249995592     gbcon257.seq
 126794597     gbcon258.seq
 249998566     gbcon259.seq
 249997656     gbcon26.seq
 249964693     gbcon260.seq
 249940775     gbcon261.seq
 249998121     gbcon262.seq
 249977472     gbcon263.seq
 249998372     gbcon264.seq
 183103550     gbcon265.seq
 249999962     gbcon266.seq
 249996982     gbcon267.seq
 249987851     gbcon268.seq
 249998390     gbcon269.seq
 216499337     gbcon27.seq
 249998892     gbcon270.seq
 249999650     gbcon271.seq
 249999917     gbcon272.seq
  25046915     gbcon273.seq
 249994058     gbcon274.seq
 249975679     gbcon275.seq
 250000185     gbcon276.seq
 249915324     gbcon277.seq
 249998761     gbcon278.seq
 118221903     gbcon279.seq
 249998086     gbcon28.seq
 249999438     gbcon280.seq
 249997913     gbcon281.seq
 249998728     gbcon282.seq
 249832247     gbcon283.seq
 249995165     gbcon284.seq
 130300787     gbcon285.seq
 249998566     gbcon286.seq
 249999167     gbcon287.seq
 249999107     gbcon288.seq
 249991615     gbcon289.seq
 249999757     gbcon29.seq
 249998192     gbcon290.seq
 184516831     gbcon291.seq
 249994716     gbcon292.seq
 249994930     gbcon293.seq
 249988364     gbcon294.seq
 249959053     gbcon295.seq
 249994831     gbcon296.seq
 249999608     gbcon297.seq
 138731058     gbcon298.seq
 249407746     gbcon299.seq
 249659590     gbcon3.seq
 249996633     gbcon30.seq
 249984475     gbcon300.seq
 248866642     gbcon301.seq
 249997544     gbcon302.seq
 249991035     gbcon303.seq
 249993812     gbcon304.seq
 249982585     gbcon305.seq
 249995315     gbcon306.seq
 143498110     gbcon307.seq
 249686189     gbcon308.seq
 249999147     gbcon309.seq
 249977268     gbcon31.seq
 249965617     gbcon310.seq
 249995190     gbcon311.seq
 249997063     gbcon312.seq
 249999722     gbcon313.seq
 249997207     gbcon314.seq
 249998107     gbcon315.seq
 180092429     gbcon316.seq
 250000009     gbcon317.seq
 249999657     gbcon318.seq
 249999310     gbcon319.seq
 249992741     gbcon32.seq
 249998447     gbcon320.seq
  45716074     gbcon321.seq
 250000113     gbcon322.seq
 249997605     gbcon323.seq
 249928812     gbcon324.seq
 249980928     gbcon325.seq
 249996796     gbcon326.seq
 249999414     gbcon327.seq
 115243437     gbcon328.seq
  18866261     gbcon329.seq
 249996261     gbcon33.seq
  24512590     gbcon330.seq
 137326195     gbcon34.seq
 249996506     gbcon35.seq
 248806791     gbcon36.seq
 133502568     gbcon37.seq
 129846276     gbcon38.seq
 249996964     gbcon39.seq
 249666161     gbcon4.seq
 249996854     gbcon40.seq
 249999218     gbcon41.seq
 249997951     gbcon42.seq
 129038064     gbcon43.seq
 249998410     gbcon44.seq
 249999995     gbcon45.seq
 249998691     gbcon46.seq
 249999465     gbcon47.seq
 249962738     gbcon48.seq
 215807124     gbcon49.seq
 249998590     gbcon5.seq
 249995573     gbcon50.seq
 249996408     gbcon51.seq
 249994120     gbcon52.seq
 249994952     gbcon53.seq
 249998384     gbcon54.seq
 249996413     gbcon55.seq
  73437195     gbcon56.seq
 249998712     gbcon57.seq
 249998158     gbcon58.seq
 249996631     gbcon59.seq
 249881717     gbcon6.seq
 249998184     gbcon60.seq
 249997010     gbcon61.seq
  53203903     gbcon62.seq
 249995129     gbcon63.seq
 249997080     gbcon64.seq
 249999244     gbcon65.seq
 249997768     gbcon66.seq
 249999302     gbcon67.seq
  46505761     gbcon68.seq
 249997479     gbcon69.seq
 199375159     gbcon7.seq
 250000123     gbcon70.seq
 249999337     gbcon71.seq
 249997135     gbcon72.seq
 249996958     gbcon73.seq
 163671197     gbcon74.seq
 249996154     gbcon75.seq
 250000031     gbcon76.seq
 249995010     gbcon77.seq
 249997630     gbcon78.seq
 194598585     gbcon79.seq
 249993350     gbcon8.seq
 249997650     gbcon80.seq
 249997746     gbcon81.seq
 249995972     gbcon82.seq
 249996499     gbcon83.seq
 249998163     gbcon84.seq
   7197220     gbcon85.seq
 249996246     gbcon86.seq
 249997498     gbcon87.seq
 249996448     gbcon88.seq
 249998072     gbcon89.seq
 246642676     gbcon9.seq
 249997897     gbcon90.seq
 108419384     gbcon91.seq
 249999177     gbcon92.seq
 250000223     gbcon93.seq
 249994923     gbcon94.seq
 249998335     gbcon95.seq
 249999420     gbcon96.seq
  73407611     gbcon97.seq
 249998420     gbcon98.seq
 249998945     gbcon99.seq
    139272     gbdel.txt
 249999407     gbenv1.seq
 249998376     gbenv10.seq
 249998452     gbenv11.seq
 249998988     gbenv12.seq
  61045533     gbenv13.seq
 249998460     gbenv14.seq
 249998568     gbenv15.seq
 249998490     gbenv16.seq
 249997507     gbenv17.seq
 250000078     gbenv18.seq
 250000179     gbenv19.seq
 249999756     gbenv2.seq
 249999061     gbenv20.seq
 249998308     gbenv21.seq
   8269166     gbenv22.seq
 249999039     gbenv23.seq
 249999425     gbenv24.seq
 249998713     gbenv25.seq
 249999999     gbenv26.seq
 182001591     gbenv27.seq
 250000186     gbenv28.seq
 249932188     gbenv29.seq
 249998183     gbenv3.seq
 250000042     gbenv30.seq
 249999599     gbenv31.seq
 249998757     gbenv32.seq
 249999826     gbenv33.seq
  63910512     gbenv34.seq
 249999624     gbenv35.seq
 249998745     gbenv36.seq
 249998300     gbenv37.seq
 249997700     gbenv38.seq
 189151384     gbenv39.seq
 249998833     gbenv4.seq
 249998402     gbenv40.seq
 249998773     gbenv41.seq
 249999910     gbenv42.seq
 249996961     gbenv43.seq
 249998415     gbenv44.seq
 249997305     gbenv45.seq
  54563290     gbenv46.seq
 250000145     gbenv47.seq
 249999082     gbenv48.seq
 249998462     gbenv49.seq
 249996946     gbenv5.seq
 249998468     gbenv50.seq
 199425639     gbenv51.seq
 249999860     gbenv52.seq
 249999381     gbenv53.seq
 249999079     gbenv54.seq
 249998048     gbenv55.seq
 249998492     gbenv56.seq
  89381326     gbenv57.seq
 249998928     gbenv58.seq
 249999808     gbenv59.seq
 249999374     gbenv6.seq
 249999443     gbenv60.seq
 249998810     gbenv61.seq
 249998348     gbenv62.seq
 221655825     gbenv63.seq
 250000199     gbenv64.seq
 249998092     gbenv65.seq
 249999651     gbenv66.seq
 249999866     gbenv67.seq
 249998016     gbenv68.seq
  93324355     gbenv69.seq
 249999368     gbenv7.seq
 249999752     gbenv70.seq
 249999116     gbenv71.seq
 249997725     gbenv72.seq
 250000227     gbenv73.seq
 249999348     gbenv74.seq
 151307582     gbenv75.seq
 249998450     gbenv76.seq
 249998495     gbenv77.seq
 249998227     gbenv78.seq
 249999556     gbenv79.seq
 103443545     gbenv8.seq
 249997830     gbenv80.seq
  81793491     gbenv81.seq
 249999313     gbenv82.seq
 249998307     gbenv83.seq
 249998290     gbenv84.seq
 249997467     gbenv85.seq
 249999331     gbenv86.seq
 249998187     gbenv87.seq
 249613928     gbenv88.seq
    462006     gbenv89.seq
 249999812     gbenv9.seq
 524291458     gbest1.seq
 524291436     gbest10.seq
 524289081     gbest100.seq
 524291315     gbest101.seq
 524289364     gbest102.seq
 524290598     gbest103.seq
 351987771     gbest104.seq
 524291441     gbest105.seq
 524290817     gbest106.seq
 524289728     gbest107.seq
 382655422     gbest108.seq
 386099419     gbest109.seq
 524290188     gbest11.seq
 379997094     gbest110.seq
 380732844     gbest111.seq
 377637454     gbest112.seq
 381814445     gbest113.seq
 386019645     gbest114.seq
 385194800     gbest115.seq
 384028559     gbest116.seq
 380337472     gbest117.seq
 403509258     gbest118.seq
 482056114     gbest119.seq
 524289580     gbest12.seq
 524290513     gbest120.seq
 524291506     gbest121.seq
 524290773     gbest122.seq
 524289033     gbest123.seq
 474005648     gbest124.seq
 524289420     gbest125.seq
 524291895     gbest126.seq
 524290576     gbest127.seq
 524288845     gbest128.seq
 524291373     gbest129.seq
 146374489     gbest13.seq
 524290926     gbest130.seq
 524289998     gbest131.seq
 524290792     gbest132.seq
 524289233     gbest133.seq
 524292466     gbest134.seq
 524289241     gbest135.seq
 524289989     gbest136.seq
 289926788     gbest137.seq
 524290963     gbest138.seq
 524292163     gbest139.seq
 524290288     gbest14.seq
 524292443     gbest140.seq
 524290825     gbest141.seq
 524293168     gbest142.seq
 524289322     gbest143.seq
 524290886     gbest144.seq
 524289542     gbest145.seq
 524292115     gbest146.seq
 524290606     gbest147.seq
 524292252     gbest148.seq
 524288859     gbest149.seq
 524290072     gbest15.seq
 524290133     gbest150.seq
 472140916     gbest151.seq
 524289152     gbest152.seq
 524289615     gbest153.seq
 524292070     gbest154.seq
 524290439     gbest155.seq
 524289709     gbest156.seq
 524290083     gbest157.seq
 524290317     gbest158.seq
 524291637     gbest159.seq
 524290307     gbest16.seq
 524288753     gbest160.seq
 524288926     gbest161.seq
 524291341     gbest162.seq
 524288897     gbest163.seq
 239266329     gbest164.seq
 524290748     gbest165.seq
 524290570     gbest166.seq
 524290741     gbest167.seq
 524289535     gbest168.seq
 524290327     gbest169.seq
 524289063     gbest17.seq
 524291643     gbest170.seq
 524291786     gbest171.seq
 524290137     gbest172.seq
 524290309     gbest173.seq
 524290602     gbest174.seq
 524289573     gbest175.seq
 524291557     gbest176.seq
 524289934     gbest177.seq
  92389873     gbest178.seq
 524288887     gbest179.seq
 524289462     gbest18.seq
 524290228     gbest180.seq
 524290198     gbest181.seq
 524290734     gbest182.seq
 524289961     gbest183.seq
 524288889     gbest184.seq
 524290389     gbest185.seq
 524289807     gbest186.seq
 524290942     gbest187.seq
 524288918     gbest188.seq
 524290222     gbest189.seq
 524289384     gbest19.seq
 524289760     gbest190.seq
 458862113     gbest191.seq
 524292666     gbest192.seq
 524289282     gbest193.seq
 524292147     gbest194.seq
 524288767     gbest195.seq
 524289700     gbest196.seq
 524291719     gbest197.seq
 524289120     gbest198.seq
 524289132     gbest199.seq
 524289133     gbest2.seq
 524290031     gbest20.seq
 524289664     gbest200.seq
 524291831     gbest201.seq
 524291238     gbest202.seq
 524291634     gbest203.seq
 524288832     gbest204.seq
  40863705     gbest205.seq
 524289967     gbest206.seq
 524290340     gbest207.seq
 524289842     gbest208.seq
 524290955     gbest209.seq
 524289678     gbest21.seq
 524288769     gbest210.seq
 524290151     gbest211.seq
 524292221     gbest212.seq
 524293122     gbest213.seq
 524289780     gbest214.seq
 524290227     gbest215.seq
 472767011     gbest216.seq
 524289582     gbest217.seq
 524290596     gbest218.seq
 524289367     gbest219.seq
 492361606     gbest22.seq
 524289041     gbest220.seq
 524289434     gbest221.seq
 524295622     gbest222.seq
 524288902     gbest223.seq
 524291582     gbest224.seq
 524291790     gbest225.seq
 524293110     gbest226.seq
 524291390     gbest227.seq
 524292546     gbest228.seq
 462989882     gbest229.seq
 491392605     gbest23.seq
 524290004     gbest230.seq
 524292405     gbest231.seq
 524292048     gbest232.seq
 524289254     gbest233.seq
 524291324     gbest234.seq
 524292484     gbest235.seq
 524290208     gbest236.seq
 524288793     gbest237.seq
 524289574     gbest238.seq
 524291005     gbest239.seq
 502305900     gbest24.seq
 524292606     gbest240.seq
 524289185     gbest241.seq
 524292639     gbest242.seq
 524290994     gbest243.seq
 248964561     gbest244.seq
 524290220     gbest245.seq
 524290239     gbest246.seq
 524289711     gbest247.seq
 524290321     gbest248.seq
 524290965     gbest249.seq
 326362622     gbest25.seq
 524289439     gbest250.seq
 524289368     gbest251.seq
 520609030     gbest252.seq
 524289630     gbest253.seq
 524290177     gbest254.seq
 524289156     gbest255.seq
 333403943     gbest256.seq
 524289228     gbest257.seq
 524289935     gbest258.seq
 524289051     gbest259.seq
 524290540     gbest26.seq
 524290451     gbest260.seq
 524289483     gbest261.seq
 524290470     gbest262.seq
 524288938     gbest263.seq
 524290733     gbest264.seq
 524289513     gbest265.seq
 524291527     gbest266.seq
 218386638     gbest267.seq
 524290889     gbest268.seq
 524291638     gbest269.seq
 524289076     gbest27.seq
 524291251     gbest270.seq
 524288849     gbest271.seq
 524289071     gbest272.seq
 524291244     gbest273.seq
 524289495     gbest274.seq
 524290700     gbest275.seq
 524289374     gbest276.seq
 524290351     gbest277.seq
 524289175     gbest278.seq
 371220848     gbest279.seq
 524291760     gbest28.seq
 524288780     gbest280.seq
 524290343     gbest281.seq
 524292504     gbest282.seq
 524290020     gbest283.seq
 524289901     gbest284.seq
 524289661     gbest285.seq
 524288798     gbest286.seq
 524288871     gbest287.seq
 524290299     gbest288.seq
 524289242     gbest289.seq
 524292676     gbest29.seq
 524291923     gbest290.seq
 289458758     gbest291.seq
 524289729     gbest292.seq
 524288906     gbest293.seq
 524290466     gbest294.seq
 524288829     gbest295.seq
 524290213     gbest296.seq
 524291844     gbest297.seq
 524289120     gbest298.seq
 524291385     gbest299.seq
 488091336     gbest3.seq
 524292419     gbest30.seq
 524291194     gbest300.seq
 524288733     gbest301.seq
 469674945     gbest302.seq
 325361321     gbest303.seq
 475497685     gbest304.seq
 472632901     gbest305.seq
 524291179     gbest306.seq
 524290989     gbest307.seq
 524291596     gbest308.seq
 524291713     gbest309.seq
 524289766     gbest31.seq
 524292329     gbest310.seq
 524291177     gbest311.seq
 524289499     gbest312.seq
 524292096     gbest313.seq
 524291778     gbest314.seq
 524291386     gbest315.seq
 379197692     gbest316.seq
 524291691     gbest317.seq
 524289933     gbest318.seq
 524289070     gbest319.seq
 524290435     gbest32.seq
 524289585     gbest320.seq
 524289265     gbest321.seq
 524290884     gbest322.seq
 524290944     gbest323.seq
 524289450     gbest324.seq
 524291435     gbest325.seq
 524289813     gbest326.seq
 524291755     gbest327.seq
 514169282     gbest328.seq
 517236067     gbest329.seq
 524289338     gbest33.seq
 231006084     gbest330.seq
 524291599     gbest331.seq
 524291366     gbest332.seq
 524292463     gbest333.seq
 524289892     gbest334.seq
 524290794     gbest335.seq
 524292162     gbest336.seq
 494710163     gbest337.seq
 524291933     gbest338.seq
 524292139     gbest339.seq
 509442410     gbest34.seq
 524290742     gbest340.seq
 524289351     gbest341.seq
 524291441     gbest342.seq
 524288835     gbest343.seq
 335378288     gbest344.seq
 524291314     gbest345.seq
 524290188     gbest346.seq
 524289186     gbest347.seq
 524291804     gbest348.seq
 524289701     gbest349.seq
 486410799     gbest35.seq
 524290145     gbest350.seq
 510773378     gbest351.seq
 524289936     gbest352.seq
 524293740     gbest353.seq
 524294240     gbest354.seq
 524291985     gbest355.seq
 524292249     gbest356.seq
 524290019     gbest357.seq
 524288999     gbest358.seq
 142871748     gbest359.seq
 488145311     gbest36.seq
 524288921     gbest360.seq
 524289070     gbest361.seq
 524291020     gbest362.seq
 524289333     gbest363.seq
 524289518     gbest364.seq
 524290310     gbest365.seq
 524291715     gbest366.seq
 524291107     gbest367.seq
 524289536     gbest368.seq
 524289531     gbest369.seq
 486960569     gbest37.seq
 524289276     gbest370.seq
  66077296     gbest371.seq
 524290423     gbest372.seq
 524289957     gbest373.seq
 524289079     gbest374.seq
 524289632     gbest375.seq
 524291512     gbest376.seq
 524290286     gbest377.seq
 476685938     gbest378.seq
 524290459     gbest379.seq
 481688492     gbest38.seq
 524289127     gbest380.seq
 524291393     gbest381.seq
 524289198     gbest382.seq
 281276736     gbest383.seq
 524289493     gbest384.seq
 524290634     gbest385.seq
 524290129     gbest386.seq
 524290908     gbest387.seq
 524290406     gbest388.seq
 524290590     gbest389.seq
 485610546     gbest39.seq
 524289042     gbest390.seq
 524289444     gbest391.seq
 524289376     gbest392.seq
 524291347     gbest393.seq
 202178049     gbest394.seq
 524289148     gbest395.seq
 524289472     gbest396.seq
 524290848     gbest397.seq
 524292053     gbest398.seq
 524289790     gbest399.seq
 524290360     gbest4.seq
 134632241     gbest40.seq
 524291934     gbest400.seq
 524289421     gbest401.seq
 524291250     gbest402.seq
 524290031     gbest403.seq
 524291751     gbest404.seq
 524289465     gbest405.seq
 524289724     gbest406.seq
 434141154     gbest407.seq
 524290562     gbest408.seq
 524290619     gbest409.seq
 524288883     gbest41.seq
 524289414     gbest410.seq
 524289644     gbest411.seq
 524290184     gbest412.seq
 524289371     gbest413.seq
 524290287     gbest414.seq
 524289433     gbest415.seq
 524289487     gbest416.seq
 524290192     gbest417.seq
 524290923     gbest418.seq
 524290299     gbest419.seq
 524162079     gbest42.seq
 524290181     gbest420.seq
  10043015     gbest421.seq
 524291828     gbest422.seq
 524291275     gbest423.seq
 524292238     gbest424.seq
 524290070     gbest425.seq
 524290817     gbest426.seq
 524292294     gbest427.seq
 524292207     gbest428.seq
 524294854     gbest429.seq
 524289370     gbest43.seq
 524290606     gbest430.seq
 524289363     gbest431.seq
 524289392     gbest432.seq
 524291671     gbest433.seq
 524288731     gbest434.seq
 524291169     gbest435.seq
 110178526     gbest436.seq
 524289037     gbest437.seq
 524291187     gbest438.seq
 524291738     gbest439.seq
 524288785     gbest44.seq
 524291393     gbest440.seq
 524289614     gbest441.seq
 524291406     gbest442.seq
 524289138     gbest443.seq
 524288754     gbest444.seq
 524292827     gbest445.seq
 524290978     gbest446.seq
 524289937     gbest447.seq
 524291499     gbest448.seq
 185135235     gbest449.seq
 524288807     gbest45.seq
 524290301     gbest450.seq
 524288934     gbest451.seq
 524290178     gbest452.seq
 524291472     gbest453.seq
 524289024     gbest454.seq
 524289169     gbest455.seq
 524290790     gbest456.seq
 524289781     gbest457.seq
 524288926     gbest458.seq
 524289198     gbest459.seq
 524291148     gbest46.seq
 461655254     gbest460.seq
 524289421     gbest461.seq
 524290963     gbest462.seq
 524291483     gbest463.seq
 524289012     gbest464.seq
 524291486     gbest465.seq
 524290236     gbest466.seq
 524290327     gbest467.seq
 524291636     gbest468.seq
 524291214     gbest469.seq
 524289294     gbest47.seq
 524291015     gbest470.seq
 524289415     gbest471.seq
 409055900     gbest472.seq
 524289743     gbest473.seq
 524291493     gbest474.seq
 524291332     gbest475.seq
 524289188     gbest476.seq
 524289833     gbest477.seq
 524290999     gbest478.seq
 524288960     gbest479.seq
 524291624     gbest48.seq
 306846699     gbest480.seq
 524289032     gbest49.seq
 524291207     gbest5.seq
 524288969     gbest50.seq
 524291775     gbest51.seq
 524290853     gbest52.seq
 524290300     gbest53.seq
 236682064     gbest54.seq
 524290177     gbest55.seq
 524290969     gbest56.seq
 524289335     gbest57.seq
 524292442     gbest58.seq
 524291804     gbest59.seq
 524290436     gbest6.seq
 524290772     gbest60.seq
 524289224     gbest61.seq
 524289751     gbest62.seq
 524289662     gbest63.seq
 524291481     gbest64.seq
 524289062     gbest65.seq
 524290662     gbest66.seq
 446723790     gbest67.seq
 524288966     gbest68.seq
 524290244     gbest69.seq
 524289268     gbest7.seq
 524290980     gbest70.seq
 524289127     gbest71.seq
 524290075     gbest72.seq
 524288757     gbest73.seq
 524289441     gbest74.seq
 524290576     gbest75.seq
 524289519     gbest76.seq
 524290161     gbest77.seq
 524292235     gbest78.seq
 524292971     gbest79.seq
 524290237     gbest8.seq
 166119288     gbest80.seq
 524289521     gbest81.seq
 524290668     gbest82.seq
 524288876     gbest83.seq
 524290208     gbest84.seq
 524290966     gbest85.seq
 524288760     gbest86.seq
 524291168     gbest87.seq
 524289848     gbest88.seq
 524288867     gbest89.seq
 524289862     gbest9.seq
 524289288     gbest90.seq
 524290847     gbest91.seq
 447611298     gbest92.seq
 524291298     gbest93.seq
 524290738     gbest94.seq
 524290251     gbest95.seq
 524289700     gbest96.seq
 524289932     gbest97.seq
 524289944     gbest98.seq
 524290982     gbest99.seq
 524290967     gbgss1.seq
 524291584     gbgss10.seq
 524291969     gbgss100.seq
 524291063     gbgss101.seq
 524290763     gbgss102.seq
 524289279     gbgss103.seq
 416296086     gbgss104.seq
 524288734     gbgss105.seq
 524290555     gbgss106.seq
 524290607     gbgss107.seq
 524288998     gbgss108.seq
 524290857     gbgss109.seq
 524292223     gbgss11.seq
 524290957     gbgss110.seq
 524289238     gbgss111.seq
 524291151     gbgss112.seq
 524290371     gbgss113.seq
 524290149     gbgss114.seq
 524290115     gbgss115.seq
  51428811     gbgss116.seq
 524291588     gbgss117.seq
 524290557     gbgss118.seq
 524291655     gbgss119.seq
 524289205     gbgss12.seq
 524290239     gbgss120.seq
 524291100     gbgss121.seq
 524289128     gbgss122.seq
 524290620     gbgss123.seq
 524291137     gbgss124.seq
 524291692     gbgss125.seq
 524291415     gbgss126.seq
 524290952     gbgss127.seq
 524291620     gbgss128.seq
 197916527     gbgss129.seq
 524291156     gbgss13.seq
 524289379     gbgss130.seq
 524289293     gbgss131.seq
 524290300     gbgss132.seq
 524291513     gbgss133.seq
 524289632     gbgss134.seq
 524288902     gbgss135.seq
 524289789     gbgss136.seq
 524289093     gbgss137.seq
 524289978     gbgss138.seq
 505966982     gbgss139.seq
 524289464     gbgss14.seq
 498419668     gbgss140.seq
 179523396     gbgss141.seq
 524290461     gbgss142.seq
 524291886     gbgss143.seq
 524289693     gbgss144.seq
 524289578     gbgss145.seq
 524291566     gbgss146.seq
 524291522     gbgss147.seq
 524289121     gbgss148.seq
 524290503     gbgss149.seq
 524288799     gbgss15.seq
 524290670     gbgss150.seq
 524289862     gbgss151.seq
 325844542     gbgss152.seq
 524289769     gbgss153.seq
 524289179     gbgss154.seq
 524290194     gbgss155.seq
 524291703     gbgss156.seq
 524291390     gbgss157.seq
 524290078     gbgss158.seq
 524291487     gbgss159.seq
 524291420     gbgss16.seq
 524291175     gbgss160.seq
 524291055     gbgss161.seq
 524290640     gbgss162.seq
 524291314     gbgss163.seq
 524289146     gbgss164.seq
 127156167     gbgss165.seq
 524288733     gbgss166.seq
 524291400     gbgss167.seq
 524290408     gbgss168.seq
 524288751     gbgss169.seq
 524289810     gbgss17.seq
 524289501     gbgss170.seq
 524289194     gbgss171.seq
 391008463     gbgss172.seq
 249998888     gbgss173.seq
 249997727     gbgss174.seq
 249998129     gbgss175.seq
 249997964     gbgss176.seq
  31810345     gbgss177.seq
 249997137     gbgss178.seq
 250000033     gbgss179.seq
 524290838     gbgss18.seq
 249998542     gbgss180.seq
 249998333     gbgss181.seq
 224919493     gbgss182.seq
 249998415     gbgss183.seq
 249999205     gbgss184.seq
 249999508     gbgss185.seq
 250000220     gbgss186.seq
 193957356     gbgss187.seq
 249997950     gbgss188.seq
 249998694     gbgss189.seq
 302753617     gbgss19.seq
 249998786     gbgss190.seq
 249998823     gbgss191.seq
 249998181     gbgss192.seq
  71082277     gbgss193.seq
 249999828     gbgss194.seq
   2112081     gbgss195.seq
  80348603     gbgss196.seq
 249999264     gbgss197.seq
 249998529     gbgss198.seq
  87602941     gbgss199.seq
 524290458     gbgss2.seq
 524289797     gbgss20.seq
 249999685     gbgss200.seq
 249998355     gbgss201.seq
 250000242     gbgss202.seq
 202974017     gbgss203.seq
 249999232     gbgss204.seq
 249999415     gbgss205.seq
 249999535     gbgss206.seq
 246297144     gbgss207.seq
 249997836     gbgss208.seq
 249999647     gbgss209.seq
 524290010     gbgss21.seq
 249998223     gbgss210.seq
 244710946     gbgss211.seq
 249999336     gbgss212.seq
 249996623     gbgss213.seq
 249999794     gbgss214.seq
 249996718     gbgss215.seq
 126591595     gbgss216.seq
 249997387     gbgss217.seq
 249997998     gbgss218.seq
 249999931     gbgss219.seq
 524290954     gbgss22.seq
 249998615     gbgss220.seq
  92409107     gbgss221.seq
 249999742     gbgss222.seq
 249999443     gbgss223.seq
 249998584     gbgss224.seq
 249998226     gbgss225.seq
 249999180     gbgss226.seq
 143902147     gbgss227.seq
 249997846     gbgss228.seq
 249999124     gbgss229.seq
 524289057     gbgss23.seq
 249997821     gbgss230.seq
 249997789     gbgss231.seq
  84917634     gbgss232.seq
 249999461     gbgss233.seq
 249999350     gbgss234.seq
 249998406     gbgss235.seq
 249998619     gbgss236.seq
 249999398     gbgss237.seq
 249998013     gbgss238.seq
 107958198     gbgss239.seq
 524290844     gbgss24.seq
 249999424     gbgss240.seq
 249999963     gbgss241.seq
 249997369     gbgss242.seq
  43648880     gbgss243.seq
  52925443     gbgss244.seq
 249999101     gbgss245.seq
 249999225     gbgss246.seq
 249999246     gbgss247.seq
 250000245     gbgss248.seq
 249999181     gbgss249.seq
 524290992     gbgss25.seq
 249997776     gbgss250.seq
 212341896     gbgss251.seq
 249999617     gbgss252.seq
 250000113     gbgss253.seq
 249997380     gbgss254.seq
 249999823     gbgss255.seq
  27507329     gbgss256.seq
 249997661     gbgss257.seq
 249999221     gbgss258.seq
 249996423     gbgss259.seq
 524290627     gbgss26.seq
 249997687     gbgss260.seq
 249999776     gbgss261.seq
 249999649     gbgss262.seq
 191301715     gbgss263.seq
 249998299     gbgss264.seq
 249999964     gbgss265.seq
 249999490     gbgss266.seq
 227730674     gbgss267.seq
 249998576     gbgss268.seq
 250000163     gbgss269.seq
 524288846     gbgss27.seq
 249999363     gbgss270.seq
 249998261     gbgss271.seq
 249998426     gbgss272.seq
  67465568     gbgss273.seq
 249999961     gbgss274.seq
 249999246     gbgss275.seq
 249997183     gbgss276.seq
 249998878     gbgss277.seq
 249998009     gbgss278.seq
 249998219     gbgss279.seq
 524290199     gbgss28.seq
 250000041     gbgss280.seq
 249999365     gbgss281.seq
  75177878     gbgss282.seq
 249999562     gbgss283.seq
 249998752     gbgss284.seq
 249999600     gbgss285.seq
 249999029     gbgss286.seq
 221982324     gbgss287.seq
 249999829     gbgss288.seq
 250000049     gbgss289.seq
 524289069     gbgss29.seq
 249999422     gbgss290.seq
 249998101     gbgss291.seq
  91611181     gbgss292.seq
 249998405     gbgss293.seq
 250000114     gbgss294.seq
 249999023     gbgss295.seq
 249999413     gbgss296.seq
 249999744     gbgss297.seq
 249999055     gbgss298.seq
  98688701     gbgss299.seq
 524288872     gbgss3.seq
 524290585     gbgss30.seq
  59934462     gbgss31.seq
 524289197     gbgss32.seq
 524290189     gbgss33.seq
 524290259     gbgss34.seq
 524289737     gbgss35.seq
 524290508     gbgss36.seq
 524289342     gbgss37.seq
 524291003     gbgss38.seq
 498940194     gbgss39.seq
 524291733     gbgss4.seq
 524290540     gbgss40.seq
 524289789     gbgss41.seq
 524289388     gbgss42.seq
  38956121     gbgss43.seq
 524289586     gbgss44.seq
 524289416     gbgss45.seq
 524289159     gbgss46.seq
 524290606     gbgss47.seq
 226094564     gbgss48.seq
 524289088     gbgss49.seq
 160046964     gbgss5.seq
 524291855     gbgss50.seq
 524289535     gbgss51.seq
 524290788     gbgss52.seq
 524290961     gbgss53.seq
 524289372     gbgss54.seq
 524291173     gbgss55.seq
 524291622     gbgss56.seq
 524290981     gbgss57.seq
 524290997     gbgss58.seq
 524290593     gbgss59.seq
 524290099     gbgss6.seq
  46343740     gbgss60.seq
 524291179     gbgss61.seq
 524290061     gbgss62.seq
 524290658     gbgss63.seq
 455743473     gbgss64.seq
 524290971     gbgss65.seq
 524289987     gbgss66.seq
 524289481     gbgss67.seq
 524291853     gbgss68.seq
 524291374     gbgss69.seq
 524291972     gbgss7.seq
 524290601     gbgss70.seq
 524289252     gbgss71.seq
 524288994     gbgss72.seq
 524290479     gbgss73.seq
 524290735     gbgss74.seq
 524290932     gbgss75.seq
 524290916     gbgss76.seq
  40330605     gbgss77.seq
 524290719     gbgss78.seq
 524291757     gbgss79.seq
 524290167     gbgss8.seq
 524289493     gbgss80.seq
 524290079     gbgss81.seq
 524289086     gbgss82.seq
 524293672     gbgss83.seq
 524288833     gbgss84.seq
 524291664     gbgss85.seq
 524291906     gbgss86.seq
 524289351     gbgss87.seq
 524290627     gbgss88.seq
 385974664     gbgss89.seq
 524292309     gbgss9.seq
 524291919     gbgss90.seq
 524289553     gbgss91.seq
 524292535     gbgss92.seq
 524291749     gbgss93.seq
 524291967     gbgss94.seq
 524289937     gbgss95.seq
 524291779     gbgss96.seq
 524292054     gbgss97.seq
 524288810     gbgss98.seq
 524290782     gbgss99.seq
 249989230     gbhtc1.seq
 249997276     gbhtc10.seq
 249998183     gbhtc11.seq
 117274481     gbhtc12.seq
 250000092     gbhtc13.seq
 250000118     gbhtc14.seq
 131751347     gbhtc15.seq
 249995319     gbhtc2.seq
 249993906     gbhtc3.seq
 249998396     gbhtc4.seq
 249989366     gbhtc5.seq
 249989186     gbhtc6.seq
 249996567     gbhtc7.seq
  85908087     gbhtc8.seq
 249998301     gbhtc9.seq
 249935185     gbhtg1.seq
 249953485     gbhtg10.seq
 249912350     gbhtg100.seq
 249866482     gbhtg101.seq
 249548804     gbhtg102.seq
 249901659     gbhtg103.seq
   3688364     gbhtg104.seq
 249812755     gbhtg105.seq
 249886731     gbhtg106.seq
 249840796     gbhtg107.seq
 249901348     gbhtg108.seq
 249973868     gbhtg109.seq
    799345     gbhtg11.seq
 249776631     gbhtg110.seq
 167857353     gbhtg111.seq
 249852317     gbhtg112.seq
 249920372     gbhtg113.seq
 249857995     gbhtg114.seq
 249908170     gbhtg115.seq
 249998602     gbhtg116.seq
 249966339     gbhtg117.seq
 249942541     gbhtg118.seq
 219055923     gbhtg119.seq
 249887544     gbhtg12.seq
 249984475     gbhtg120.seq
 249895000     gbhtg121.seq
 249934198     gbhtg122.seq
 249898759     gbhtg123.seq
 249889536     gbhtg124.seq
 249935646     gbhtg125.seq
 249938031     gbhtg126.seq
 249899020     gbhtg127.seq
  40177402     gbhtg128.seq
 249856106     gbhtg129.seq
 249967505     gbhtg13.seq
 249939575     gbhtg130.seq
 249866351     gbhtg131.seq
 249835929     gbhtg132.seq
 249858212     gbhtg133.seq
 136616612     gbhtg134.seq
 249860736     gbhtg135.seq
 249838185     gbhtg136.seq
 249821150     gbhtg137.seq
 249911176     gbhtg138.seq
 249980071     gbhtg139.seq
 249584228     gbhtg14.seq
 134314079     gbhtg140.seq
 249953145     gbhtg141.seq
 249783998     gbhtg142.seq
 249833127     gbhtg143.seq
 249912244     gbhtg144.seq
 249929984     gbhtg145.seq
 249938777     gbhtg146.seq
 249847558     gbhtg147.seq
 249918876     gbhtg148.seq
 249922107     gbhtg149.seq
 249771919     gbhtg15.seq
 249952857     gbhtg150.seq
 205242871     gbhtg151.seq
 249738494     gbhtg16.seq
 249165958     gbhtg17.seq
 249979927     gbhtg18.seq
 249676768     gbhtg19.seq
 249996486     gbhtg2.seq
 249986049     gbhtg20.seq
 237141740     gbhtg21.seq
 249756771     gbhtg22.seq
 249864562     gbhtg23.seq
 249983387     gbhtg24.seq
 249917977     gbhtg25.seq
 249757014     gbhtg26.seq
 249887744     gbhtg27.seq
 249957955     gbhtg28.seq
 249838323     gbhtg29.seq
 249996216     gbhtg3.seq
 249989476     gbhtg30.seq
 225321826     gbhtg31.seq
 249823604     gbhtg32.seq
 249917450     gbhtg33.seq
 249925293     gbhtg34.seq
 249914652     gbhtg35.seq
 249854022     gbhtg36.seq
 249811774     gbhtg37.seq
 249764394     gbhtg38.seq
 249623472     gbhtg39.seq
 249972436     gbhtg4.seq
 249836243     gbhtg40.seq
 224358139     gbhtg41.seq
 249873733     gbhtg42.seq
 249782842     gbhtg43.seq
 249972729     gbhtg44.seq
 249775813     gbhtg45.seq
 249969325     gbhtg46.seq
 249706878     gbhtg47.seq
 249863205     gbhtg48.seq
 249889931     gbhtg49.seq
 249908886     gbhtg5.seq
 249899880     gbhtg50.seq
 234820081     gbhtg51.seq
 249734598     gbhtg52.seq
 249972576     gbhtg53.seq
 249784976     gbhtg54.seq
 249720530     gbhtg55.seq
 249959627     gbhtg56.seq
  18795807     gbhtg57.seq
 249859956     gbhtg58.seq
 249826211     gbhtg59.seq
 249992697     gbhtg6.seq
 249998076     gbhtg60.seq
 249924577     gbhtg61.seq
 225131068     gbhtg62.seq
 249885019     gbhtg63.seq
 249907389     gbhtg64.seq
 249800911     gbhtg65.seq
 249763500     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249984103     gbhtg69.seq
 249808376     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249767742     gbhtg72.seq
 223424441     gbhtg73.seq
 249943905     gbhtg74.seq
 249882106     gbhtg75.seq
 249843224     gbhtg76.seq
 249941051     gbhtg77.seq
 235169289     gbhtg78.seq
 249873946     gbhtg79.seq
 249827100     gbhtg8.seq
 249969842     gbhtg80.seq
 249860058     gbhtg81.seq
 249885107     gbhtg82.seq
 202292732     gbhtg83.seq
 249865799     gbhtg84.seq
 249945430     gbhtg85.seq
 249859118     gbhtg86.seq
 249878008     gbhtg87.seq
 206011830     gbhtg88.seq
 249882064     gbhtg89.seq
 249952738     gbhtg9.seq
 249867864     gbhtg90.seq
 249771591     gbhtg91.seq
 249883880     gbhtg92.seq
 194407323     gbhtg93.seq
 249968670     gbhtg94.seq
 249979522     gbhtg95.seq
 249873448     gbhtg96.seq
 249797882     gbhtg97.seq
 161658993     gbhtg98.seq
 249873318     gbhtg99.seq
 249999431     gbinv1.seq
 249051590     gbinv10.seq
 249998795     gbinv100.seq
 249994232     gbinv101.seq
 249966582     gbinv102.seq
 249983747     gbinv103.seq
 249995961     gbinv104.seq
 249994417     gbinv105.seq
 151414969     gbinv106.seq
 249999545     gbinv107.seq
 249995664     gbinv108.seq
 249998338     gbinv109.seq
 249994786     gbinv11.seq
 249793471     gbinv110.seq
 249981535     gbinv111.seq
 249997903     gbinv112.seq
 243824572     gbinv113.seq
  52925611     gbinv114.seq
 249973860     gbinv115.seq
 249946261     gbinv116.seq
 249988320     gbinv117.seq
 249992203     gbinv118.seq
  25288037     gbinv119.seq
 249997517     gbinv12.seq
 250000131     gbinv120.seq
 249997724     gbinv121.seq
  59918656     gbinv122.seq
 249998579     gbinv123.seq
 249973278     gbinv124.seq
 249995075     gbinv125.seq
 249994925     gbinv126.seq
 148119999     gbinv127.seq
 249995603     gbinv128.seq
 249999045     gbinv129.seq
 225084784     gbinv13.seq
 249999297     gbinv130.seq
 249999642     gbinv131.seq
 249998443     gbinv132.seq
 249999508     gbinv133.seq
 249381302     gbinv134.seq
 159193257     gbinv135.seq
    231513     gbinv136.seq
 249998526     gbinv14.seq
 249999218     gbinv15.seq
 249999736     gbinv16.seq
 165765377     gbinv17.seq
 249513837     gbinv18.seq
 247715986     gbinv19.seq
 249850774     gbinv2.seq
 250000129     gbinv20.seq
 249998177     gbinv21.seq
 249998498     gbinv22.seq
   1595277     gbinv23.seq
 230124997     gbinv24.seq
 175506967     gbinv25.seq
 249999402     gbinv26.seq
 249999834     gbinv27.seq
 227021134     gbinv28.seq
 249998368     gbinv29.seq
 249743001     gbinv3.seq
 249997176     gbinv30.seq
 249997793     gbinv31.seq
 249997495     gbinv32.seq
 181966519     gbinv33.seq
 249998273     gbinv34.seq
 249999352     gbinv35.seq
 249999583     gbinv36.seq
 249998174     gbinv37.seq
 179613193     gbinv38.seq
 249998481     gbinv39.seq
 221282314     gbinv4.seq
 249998724     gbinv40.seq
 249999124     gbinv41.seq
 249997411     gbinv42.seq
  83998556     gbinv43.seq
 249997131     gbinv44.seq
 249999266     gbinv45.seq
 249998535     gbinv46.seq
 249999316     gbinv47.seq
 249998232     gbinv48.seq
 249997731     gbinv49.seq
 249999694     gbinv5.seq
 250000007     gbinv50.seq
 249996989     gbinv51.seq
  78777534     gbinv52.seq
 249999389     gbinv53.seq
 249999741     gbinv54.seq
 249998217     gbinv55.seq
 201725951     gbinv56.seq
 249933236     gbinv57.seq
 249971937     gbinv58.seq
 247888568     gbinv59.seq
 249998055     gbinv6.seq
 249989382     gbinv60.seq
 249958910     gbinv61.seq
 249849667     gbinv62.seq
 249972455     gbinv63.seq
 220735667     gbinv64.seq
 249997947     gbinv65.seq
 249993437     gbinv66.seq
 249995495     gbinv67.seq
 249997709     gbinv68.seq
  51747128     gbinv69.seq
 249998465     gbinv7.seq
 249996142     gbinv70.seq
 249961763     gbinv71.seq
 249996526     gbinv72.seq
 249990785     gbinv73.seq
 249983105     gbinv74.seq
 249977710     gbinv75.seq
 249994985     gbinv76.seq
 249998590     gbinv77.seq
 249999068     gbinv78.seq
 224842193     gbinv79.seq
 227410722     gbinv8.seq
 249989083     gbinv80.seq
 249979519     gbinv81.seq
 249994236     gbinv82.seq
 249996734     gbinv83.seq
 250000084     gbinv84.seq
 249999397     gbinv85.seq
 249994988     gbinv86.seq
 249998647     gbinv87.seq
  30318265     gbinv88.seq
 249955084     gbinv89.seq
 249997940     gbinv9.seq
 249996848     gbinv90.seq
 249991951     gbinv91.seq
 249976129     gbinv92.seq
 249999979     gbinv93.seq
 249983497     gbinv94.seq
 249996597     gbinv95.seq
  89129685     gbinv96.seq
 249973374     gbinv97.seq
 249899692     gbinv98.seq
 249979395     gbinv99.seq
 249868312     gbmam1.seq
 338653945     gbmam10.seq
 315434421     gbmam11.seq
 162425861     gbmam12.seq
 150157348     gbmam13.seq
 159032552     gbmam14.seq
 136269244     gbmam15.seq
 122412969     gbmam16.seq
 248159424     gbmam17.seq
 202955099     gbmam18.seq
 208310894     gbmam19.seq
 249994865     gbmam2.seq
 209752374     gbmam20.seq
 197940571     gbmam21.seq
 230561883     gbmam22.seq
 220222486     gbmam23.seq
 123191148     gbmam24.seq
 191446547     gbmam25.seq
   9946563     gbmam26.seq
  43996573     gbmam27.seq
  91328397     gbmam28.seq
  88836150     gbmam29.seq
  81812258     gbmam3.seq
   6474948     gbmam30.seq
  21386956     gbmam31.seq
 249997304     gbmam32.seq
 203260074     gbmam33.seq
 249999281     gbmam34.seq
 249998691     gbmam35.seq
 249998328     gbmam36.seq
  92204364     gbmam37.seq
  86006821     gbmam4.seq
  72145384     gbmam5.seq
  22738739     gbmam6.seq
   1267718     gbmam7.seq
   2480909     gbmam8.seq
 375834671     gbmam9.seq
  18487317     gbnew.txt
 249998243     gbpat1.seq
 249999494     gbpat10.seq
 249999052     gbpat100.seq
 249998996     gbpat101.seq
 249999065     gbpat102.seq
 249999793     gbpat103.seq
 149112469     gbpat104.seq
 249999880     gbpat105.seq
 249998929     gbpat106.seq
 249928220     gbpat107.seq
 249824879     gbpat108.seq
 249998856     gbpat109.seq
 179861220     gbpat11.seq
 192956252     gbpat110.seq
 250000180     gbpat111.seq
 249999701     gbpat112.seq
 249995735     gbpat113.seq
  80219209     gbpat114.seq
 249999685     gbpat115.seq
 250000202     gbpat116.seq
 249767876     gbpat117.seq
 250000129     gbpat118.seq
 249999583     gbpat119.seq
 249987435     gbpat12.seq
  67188949     gbpat120.seq
 249998923     gbpat121.seq
 250000184     gbpat122.seq
 249999601     gbpat123.seq
 249999810     gbpat124.seq
 160252740     gbpat125.seq
 249999692     gbpat126.seq
 250000171     gbpat127.seq
 234780519     gbpat128.seq
 249991536     gbpat129.seq
 249999056     gbpat13.seq
 249970935     gbpat130.seq
 249999745     gbpat131.seq
 249999400     gbpat132.seq
 249994345     gbpat133.seq
  66832984     gbpat134.seq
 249992315     gbpat135.seq
 249999844     gbpat136.seq
 250000121     gbpat137.seq
 250000131     gbpat138.seq
 249999522     gbpat139.seq
 249999845     gbpat14.seq
  18435141     gbpat140.seq
 249999655     gbpat141.seq
 249998828     gbpat142.seq
 249999803     gbpat143.seq
 249999630     gbpat144.seq
  46945926     gbpat145.seq
 250000154     gbpat146.seq
 249998813     gbpat147.seq
 249998963     gbpat148.seq
 234578566     gbpat149.seq
 249996082     gbpat15.seq
 249999721     gbpat150.seq
 249999913     gbpat151.seq
 249999528     gbpat152.seq
  86841554     gbpat153.seq
 249999922     gbpat154.seq
 249998652     gbpat155.seq
 249999117     gbpat156.seq
  63851432     gbpat157.seq
 249997862     gbpat158.seq
 249999933     gbpat159.seq
 249999391     gbpat16.seq
 250000112     gbpat160.seq
 249999402     gbpat161.seq
 249999639     gbpat162.seq
 249999487     gbpat163.seq
 224194342     gbpat164.seq
 250000249     gbpat165.seq
 249999893     gbpat166.seq
 249999893     gbpat167.seq
 220539897     gbpat168.seq
 249999753     gbpat169.seq
  75603989     gbpat17.seq
 249998326     gbpat170.seq
 249999321     gbpat171.seq
  12454839     gbpat172.seq
 249950762     gbpat173.seq
 249998465     gbpat174.seq
 249999506     gbpat175.seq
 250000259     gbpat176.seq
  91701226     gbpat177.seq
 249999432     gbpat178.seq
 249999105     gbpat179.seq
 250000027     gbpat18.seq
 249998633     gbpat180.seq
 250000180     gbpat181.seq
   9115252     gbpat182.seq
 249999856     gbpat183.seq
 249999183     gbpat184.seq
 249999616     gbpat185.seq
 249999284     gbpat186.seq
 250000120     gbpat187.seq
 249999388     gbpat188.seq
 249999877     gbpat189.seq
 249999209     gbpat19.seq
 104201563     gbpat190.seq
 249998585     gbpat191.seq
 249999059     gbpat192.seq
 249999870     gbpat193.seq
 249995949     gbpat194.seq
 214692020     gbpat195.seq
 249995764     gbpat196.seq
 249209295     gbpat197.seq
 249997832     gbpat198.seq
 249999356     gbpat199.seq
 249994776     gbpat2.seq
 249999254     gbpat20.seq
 181213317     gbpat200.seq
 249548891     gbpat201.seq
 248510850     gbpat202.seq
 249999000     gbpat203.seq
 250000238     gbpat204.seq
 249937220     gbpat205.seq
 249999876     gbpat206.seq
  18031394     gbpat207.seq
 249999836     gbpat208.seq
 250000239     gbpat209.seq
 249998950     gbpat21.seq
 249999637     gbpat210.seq
 249997737     gbpat211.seq
 249998332     gbpat212.seq
 249999619     gbpat213.seq
 249995461     gbpat214.seq
 249998862     gbpat215.seq
 249995466     gbpat216.seq
 249999694     gbpat217.seq
 242040742     gbpat218.seq
 249999844     gbpat219.seq
 186231414     gbpat22.seq
 249999499     gbpat220.seq
 249998076     gbpat221.seq
 249999526     gbpat222.seq
  66984186     gbpat223.seq
 250000133     gbpat224.seq
 249998508     gbpat225.seq
 249995299     gbpat226.seq
 249996474     gbpat227.seq
 249997032     gbpat228.seq
 244578921     gbpat229.seq
 249999986     gbpat23.seq
 249999763     gbpat230.seq
 249999967     gbpat231.seq
 250000101     gbpat232.seq
 249998350     gbpat233.seq
  35657240     gbpat234.seq
 249999048     gbpat235.seq
 249994707     gbpat236.seq
 249999514     gbpat237.seq
 144872604     gbpat238.seq
 249706988     gbpat239.seq
 249826207     gbpat24.seq
 249999719     gbpat240.seq
 250000099     gbpat241.seq
 250000099     gbpat242.seq
 249999965     gbpat243.seq
 249999587     gbpat244.seq
 179771996     gbpat245.seq
  63227486     gbpat246.seq
 249999796     gbpat25.seq
 249999510     gbpat26.seq
  71842513     gbpat27.seq
 249998732     gbpat28.seq
 249999909     gbpat29.seq
 249999364     gbpat3.seq
 249998408     gbpat30.seq
 249999340     gbpat31.seq
 249999300     gbpat32.seq
 180390029     gbpat33.seq
 250000043     gbpat34.seq
 249998536     gbpat35.seq
 250000027     gbpat36.seq
 249999240     gbpat37.seq
 249999849     gbpat38.seq
 249999312     gbpat39.seq
 249998815     gbpat4.seq
 249828460     gbpat40.seq
 103949790     gbpat41.seq
 249999029     gbpat42.seq
 249979613     gbpat43.seq
 249999850     gbpat44.seq
 249999634     gbpat45.seq
 249999517     gbpat46.seq
 249942586     gbpat47.seq
 249999788     gbpat48.seq
 249998536     gbpat49.seq
  71663145     gbpat5.seq
 172106693     gbpat50.seq
 249997876     gbpat51.seq
 249999740     gbpat52.seq
 250000064     gbpat53.seq
 250000038     gbpat54.seq
 222935237     gbpat55.seq
 249999057     gbpat56.seq
 249999847     gbpat57.seq
 249999517     gbpat58.seq
 164755595     gbpat59.seq
 249998966     gbpat6.seq
 249912053     gbpat60.seq
 249999676     gbpat61.seq
 249999083     gbpat62.seq
 249998732     gbpat63.seq
 135951896     gbpat64.seq
 250000044     gbpat65.seq
 249998123     gbpat66.seq
 249996994     gbpat67.seq
 249998077     gbpat68.seq
 250000144     gbpat69.seq
 249999985     gbpat7.seq
 249999452     gbpat70.seq
 144901242     gbpat71.seq
 249999880     gbpat72.seq
 249999899     gbpat73.seq
 249998837     gbpat74.seq
 244402247     gbpat75.seq
 248968893     gbpat76.seq
 244458666     gbpat77.seq
 247877996     gbpat78.seq
 249998936     gbpat79.seq
 249979569     gbpat8.seq
 160632775     gbpat80.seq
 250000121     gbpat81.seq
 249999657     gbpat82.seq
 249999470     gbpat83.seq
 249999644     gbpat84.seq
 250000196     gbpat85.seq
 249999913     gbpat86.seq
  99345448     gbpat87.seq
 249157810     gbpat88.seq
 249999245     gbpat89.seq
 249999961     gbpat9.seq
 249999755     gbpat90.seq
 249999384     gbpat91.seq
 249999113     gbpat92.seq
 249999495     gbpat93.seq
 145308021     gbpat94.seq
 249999294     gbpat95.seq
 249998960     gbpat96.seq
 249999939     gbpat97.seq
 250000257     gbpat98.seq
 196971900     gbpat99.seq
 249994596     gbphg1.seq
 249806774     gbphg2.seq
  63870134     gbphg3.seq
 249998021     gbpln1.seq
 157523143     gbpln10.seq
 249996211     gbpln100.seq
 249999823     gbpln101.seq
 249896627     gbpln102.seq
  90097379     gbpln103.seq
 249998937     gbpln104.seq
 249997947     gbpln105.seq
 249999763     gbpln106.seq
 202264984     gbpln107.seq
 249998536     gbpln108.seq
 249997471     gbpln109.seq
 249996253     gbpln11.seq
 249998386     gbpln110.seq
 123539682     gbpln111.seq
 249973190     gbpln112.seq
 249943593     gbpln113.seq
 249997346     gbpln114.seq
  65124082     gbpln115.seq
 249874544     gbpln116.seq
 249903393     gbpln117.seq
 245761082     gbpln118.seq
 249219320     gbpln119.seq
 249995402     gbpln12.seq
 246544994     gbpln120.seq
 214760076     gbpln121.seq
 239775922     gbpln122.seq
 249680555     gbpln123.seq
 207038273     gbpln124.seq
    967690     gbpln125.seq
 249995982     gbpln13.seq
 249977573     gbpln14.seq
 217143559     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
  20516461     gbpln19.seq
 249998115     gbpln2.seq
 242151461     gbpln20.seq
 249944343     gbpln21.seq
 248503758     gbpln22.seq
 249473179     gbpln23.seq
 235702745     gbpln24.seq
 232335792     gbpln25.seq
 233137901     gbpln26.seq
 235733976     gbpln27.seq
 199441006     gbpln28.seq
 193250955     gbpln29.seq
 249983502     gbpln3.seq
 249998952     gbpln30.seq
 100520847     gbpln31.seq
 249998886     gbpln32.seq
 141504360     gbpln33.seq
 206763839     gbpln34.seq
  85568252     gbpln35.seq
 193636511     gbpln36.seq
 220248685     gbpln37.seq
 238613462     gbpln38.seq
 249133968     gbpln39.seq
 249949409     gbpln4.seq
 247513250     gbpln40.seq
 249326251     gbpln41.seq
 248954342     gbpln42.seq
 155872787     gbpln43.seq
 248784015     gbpln44.seq
 247962145     gbpln45.seq
 248871590     gbpln46.seq
 249648047     gbpln47.seq
 249483980     gbpln48.seq
 227366911     gbpln49.seq
 249961358     gbpln5.seq
 237545098     gbpln50.seq
 249427743     gbpln51.seq
 156860992     gbpln52.seq
  40095425     gbpln53.seq
  75057058     gbpln54.seq
 249998408     gbpln55.seq
 249997818     gbpln56.seq
 249999270     gbpln57.seq
 115224149     gbpln58.seq
 249998494     gbpln59.seq
 249797510     gbpln6.seq
 249999696     gbpln60.seq
 249998265     gbpln61.seq
 249998394     gbpln62.seq
 149583812     gbpln63.seq
 249997837     gbpln64.seq
 249997531     gbpln65.seq
 249998234     gbpln66.seq
 249393713     gbpln67.seq
 246484142     gbpln68.seq
 249963482     gbpln69.seq
 249910230     gbpln7.seq
 249999798     gbpln70.seq
  46998481     gbpln71.seq
 249999420     gbpln72.seq
  50205767     gbpln73.seq
 212662970     gbpln74.seq
 249114350     gbpln75.seq
 187022878     gbpln76.seq
 997560866     gbpln77.seq
  55895323     gbpln78.seq
 211093825     gbpln79.seq
 249890941     gbpln8.seq
 171793674     gbpln80.seq
 197391160     gbpln81.seq
 177950644     gbpln82.seq
 196456279     gbpln83.seq
 189037066     gbpln84.seq
 220764647     gbpln85.seq
 227204520     gbpln86.seq
 224027197     gbpln87.seq
 248372246     gbpln88.seq
 188525180     gbpln89.seq
 249998470     gbpln9.seq
 249999933     gbpln90.seq
 249999161     gbpln91.seq
  62677120     gbpln92.seq
 249998769     gbpln93.seq
 249998938     gbpln94.seq
 249999400     gbpln95.seq
 250000061     gbpln96.seq
 249999044     gbpln97.seq
  25216594     gbpln98.seq
 249999496     gbpln99.seq
 149029999     gbpri1.seq
 249840096     gbpri10.seq
 143962018     gbpri11.seq
 249958771     gbpri12.seq
 249890671     gbpri13.seq
 249893869     gbpri14.seq
 249943075     gbpri15.seq
 249865806     gbpri16.seq
 249867568     gbpri17.seq
 249757996     gbpri18.seq
 249922745     gbpri19.seq
 249955150     gbpri2.seq
 249959015     gbpri20.seq
 249969459     gbpri21.seq
 249684154     gbpri22.seq
 149016879     gbpri23.seq
 177369871     gbpri24.seq
 249994845     gbpri25.seq
 211434460     gbpri26.seq
 249970709     gbpri27.seq
 249937746     gbpri28.seq
 249764453     gbpri29.seq
 249929800     gbpri3.seq
 249875065     gbpri30.seq
 249885937     gbpri31.seq
 249972196     gbpri32.seq
 249965632     gbpri33.seq
 249983306     gbpri34.seq
  28317791     gbpri35.seq
 249994554     gbpri36.seq
 249995846     gbpri37.seq
 249546137     gbpri38.seq
 249997294     gbpri39.seq
 249981535     gbpri4.seq
 249630101     gbpri40.seq
 203192185     gbpri41.seq
 249999616     gbpri42.seq
 249970144     gbpri43.seq
 249995535     gbpri44.seq
 249974430     gbpri45.seq
 249992464     gbpri46.seq
 249997904     gbpri47.seq
 180416473     gbpri48.seq
 314294187     gbpri49.seq
 249940899     gbpri5.seq
 258775309     gbpri50.seq
 268666448     gbpri51.seq
 249956649     gbpri52.seq
  12596327     gbpri53.seq
      2644     gbpri54.seq
 249865983     gbpri6.seq
 249762410     gbpri7.seq
 249909956     gbpri8.seq
 249783069     gbpri9.seq
    422392     gbrel.txt
 249910648     gbrod1.seq
 249881012     gbrod10.seq
  81395652     gbrod11.seq
 249871281     gbrod12.seq
 249783723     gbrod13.seq
 249992850     gbrod14.seq
 249651610     gbrod15.seq
 249953745     gbrod16.seq
 249885180     gbrod17.seq
 249943440     gbrod18.seq
 249999964     gbrod19.seq
 249966454     gbrod2.seq
   6190543     gbrod20.seq
 249986435     gbrod21.seq
 249769182     gbrod22.seq
 191022450     gbrod23.seq
 249997083     gbrod24.seq
 249995233     gbrod25.seq
 249897979     gbrod26.seq
 249849902     gbrod27.seq
 249999538     gbrod28.seq
 249988328     gbrod29.seq
 249855993     gbrod3.seq
 249997179     gbrod30.seq
 165415899     gbrod31.seq
 249898357     gbrod4.seq
 249902546     gbrod5.seq
 249953833     gbrod6.seq
 249875514     gbrod7.seq
 249989335     gbrod8.seq
 249955881     gbrod9.seq
 249997156     gbsts1.seq
 249997905     gbsts10.seq
 210966786     gbsts11.seq
 249996524     gbsts12.seq
 250000001     gbsts13.seq
 249998369     gbsts14.seq
 249999397     gbsts15.seq
  26057898     gbsts16.seq
 250000234     gbsts17.seq
 249999569     gbsts18.seq
 249999175     gbsts19.seq
 249999945     gbsts2.seq
 187465088     gbsts20.seq
 249997298     gbsts3.seq
 249998701     gbsts4.seq
  42343720     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249997315     gbsts9.seq
 248061554     gbsyn1.seq
 249992206     gbsyn2.seq
 249995033     gbsyn3.seq
 249990159     gbsyn4.seq
 249945129     gbsyn5.seq
 249963975     gbsyn6.seq
 249999592     gbsyn7.seq
 132623350     gbsyn8.seq
 249999103     gbtsa1.seq
  56875503     gbtsa10.seq
 249999189     gbtsa100.seq
 249999433     gbtsa101.seq
 249996526     gbtsa102.seq
 249998542     gbtsa103.seq
 107894053     gbtsa104.seq
 249999743     gbtsa105.seq
 249999340     gbtsa106.seq
 250000193     gbtsa107.seq
 249997708     gbtsa108.seq
 249999597     gbtsa109.seq
 249996711     gbtsa11.seq
 249998574     gbtsa110.seq
 228581442     gbtsa111.seq
 249998448     gbtsa112.seq
 249998116     gbtsa113.seq
 249999828     gbtsa114.seq
 249999325     gbtsa115.seq
 249994026     gbtsa116.seq
  16579382     gbtsa117.seq
 249998403     gbtsa118.seq
 249999879     gbtsa119.seq
 249996983     gbtsa12.seq
 249998407     gbtsa120.seq
 220818721     gbtsa121.seq
 249996276     gbtsa122.seq
 249998492     gbtsa123.seq
 249994958     gbtsa124.seq
 249998709     gbtsa125.seq
 249999528     gbtsa126.seq
 249998038     gbtsa127.seq
 173017184     gbtsa128.seq
 249999326     gbtsa129.seq
 249992959     gbtsa13.seq
 249997095     gbtsa130.seq
 249998452     gbtsa131.seq
 249997998     gbtsa132.seq
 249999141     gbtsa133.seq
 249999792     gbtsa134.seq
   8254827     gbtsa135.seq
 249999027     gbtsa136.seq
 249999626     gbtsa137.seq
 249999337     gbtsa138.seq
 249997377     gbtsa139.seq
 249998857     gbtsa14.seq
 136260650     gbtsa140.seq
 249998131     gbtsa141.seq
 249999514     gbtsa142.seq
 249997541     gbtsa143.seq
 249997718     gbtsa144.seq
  35878567     gbtsa145.seq
 249999033     gbtsa146.seq
 249999594     gbtsa147.seq
 249997800     gbtsa148.seq
 249999490     gbtsa149.seq
 211085582     gbtsa15.seq
 249998415     gbtsa150.seq
 250000242     gbtsa151.seq
 249999053     gbtsa152.seq
 249998502     gbtsa153.seq
  55349804     gbtsa154.seq
 249998344     gbtsa155.seq
 249998929     gbtsa156.seq
 249999098     gbtsa157.seq
 249998969     gbtsa158.seq
 249998324     gbtsa159.seq
 249997341     gbtsa16.seq
 249996965     gbtsa160.seq
  87841275     gbtsa161.seq
 249999569     gbtsa162.seq
 249998179     gbtsa163.seq
 249997593     gbtsa164.seq
 133634227     gbtsa165.seq
 250000051     gbtsa166.seq
 249997064     gbtsa167.seq
 249996807     gbtsa168.seq
 249995565     gbtsa169.seq
 249999323     gbtsa17.seq
 249999016     gbtsa170.seq
 249999347     gbtsa171.seq
 212464283     gbtsa172.seq
 249999604     gbtsa173.seq
 250000062     gbtsa174.seq
 249998057     gbtsa175.seq
 249999289     gbtsa176.seq
 249999094     gbtsa177.seq
 249995474     gbtsa178.seq
 235671082     gbtsa179.seq
 249997905     gbtsa18.seq
 249996624     gbtsa180.seq
 249997321     gbtsa181.seq
 249995617     gbtsa182.seq
 249994262     gbtsa183.seq
 249997299     gbtsa184.seq
 249994810     gbtsa185.seq
 249996107     gbtsa186.seq
 158803373     gbtsa187.seq
 249998144     gbtsa188.seq
 249999142     gbtsa189.seq
 249996813     gbtsa19.seq
 249995468     gbtsa190.seq
 249995022     gbtsa191.seq
 249996263     gbtsa192.seq
 249997899     gbtsa193.seq
 245292246     gbtsa194.seq
 249999134     gbtsa2.seq
 184133188     gbtsa20.seq
 249998807     gbtsa21.seq
 249998164     gbtsa22.seq
 250000229     gbtsa23.seq
 250000261     gbtsa24.seq
 132951096     gbtsa25.seq
 249998989     gbtsa26.seq
 249996697     gbtsa27.seq
 249999508     gbtsa28.seq
 249996125     gbtsa29.seq
 249998094     gbtsa3.seq
 249994711     gbtsa30.seq
  14694736     gbtsa31.seq
 249999462     gbtsa32.seq
 249997921     gbtsa33.seq
 250000061     gbtsa34.seq
 249999369     gbtsa35.seq
 249998710     gbtsa36.seq
 250000200     gbtsa37.seq
  77824344     gbtsa38.seq
 249998838     gbtsa39.seq
 249998875     gbtsa4.seq
 249998049     gbtsa40.seq
 249998580     gbtsa41.seq
 249998509     gbtsa42.seq
 249998813     gbtsa43.seq
 249998265     gbtsa44.seq
 249999019     gbtsa45.seq
  35343531     gbtsa46.seq
 249996819     gbtsa47.seq
 249998958     gbtsa48.seq
 249998918     gbtsa49.seq
 154440094     gbtsa5.seq
 249999945     gbtsa50.seq
  77219842     gbtsa51.seq
 249999788     gbtsa52.seq
 249999066     gbtsa53.seq
 249996389     gbtsa54.seq
 249998945     gbtsa55.seq
 141892200     gbtsa56.seq
 250000009     gbtsa57.seq
 249998760     gbtsa58.seq
 249999183     gbtsa59.seq
 249997875     gbtsa6.seq
 249998062     gbtsa60.seq
 249997264     gbtsa61.seq
 249999006     gbtsa62.seq
 249999666     gbtsa63.seq
 246318645     gbtsa64.seq
 249999221     gbtsa65.seq
 249998419     gbtsa66.seq
 249998283     gbtsa67.seq
 249998268     gbtsa68.seq
 250000204     gbtsa69.seq
 249998005     gbtsa7.seq
 249998985     gbtsa70.seq
 232171452     gbtsa71.seq
 249998934     gbtsa72.seq
 249999138     gbtsa73.seq
 249998810     gbtsa74.seq
 249999063     gbtsa75.seq
 249998126     gbtsa76.seq
 249999007     gbtsa77.seq
 185899455     gbtsa78.seq
 249999580     gbtsa79.seq
 249999806     gbtsa8.seq
 249999459     gbtsa80.seq
 250000060     gbtsa81.seq
 249998829     gbtsa82.seq
 249995363     gbtsa83.seq
 111806279     gbtsa84.seq
 249997659     gbtsa85.seq
 249998620     gbtsa86.seq
 249998734     gbtsa87.seq
 249992900     gbtsa88.seq
 249999666     gbtsa89.seq
 249999617     gbtsa9.seq
  45985876     gbtsa90.seq
 249999089     gbtsa91.seq
 249999676     gbtsa92.seq
 249999794     gbtsa93.seq
 249999476     gbtsa94.seq
 249997211     gbtsa95.seq
 150721457     gbtsa96.seq
 250000251     gbtsa97.seq
 250000245     gbtsa98.seq
 249999623     gbtsa99.seq
    777300     gbuna1.seq
 250000074     gbvrl1.seq
 249998107     gbvrl10.seq
 249999858     gbvrl11.seq
 249997917     gbvrl12.seq
 250000167     gbvrl13.seq
 153559921     gbvrl14.seq
 249995949     gbvrl15.seq
 249997817     gbvrl16.seq
 249999177     gbvrl17.seq
 249992022     gbvrl18.seq
 224259860     gbvrl19.seq
 249998757     gbvrl2.seq
 249998850     gbvrl20.seq
 249999557     gbvrl21.seq
 250000246     gbvrl22.seq
 249986701     gbvrl23.seq
 142411528     gbvrl24.seq
 249997151     gbvrl25.seq
 249996003     gbvrl26.seq
 249761416     gbvrl27.seq
 249999120     gbvrl28.seq
 249997256     gbvrl29.seq
 249999198     gbvrl3.seq
  72186827     gbvrl30.seq
 249999473     gbvrl31.seq
 249996358     gbvrl32.seq
 249997934     gbvrl33.seq
 249990023     gbvrl34.seq
 249923130     gbvrl35.seq
 249998011     gbvrl36.seq
 249999712     gbvrl37.seq
 249996773     gbvrl38.seq
 243058882     gbvrl39.seq
 249996789     gbvrl4.seq
    318654     gbvrl40.seq
 249997831     gbvrl5.seq
  76509059     gbvrl6.seq
 249998076     gbvrl7.seq
 249997650     gbvrl8.seq
 249995775     gbvrl9.seq
 249935165     gbvrt1.seq
 249839255     gbvrt10.seq
 249984545     gbvrt11.seq
 139684418     gbvrt12.seq
 249971293     gbvrt13.seq
 249940578     gbvrt14.seq
 249974888     gbvrt15.seq
 249998225     gbvrt16.seq
 249999532     gbvrt17.seq
 249999658     gbvrt18.seq
  63139965     gbvrt19.seq
 249800243     gbvrt2.seq
 249953838     gbvrt20.seq
 249998268     gbvrt21.seq
 249997715     gbvrt22.seq
 249996607     gbvrt23.seq
 249998331     gbvrt24.seq
 107557106     gbvrt25.seq
 249998646     gbvrt26.seq
 249998385     gbvrt27.seq
 249997372     gbvrt28.seq
 198069048     gbvrt29.seq
 250000043     gbvrt3.seq
 249997973     gbvrt30.seq
 249997086     gbvrt31.seq
  26222432     gbvrt32.seq
 249997120     gbvrt33.seq
 179163213     gbvrt34.seq
 249997351     gbvrt35.seq
 249999809     gbvrt36.seq
 249998479     gbvrt37.seq
  17226009     gbvrt38.seq
 249998146     gbvrt39.seq
 249903030     gbvrt4.seq
 249362422     gbvrt40.seq
 242025957     gbvrt41.seq
 246326802     gbvrt42.seq
 248775425     gbvrt43.seq
 247442556     gbvrt44.seq
 249942188     gbvrt45.seq
 249975819     gbvrt46.seq
 249982425     gbvrt47.seq
  93264507     gbvrt48.seq
 249999335     gbvrt49.seq
 203890851     gbvrt5.seq
 180507423     gbvrt50.seq
 245932488     gbvrt51.seq
 227143105     gbvrt52.seq
 249608691     gbvrt53.seq
 234447524     gbvrt54.seq
 249647333     gbvrt55.seq
 249740040     gbvrt56.seq
 249797253     gbvrt57.seq
 249954226     gbvrt58.seq
 248825435     gbvrt59.seq
 249996938     gbvrt6.seq
 133684298     gbvrt60.seq
    981047     gbvrt61.seq
 249993735     gbvrt7.seq
 249836886     gbvrt8.seq
 249765487     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63763      86339311
BCT10        6837       89809592
BCT100       42         106414250
BCT101       13         27480431
BCT102       29         106059433
BCT103       23         101237478
BCT104       22         102814559
BCT105       22         103462023
BCT106       22         103153641
BCT107       23         107938593
BCT108       21         101718319
BCT109       22         104582916
BCT11        66         116102654
BCT110       31         114622354
BCT111       41         106834537
BCT112       32         88594034
BCT113       47         108832978
BCT114       60         109369965
BCT115       59         112726237
BCT116       65         111921547
BCT117       51         113750383
BCT118       43         116476498
BCT119       60         110504352
BCT12        76         117341384
BCT120       24         107989370
BCT121       39         94603674
BCT122       44         114144416
BCT123       48         114538095
BCT124       59         112456580
BCT125       41         108801913
BCT126       53         115768065
BCT127       31         108649066
BCT128       39         112161396
BCT129       59         111767735
BCT13        108        113715486
BCT130       43         110120447
BCT131       29         113361937
BCT132       39         120088968
BCT133       55         111840735
BCT134       36         71416416
BCT135       76         112890888
BCT136       41         109494759
BCT137       57         108499514
BCT138       59         112518447
BCT139       69         112192396
BCT14        65         108986169
BCT140       63         116643634
BCT141       43         107146463
BCT142       64         110590993
BCT143       43         107835222
BCT144       63         104894896
BCT145       56         109410261
BCT146       50         110015568
BCT147       60         106975782
BCT148       56         108754490
BCT149       34         104789361
BCT15        63         118388219
BCT150       46         113449495
BCT151       36         109073078
BCT152       45         108016882
BCT153       44         110724846
BCT154       42         104307992
BCT155       42         101692413
BCT156       92         103371936
BCT157       46         105755323
BCT158       40         110721028
BCT159       53         107822148
BCT16        62         122467512
BCT160       37         111685256
BCT161       40         109566226
BCT162       43         108127298
BCT163       39         108252020
BCT164       37         62042366
BCT165       56         108989907
BCT166       52         108893099
BCT167       52         107923815
BCT168       83         109940090
BCT169       50         112777284
BCT17        40         111660930
BCT170       42         108120374
BCT171       47         111757823
BCT172       14         23003658
BCT173       65         109243770
BCT174       48         107033552
BCT175       41         109143929
BCT176       46         106810486
BCT177       35         103806952
BCT178       56         105963952
BCT179       72         107407090
BCT18        78         119888421
BCT180       34         30751861
BCT181       203        89845400
BCT182       325        25743984
BCT183       1589       2511877
BCT184       3180       5275277
BCT185       6346       7804686
BCT186       12647      15075815
BCT187       25621      27729610
BCT188       50573      54086316
BCT189       75867      77889228
BCT19        16111      79294443
BCT190       71349      76814554
BCT191       10330      92167194
BCT192       5305       94797457
BCT193       3322       102667027
BCT194       126        98294245
BCT195       40         104398375
BCT196       213        102908149
BCT197       6604       95467851
BCT198       24601      93885970
BCT199       18171      17903973
BCT2         30017      97941651
BCT20        53926      85357757
BCT200       71159      73481271
BCT201       3689       102660265
BCT202       3947       100740033
BCT203       6493       97475112
BCT204       3882       98382653
BCT205       16406      101980792
BCT206       75195      79004183
BCT207       72005      78168604
BCT208       75618      78518866
BCT209       72166      77317628
BCT21        79         109838518
BCT210       72898      73866260
BCT211       12307      14258094
BCT212       71668      74618386
BCT213       72509      74330948
BCT214       69319      79392652
BCT215       46612      91665931
BCT216       3507       130192833
BCT217       1682       195464948
BCT218       2900       110376224
BCT219       1841       106460900
BCT22        143        95924047
BCT220       3063       103929035
BCT221       1572       109170208
BCT222       15545      107576359
BCT223       15021      27816108
BCT224       72         58678182
BCT23        58         112822895
BCT24        53         111392505
BCT25        46         112848420
BCT26        57         112994744
BCT27        66         108817610
BCT28        36         96325907
BCT29        40         106881287
BCT3         45         110044504
BCT30        59         107430269
BCT31        74         111675186
BCT32        55         110045255
BCT33        63         106845588
BCT34        55         109391286
BCT35        53         108650404
BCT36        46         110495229
BCT37        95         109522868
BCT38        58         106383657
BCT39        67         109486091
BCT4         58         111962594
BCT40        125        110095720
BCT41        37         71643089
BCT42        200        111474100
BCT43        54         111189650
BCT44        35         108859141
BCT45        59         107860764
BCT46        56         105257887
BCT47        45         109560296
BCT48        74         109517239
BCT49        63         108815938
BCT5         24176      103446492
BCT50        45         105399191
BCT51        59         110379618
BCT52        70         108888422
BCT53        77         109259381
BCT54        22         22714378
BCT55        67         109336234
BCT56        60         104664634
BCT57        53         102829098
BCT58        56         108908758
BCT59        58         105643854
BCT6         14142      21394515
BCT60        54         109754097
BCT61        72         109941269
BCT62        61         106056484
BCT63        62         107001009
BCT64        40         113733092
BCT65        79         111042894
BCT66        50         106161732
BCT67        54         111968009
BCT68        37         44997032
BCT69        43         109822487
BCT7         38995      83758873
BCT70        50         116699480
BCT71        66         111693041
BCT72        50         111467075
BCT73        53         109197672
BCT74        98         116077694
BCT75        73         111137910
BCT76        80         106445736
BCT77        63         114250996
BCT78        69         114803403
BCT79        45         117172941
BCT8         5507       93831194
BCT80        61         113530094
BCT81        55         114714635
BCT82        11         29093403
BCT83        48         114178839
BCT84        147        116907217
BCT85        168        115937395
BCT86        66         111220207
BCT87        290        114921020
BCT88        58         105926263
BCT89        65         107211822
BCT9         13775      85413836
BCT90        45         111430850
BCT91        61         107667593
BCT92        60         105685072
BCT93        57         116195274
BCT94        64         109473239
BCT95        42         111200780
BCT96        54         112929331
BCT97        43         107961696
BCT98        52         104667732
BCT99        54         109215555
ENV1         92505      71806797
ENV10        86245      70371092
ENV11        93067      72833368
ENV12        82356      86584530
ENV13        21842      18726397
ENV14        84745      80842333
ENV15        118344     43031201
ENV16        89133      77082595
ENV17        96415      67762965
ENV18        96033      63236957
ENV19        109652     66849527
ENV2         95987      68910853
ENV20        121935     64265767
ENV21        59519      80371247
ENV22        1973       2649603
ENV23        64099      80454489
ENV24        90245      75718963
ENV25        125172     39271464
ENV26        122790     28946863
ENV27        90467      20857408
ENV28        123097     49753756
ENV29        97825      67151499
ENV3         93909      67721834
ENV30        114992     56529461
ENV31        135873     52808489
ENV32        109154     60797853
ENV33        94469      65625480
ENV34        20088      19274861
ENV35        62536      84995133
ENV36        88888      73354471
ENV37        102539     44135473
ENV38        96736      55901636
ENV39        70995      55094538
ENV4         79919      78116162
ENV40        111235     47248815
ENV41        100826     61078728
ENV42        107056     61682203
ENV43        63686      90611811
ENV44        72549      78882430
ENV45        62024      84274740
ENV46        13535      18410041
ENV47        70513      78327836
ENV48        107794     49575233
ENV49        112480     56191431
ENV5         45043      99284712
ENV50        104691     61477580
ENV51        80589      42554978
ENV52        100603     44032874
ENV53        42860      53350430
ENV54        41971      54594945
ENV55        57501      57080603
ENV56        96516      61612734
ENV57        35088      19501136
ENV58        92149      66866589
ENV59        80780      71287048
ENV6         89354      79018986
ENV60        78507      67764835
ENV61        85923      69889803
ENV62        95787      60398951
ENV63        83247      53421906
ENV64        109676     46039173
ENV65        90195      60790075
ENV66        101130     51568649
ENV67        93845      57103958
ENV68        80622      73559256
ENV69        31855      24713170
ENV7         89355      83731454
ENV70        74036      82749776
ENV71        82852      51551337
ENV72        86187      59237579
ENV73        56858      76563126
ENV74        105364     31946931
ENV75        65538      16555539
ENV76        78377      74508027
ENV77        92324      57924315
ENV78        101708     60089843
ENV79        108878     38899299
ENV8         49227      18603958
ENV80        107909     37832596
ENV81        28783      21757376
ENV82        98918      54200894
ENV83        116351     29438776
ENV84        107844     40722907
ENV85        102195     51397361
ENV86        105660     50584235
ENV87        103399     52022521
ENV88        96551      64582642
ENV89        110        148420
ENV9         131407     31020478
EST1         159498     61801009
EST10        168027     72457010
EST100       233458     141786807
EST101       238402     125275700
EST102       190883     104629538
EST103       184966     102305345
EST104       101131     70451144
EST105       160792     120297681
EST106       174163     106396062
EST107       134720     84650800
EST108       63886      23757773
EST109       63358      22277286
EST11        169627     73879769
EST110       63850      23104651
EST111       63871      26893070
EST112       64361      22975223
EST113       64589      24557766
EST114       63579      27051032
EST115       63773      26189708
EST116       64047      27301897
EST117       63896      25162614
EST118       61257      33655518
EST119       122820     62533151
EST12        167825     70446345
EST120       160360     85610332
EST121       187678     92612209
EST122       148679     95607866
EST123       158546     93394809
EST124       131749     85719361
EST125       188285     90231910
EST126       157084     83553779
EST127       157251     84354425
EST128       156735     84849122
EST129       152166     85243481
EST13        68791      33346440
EST130       173795     93250797
EST131       183515     117052900
EST132       202840     102639788
EST133       159699     87278665
EST134       162992     83010952
EST135       142494     83648851
EST136       144801     89852751
EST137       98217      52020172
EST138       172653     97584761
EST139       244036     112746826
EST14        217461     108978814
EST140       155728     83937472
EST141       167351     92253912
EST142       151171     88672883
EST143       133038     80894924
EST144       154601     97430951
EST145       156929     86005000
EST146       124233     63247394
EST147       121184     65013976
EST148       127593     58030895
EST149       127050     51275380
EST15        169670     106000326
EST150       128457     51162754
EST151       115970     43262749
EST152       164021     82736970
EST153       176887     74089486
EST154       162720     110595936
EST155       199582     122326131
EST156       213395     121238984
EST157       175157     97093632
EST158       154463     108165104
EST159       142639     95242130
EST16        181574     113585917
EST160       155111     96479813
EST161       157933     82769553
EST162       139655     78575327
EST163       168587     93707203
EST164       69783      43386809
EST165       150728     92270715
EST166       192390     110559402
EST167       146084     84093836
EST168       142827     72419220
EST169       150267     87648644
EST17        196118     115749310
EST170       191287     104910047
EST171       156734     96079420
EST172       168073     82954959
EST173       126927     86615176
EST174       171135     100361717
EST175       173590     100469611
EST176       121335     67886296
EST177       158113     91087557
EST178       30453      17682521
EST179       170877     103282132
EST18        194428     120876978
EST180       181396     119581108
EST181       143703     116741571
EST182       194433     99359772
EST183       153314     103348882
EST184       154994     101639025
EST185       141187     81726760
EST186       176777     71787840
EST187       150843     84459489
EST188       157413     99900850
EST189       156883     96486068
EST19        157764     113162126
EST190       140871     84007763
EST191       159207     96164338
EST192       146889     94035515
EST193       131478     91560094
EST194       142716     87526263
EST195       137337     89554351
EST196       132644     93992974
EST197       163935     87296348
EST198       174728     96024221
EST199       174085     96902287
EST2         162335     61672666
EST20        189882     100191188
EST200       171959     96533852
EST201       169420     94935208
EST202       172386     95810882
EST203       174112     95379668
EST204       174590     96203166
EST205       13714      7287203
EST206       189437     105533524
EST207       205997     105137228
EST208       172529     102456415
EST209       180702     102076345
EST21        218523     107505852
EST210       202166     123332305
EST211       195697     112856439
EST212       195805     124208041
EST213       138660     93481659
EST214       215657     137366130
EST215       234912     121576607
EST216       161275     105596321
EST217       182463     100789792
EST218       202165     98900693
EST219       132731     95259554
EST22        190260     62070671
EST220       147700     87572183
EST221       210706     116133728
EST222       161782     105322117
EST223       103236     107486598
EST224       153145     103901904
EST225       159108     95528660
EST226       142959     103194768
EST227       224828     104407297
EST228       137162     100986850
EST229       122015     86673174
EST23        138910     39563203
EST230       137909     97920190
EST231       122791     87937821
EST232       143756     89675230
EST233       129921     88653546
EST234       140445     105176552
EST235       132003     93219165
EST236       124108     83980666
EST237       142782     88097503
EST238       156729     120884569
EST239       127187     119292151
EST24        102635     27788652
EST240       139414     103465004
EST241       174701     105924947
EST242       167053     103587103
EST243       154366     99270550
EST244       86825      49728025
EST245       166833     125568689
EST246       143643     106125626
EST247       155612     100205148
EST248       211958     97621163
EST249       187839     112088979
EST25        122484     51006508
EST250       153240     86290264
EST251       217806     27103152
EST252       220500     89857553
EST253       163517     120445167
EST254       175308     102741115
EST255       162357     107937169
EST256       114001     71037775
EST257       155413     113564926
EST258       185037     112314796
EST259       188989     97739197
EST26        214445     97482243
EST260       176337     110276490
EST261       162361     111841557
EST262       230852     108310770
EST263       276083     121284916
EST264       193030     115010754
EST265       187886     36313796
EST266       258549     125924733
EST267       65434      39709778
EST268       153139     97643866
EST269       166007     102205977
EST27        219438     110315416
EST270       166175     114254221
EST271       198037     102917920
EST272       156554     106611438
EST273       196091     115064683
EST274       196798     48852594
EST275       206601     42210923
EST276       181596     103281071
EST277       171083     115307779
EST278       186387     116517306
EST279       126143     72512334
EST28        190587     88628043
EST280       175329     114180121
EST281       170847     74582992
EST282       133349     83116530
EST283       130613     85387420
EST284       155200     102551061
EST285       260789     27544843
EST286       264780     24330030
EST287       148927     104663026
EST288       169548     109665839
EST289       160106     102643701
EST29        158258     69009585
EST290       155896     92347999
EST291       153059     14146575
EST292       209893     74150341
EST293       165145     107757995
EST294       177127     106903885
EST295       153868     98602066
EST296       200099     108084856
EST297       154906     111181535
EST298       166341     101026539
EST299       188022     115229514
EST3         151286     53608977
EST30        171782     69703645
EST300       178943     103012559
EST301       185809     99177906
EST302       184133     64502858
EST303       127027     45049342
EST304       183962     71376275
EST305       184618     69634960
EST306       185718     96310173
EST307       182546     131141512
EST308       145714     84793134
EST309       152909     92418323
EST31        149996     63655161
EST310       131469     100584685
EST311       161070     97315705
EST312       171234     97966080
EST313       150733     96916738
EST314       168232     95569497
EST315       160459     107363424
EST316       100907     70868221
EST317       164574     107967038
EST318       157371     108929746
EST319       178602     151136465
EST32        168734     76283434
EST320       170888     112059985
EST321       141704     75845451
EST322       144016     98183743
EST323       147115     101049725
EST324       134859     90904566
EST325       149245     99478265
EST326       149867     101255520
EST327       177662     110777931
EST328       149026     82699620
EST329       149122     85531781
EST33        175393     67759309
EST330       65949      40599126
EST331       150517     108379288
EST332       161709     97057218
EST333       143750     91467623
EST334       141804     89347190
EST335       203905     111092352
EST336       138716     75680876
EST337       91345      54429783
EST338       130354     85747840
EST339       137142     87063325
EST34        119090     41171876
EST340       125781     80489117
EST341       159076     85298695
EST342       217294     85067989
EST343       171303     87508015
EST344       106557     63651008
EST345       165373     103535447
EST346       146959     89845833
EST347       133010     88559731
EST348       136155     88631617
EST349       185830     121788971
EST35        96367      29585836
EST350       161430     97667752
EST351       153714     78014361
EST352       187982     127475040
EST353       118428     82247150
EST354       73371      44184390
EST355       136741     75241206
EST356       130580     78257086
EST357       147557     58547030
EST358       158747     32261811
EST359       43230      8856163
EST36        96775      30246187
EST360       155609     42677654
EST361       190872     120937158
EST362       238337     113678952
EST363       247502     113100236
EST364       187914     102855353
EST365       141234     91576315
EST366       136585     86831790
EST367       152970     90139577
EST368       190341     117666386
EST369       227721     63625001
EST37        95688      29021332
EST370       177663     111615477
EST371       32344      14184894
EST372       214514     117796580
EST373       204768     121579933
EST374       200947     111116537
EST375       146256     70831421
EST376       190662     120720084
EST377       168075     106289321
EST378       157830     121087673
EST379       181090     147410037
EST38        97555      29505398
EST380       157546     90357101
EST381       164166     106406941
EST382       186111     105704984
EST383       104236     59512923
EST384       205694     112538301
EST385       190899     108464033
EST386       198054     121392393
EST387       186335     122055078
EST388       203156     135506447
EST389       223060     131193275
EST39        97680      30982800
EST390       206765     135740776
EST391       203609     165973408
EST392       216432     139560743
EST393       172700     106127120
EST394       71868      42862158
EST395       188733     97351804
EST396       168762     13280006
EST397       158451     13578023
EST398       157712     27972775
EST399       158892     31896318
EST4         171412     67335226
EST40        28212      7230045
EST400       158698     32356422
EST401       148992     81887043
EST402       179190     104999807
EST403       167123     114735143
EST404       167049     97232838
EST405       156303     108411066
EST406       139823     97466623
EST407       122043     85300634
EST408       158191     98678402
EST409       159839     117106211
EST41        101354     52983819
EST410       165802     100177404
EST411       171368     55664980
EST412       168284     37922348
EST413       158666     107325527
EST414       157454     103164145
EST415       176637     114264178
EST416       137667     78868680
EST417       195825     113696660
EST418       154023     110704897
EST419       133555     91069231
EST42        119679     50944607
EST420       139889     91849262
EST421       2712       1376704
EST422       153870     92828131
EST423       171120     95860095
EST424       178837     99502055
EST425       153586     92244581
EST426       179134     108641133
EST427       152126     93152646
EST428       110538     75944646
EST429       84315      64836093
EST43        166339     91994018
EST430       99907      67137525
EST431       145383     82584502
EST432       132078     79039110
EST433       134788     85077565
EST434       138212     86686739
EST435       148439     90744946
EST436       43455      21424865
EST437       156650     86072822
EST438       198003     117469434
EST439       127085     83701120
EST44        170669     72319086
EST440       189389     101992758
EST441       182619     88037927
EST442       154350     88198510
EST443       157883     86994719
EST444       216942     126445434
EST445       179977     109502633
EST446       172244     103852328
EST447       143401     105454840
EST448       138292     88860513
EST449       47970      32817484
EST45        167823     85161641
EST450       171977     76384002
EST451       191163     85186790
EST452       207928     85698430
EST453       203167     83985588
EST454       186395     99609314
EST455       181575     107768650
EST456       190193     110731990
EST457       190636     117896520
EST458       201195     130001003
EST459       189420     88392261
EST46        168452     86860097
EST460       166055     78464668
EST461       208748     124079600
EST462       190885     117302324
EST463       174543     103294591
EST464       203831     127450740
EST465       145084     89488643
EST466       151724     109436307
EST467       163705     88522648
EST468       181467     93222895
EST469       153500     82848725
EST47        163585     87991346
EST470       150546     80862389
EST471       189903     103276378
EST472       135812     87203477
EST473       177830     102363235
EST474       172562     119032325
EST475       188405     124772315
EST476       183068     114512555
EST477       182036     102245819
EST478       171946     65520775
EST479       169461     60235829
EST48        162696     83194289
EST480       95525      38025111
EST49        160305     91341666
EST5         169495     66370457
EST50        162287     88456137
EST51        157697     99243776
EST52        159782     70009209
EST53        147287     82494200
EST54        72045      47626206
EST55        167521     70086597
EST56        165247     74991905
EST57        164952     91076377
EST58        159210     97094747
EST59        156791     102104063
EST6         172138     67169603
EST60        165073     99236289
EST61        160292     108342029
EST62        171997     80642137
EST63        173909     93376113
EST64        155448     84249033
EST65        148877     81666513
EST66        159090     98573738
EST67        131592     75053440
EST68        150067     91962686
EST69        195872     108737839
EST7         170560     73069995
EST70        181354     95121407
EST71        222270     121811794
EST72        187090     111908612
EST73        203923     120921264
EST74        164641     90824914
EST75        132422     60411972
EST76        137991     67967731
EST77        157792     97848530
EST78        157455     97725630
EST79        142839     78805143
EST8         180019     73158385
EST80        46269      21517812
EST81        164066     100492784
EST82        212712     115143723
EST83        224802     124305320
EST84        200943     94560402
EST85        212094     93365020
EST86        161354     93004234
EST87        144166     87391880
EST88        164649     81030683
EST89        158845     79982352
EST9         168970     69426169
EST90        153595     102340562
EST91        151696     88962761
EST92        131023     84787310
EST93        156093     112957041
EST94        141253     103425213
EST95        142079     101604771
EST96        141253     97651112
EST97        147722     81887569
EST98        178942     111005620
EST99        223818     135594745
GSS1         200936     87992234
GSS10        132676     60724048
GSS100       145433     114443307
GSS101       141764     116180696
GSS102       143263     116676310
GSS103       166586     128265594
GSS104       149008     82037239
GSS105       191434     120802559
GSS106       168728     112791184
GSS107       198756     116502244
GSS108       205237     134892883
GSS109       209604     138169321
GSS11        137127     73876743
GSS110       207352     140814174
GSS111       206099     142297254
GSS112       205164     143528872
GSS113       204922     143953212
GSS114       202025     146603079
GSS115       182181     139426069
GSS116       16982      10153490
GSS117       133157     84218013
GSS118       170170     80215500
GSS119       183874     79362523
GSS12        148407     75889972
GSS120       170041     148158896
GSS121       177725     120653925
GSS122       179419     145660140
GSS123       187617     120672988
GSS124       186871     139164922
GSS125       192430     127211226
GSS126       192031     93287665
GSS127       167552     156547971
GSS128       163752     114084636
GSS129       60792      36762663
GSS13        145642     69077037
GSS130       170924     155391140
GSS131       172237     154354894
GSS132       172284     155048216
GSS133       173670     154060708
GSS134       171880     154915429
GSS135       180297     138258617
GSS136       177787     146358262
GSS137       166216     119394212
GSS138       192413     95142304
GSS139       258611     44174596
GSS14        171155     85464334
GSS140       258272     39801292
GSS141       93042      14313948
GSS142       254556     58909555
GSS143       266280     53713287
GSS144       190437     88884419
GSS145       196772     64280232
GSS146       185068     146367378
GSS147       181724     149597804
GSS148       167299     154580329
GSS149       170987     157779720
GSS15        161588     98197043
GSS150       232947     77205271
GSS151       231020     76736641
GSS152       131143     60269207
GSS153       213621     54267240
GSS154       157563     97580449
GSS155       182978     113563518
GSS156       136219     87347034
GSS157       165425     130436047
GSS158       183795     161473894
GSS159       193940     159495654
GSS16        173176     87176383
GSS160       190517     125550731
GSS161       217139     138255805
GSS162       221506     132832018
GSS163       160555     98726955
GSS164       149935     86110651
GSS165       36772      28129694
GSS166       211710     157957657
GSS167       192444     102609558
GSS168       171875     67367331
GSS169       206248     159854259
GSS17        184002     114250776
GSS170       207779     162109634
GSS171       207244     163858286
GSS172       154847     116385451
GSS173       87032      63853715
GSS174       83577      62785783
GSS175       103113     48365477
GSS176       68934      58595891
GSS177       8571       7692351
GSS178       68591      57924394
GSS179       69224      56650935
GSS18        191866     113865013
GSS180       69460      56187403
GSS181       71202      55998401
GSS182       68561      51865315
GSS183       75915      58209304
GSS184       86540      74277212
GSS185       81317      44384966
GSS186       92266      45108910
GSS187       65131      48539953
GSS188       77811      61666620
GSS189       70214      59194054
GSS19        109284     49036047
GSS190       68204      63291319
GSS191       62732      52926209
GSS192       94994      42346465
GSS193       19508      4537157
GSS194       112930     70870954
GSS195       830        565879
GSS196       23226      28867035
GSS197       109084     70678875
GSS198       84403      34582519
GSS199       35904      22282147
GSS2         182739     92537598
GSS20        181328     101431612
GSS200       103304     62490220
GSS201       102329     63761256
GSS202       104240     67638632
GSS203       82127      41294650
GSS204       83102      54651503
GSS205       95565      61249467
GSS206       107362     78589335
GSS207       106444     76728833
GSS208       106101     79982459
GSS209       104001     80014803
GSS21        166554     114432569
GSS210       75801      50678132
GSS211       105097     63619915
GSS212       109868     66415305
GSS213       105969     59182678
GSS214       68062      37223883
GSS215       69097      38525198
GSS216       38174      18339130
GSS217       85817      46213833
GSS218       97756      56282806
GSS219       94838      49467300
GSS22        169442     97581438
GSS220       96276      55952494
GSS221       41313      23149851
GSS222       114055     43442995
GSS223       116422     39251295
GSS224       108546     52732132
GSS225       108722     67128647
GSS226       101583     78242094
GSS227       57005      34059998
GSS228       96897      36918766
GSS229       96399      37676586
GSS23        186616     125926468
GSS230       97739      35452830
GSS231       95145      39751140
GSS232       33820      15967145
GSS233       103939     66277823
GSS234       94551      61190929
GSS235       95128      60357048
GSS236       94773      60868501
GSS237       75675      70017159
GSS238       80658      68522367
GSS239       36895      34939652
GSS24        192673     129464876
GSS240       83736      28233267
GSS241       84219      27346468
GSS242       84926      25909272
GSS243       14851      4422302
GSS244       16547      7508221
GSS245       94100      60580478
GSS246       97403      65501702
GSS247       96166      65715907
GSS248       106376     69841317
GSS249       91708      45507881
GSS25        177867     105786766
GSS250       91214      49568095
GSS251       75915      41427331
GSS252       90839      57016024
GSS253       89674      61866093
GSS254       88534      63668650
GSS255       89290      62493340
GSS256       9699       6996370
GSS257       87995      63795538
GSS258       90590      62742076
GSS259       94937      59925372
GSS26        184546     106683191
GSS260       74696      63777273
GSS261       84391      78676825
GSS262       82881      80793634
GSS263       69452      51663438
GSS264       114900     62956729
GSS265       108980     55519998
GSS266       107208     51972208
GSS267       99627      44671760
GSS268       109459     48915853
GSS269       97817      45815705
GSS27        170198     149608841
GSS270       73084      72182459
GSS271       77066      72626452
GSS272       92139      71206302
GSS273       25095      18901203
GSS274       92250      71055526
GSS275       85869      83025280
GSS276       83675      87061685
GSS277       82362      86366324
GSS278       87240      67099066
GSS279       90053      72027971
GSS28        188951     147804604
GSS280       91819      69973376
GSS281       92878      57731227
GSS282       28501      17204721
GSS283       94787      57200301
GSS284       93517      59081345
GSS285       93900      58510429
GSS286       94714      57307691
GSS287       83843      51265303
GSS288       103666     69242174
GSS289       104299     74321241
GSS29        150158     104258657
GSS290       109373     68331863
GSS291       106994     71135784
GSS292       38781      26571815
GSS293       111314     66044649
GSS294       97521      60954564
GSS295       106950     56669731
GSS296       93049      72593618
GSS297       87513      93709205
GSS298       84142      99327596
GSS299       35869      19335436
GSS3         175733     88087457
GSS30        191200     131472175
GSS31        20998      14019707
GSS32        195376     126941784
GSS33        217735     116815872
GSS34        219656     114196497
GSS35        220809     112620867
GSS36        214074     122633657
GSS37        196391     154721890
GSS38        192939     145201406
GSS39        193487     73142088
GSS4         167433     85324699
GSS40        186630     96352725
GSS41        187082     123983791
GSS42        173605     161518142
GSS43        12207      7851285
GSS44        183230     99931003
GSS45        172378     121122494
GSS46        183257     123433974
GSS47        188859     120896483
GSS48        75964      66222022
GSS49        170045     100948017
GSS5         51061      30412071
GSS50        166240     102102664
GSS51        166431     101323646
GSS52        181635     120322752
GSS53        183662     115768061
GSS54        181040     122896955
GSS55        187709     112754833
GSS56        187356     135087760
GSS57        177426     103598407
GSS58        194388     118885545
GSS59        180323     129965882
GSS6         161937     84623154
GSS60        15051      13642852
GSS61        172962     139025327
GSS62        162250     111941733
GSS63        162289     111953917
GSS64        157258     106579075
GSS65        156862     129149769
GSS66        170500     142784855
GSS67        179008     116491862
GSS68        202194     126775279
GSS69        193437     110328172
GSS7         165838     79601885
GSS70        244818     126471946
GSS71        160611     106839677
GSS72        158809     118915346
GSS73        162712     124581605
GSS74        162679     124639510
GSS75        174512     108739947
GSS76        190714     140137565
GSS77        15486      9553301
GSS78        196624     124923488
GSS79        169518     110606100
GSS8         165838     89012366
GSS80        199150     130500908
GSS81        210477     89361250
GSS82        190560     96236753
GSS83        132952     92975029
GSS84        146002     117270599
GSS85        139785     117030641
GSS86        142881     113987623
GSS87        144229     119961312
GSS88        141769     115692271
GSS89        109453     91270460
GSS9         138238     67304387
GSS90        149553     122345018
GSS91        147788     117792665
GSS92        144115     113155638
GSS93        142979     115531478
GSS94        144339     119769367
GSS95        148217     121718869
GSS96        147793     117902839
GSS97        146200     121153918
GSS98        146261     121035223
GSS99        146701     120155849
HTC1         25047      27029900
HTC10        70844      69673892
HTC11        71635      69840927
HTC12        29409      34211569
HTC13        67517      60542416
HTC14        69053      69673151
HTC15        47464      33306362
HTC2         16071      36202003
HTC3         16014      36607191
HTC4         16234      35514380
HTC5         15960      40329026
HTC6         16042      37386456
HTC7         53542      31186695
HTC8         31530      19965253
HTC9         60703      77599470
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1440       190168820
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1591       179505523
HTG121       1587       179611588
HTG122       1580       179575648
HTG123       1598       179580959
HTG124       1603       179513131
HTG125       1542       181418287
HTG126       1163       189691579
HTG127       1091       184774502
HTG128       194        30266652
HTG129       1554       186401663
HTG13        875        191786413
HTG130       1856       177940493
HTG131       987        187833605
HTG132       1084       193226449
HTG133       1091       193148700
HTG134       581        105816839
HTG135       1031       189469892
HTG136       1055       192678789
HTG137       1163       191852916
HTG138       1080       192395749
HTG139       1084       193090210
HTG14        753        191921309
HTG140       588        103686357
HTG141       1122       192664765
HTG142       1078       192368458
HTG143       1078       192343720
HTG144       1167       191963854
HTG145       2135       191536672
HTG146       1096       192456765
HTG147       1077       192049291
HTG148       1089       192458198
HTG149       1036       190312456
HTG15        745        191963148
HTG150       1429       183097449
HTG151       1526       156462941
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93655      48152247
INV10        49252      92151228
INV100       26084      174037919
INV101       14547      181030545
INV102       44397      155376448
INV103       27112      171621394
INV104       19370      174154051
INV105       49371      138775955
INV106       29055      84543185
INV107       96245      108547326
INV108       35892      166944993
INV109       23159      177277868
INV11        2904       169680933
INV110       22654      170374262
INV111       4699       190767649
INV112       29376      152389625
INV113       55624      119361124
INV114       566        40635863
INV115       7358       190633905
INV116       51895      153104512
INV117       5607       188059543
INV118       34410      163534896
INV119       3012       16955343
INV12        82226      65555960
INV120       39813      159668855
INV121       62444      141571579
INV122       19462      30223725
INV123       104664     106635585
INV124       74577      120116541
INV125       12112      167732182
INV126       18278      163726949
INV127       13818      94808827
INV128       29262      155753563
INV129       38610      149060814
INV13        68314      56717003
INV130       51684      139700572
INV131       70877      126444377
INV132       97323      108082698
INV133       125942     86452766
INV134       33073      138745739
INV135       24212      79718699
INV136       50         64142
INV14        84556      65985296
INV15        80724      66689782
INV16        78502      66822432
INV17        49928      46911694
INV18        36850      122230889
INV19        283        149271649
INV2         59586      90205381
INV20        49892      102953608
INV21        77072      55600984
INV22        72009      61760801
INV23        395        256175
INV24        23089      127304912
INV25        6          133712559
INV26        56690      101667082
INV27        74042      50236999
INV28        70280      51055262
INV29        76802      54982096
INV3         1368       188169769
INV30        75538      57254183
INV31        76830      57149896
INV32        73286      54012005
INV33        54909      36351227
INV34        78720      56699975
INV35        74450      55199497
INV36        73853      61006594
INV37        77577      57838060
INV38        53554      35898995
INV39        77752      56576389
INV4         881        137166132
INV40        73239      50771821
INV41        75297      57337753
INV42        78095      58445488
INV43        25346      22437765
INV44        75567      48033210
INV45        73047      44523202
INV46        75229      45514223
INV47        75550      54640144
INV48        75621      51144782
INV49        70946      57645802
INV5         26400      110206361
INV50        60783      47324175
INV51        34073      143736519
INV52        20456      44318713
INV53        81470      126200327
INV54        100427     109693332
INV55        116034     96137499
INV56        101332     70787687
INV57        35239      166647152
INV58        30755      171594048
INV59        27724      170864744
INV6         79038      70496864
INV60        2593       190623823
INV61        6184       191137004
INV62        17835      180125439
INV63        15379      184771779
INV64        6837       167143853
INV65        8875       189509571
INV66        15662      184182101
INV67        30722      171526293
INV68        65600      142208408
INV69        21638      22670137
INV7         53176      95792231
INV70        50224      153584896
INV71        4095       191102716
INV72        11177      184659675
INV73        29153      168751324
INV74        3317       189349389
INV75        6330       186171285
INV76        12367      180474553
INV77        39596      157268982
INV78        60755      142074593
INV79        67983      110944176
INV8         42611      88014319
INV80        93001      114614617
INV81        56274      146052731
INV82        16688      171579078
INV83        33874      156329130
INV84        82253      117982423
INV85        24999      174542393
INV86        32599      158648520
INV87        60222      139121472
INV88        13267      12603878
INV89        41258      162193552
INV9         80252      71490414
INV90        8649       189035299
INV91        14549      181577331
INV92        5295       188760704
INV93        18509      176900436
INV94        34351      158679406
INV95        14344      172158272
INV96        23577      45955779
INV97        16795      180349455
INV98        21027      172501512
INV99        4891       191046501
MAM1         20993      154887251
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         14189      164583364
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        9          136550477
MAM26        54         7614329
MAM27        215        34073042
MAM28        431        71272130
MAM29        861        68509101
MAM3         20019      30132202
MAM30        1723       2422825
MAM31        6890       6242787
MAM32        79448      74386150
MAM33        31207      119066071
MAM34        75937      62141379
MAM35        68763      72305710
MAM36        65725      77268248
MAM37        29182      26441905
MAM4         27558      25602174
MAM5         13779      20649917
MAM6         3445       7368893
MAM7         107        700282
MAM8         19         1775631
MAM9         1          275920749
PAT1         222547     70103365
PAT10        124323     102482733
PAT100       178683     3394977
PAT101       178342     3388498
PAT102       178198     3385762
PAT103       178185     3385515
PAT104       132610     2848492
PAT105       342935     8573375
PAT106       188806     88519660
PAT107       111348     132068608
PAT108       3850       194703659
PAT109       131292     110979300
PAT11        98860      64213771
PAT110       158599     54826034
PAT111       224682     34110443
PAT112       250080     15844315
PAT113       180713     63623716
PAT114       51663      26102651
PAT115       114135     110460977
PAT116       137538     83209859
PAT117       164372     99021343
PAT118       158392     103578951
PAT119       137596     115028387
PAT12        141822     62665554
PAT120       42621      28098514
PAT121       193712     81686401
PAT122       150218     108404223
PAT123       356051     11379519
PAT124       257211     57607676
PAT125       138160     48226316
PAT126       322021     22795469
PAT127       155642     102753966
PAT128       132724     110696205
PAT129       128341     121313309
PAT13        103914     59422280
PAT130       21664      184390005
PAT131       144889     112900617
PAT132       171997     96405634
PAT133       44617      171215968
PAT134       9167       47581637
PAT135       33645      178334734
PAT136       153558     109675196
PAT137       178705     90913377
PAT138       136050     115324192
PAT139       120392     123343236
PAT14        102680     49407919
PAT140       8526       8991488
PAT141       155429     101473147
PAT142       184764     88815933
PAT143       182409     85292093
PAT144       174403     93928365
PAT145       28829      20461016
PAT146       147930     108545990
PAT147       160944     101973644
PAT148       185311     90980420
PAT149       231649     49265020
PAT15        120393     52406812
PAT150       203020     47532890
PAT151       277497     9807983
PAT152       220369     46464135
PAT153       107732     2906467
PAT154       270386     21672571
PAT155       186658     61145888
PAT156       109659     106103514
PAT157       47751      9597654
PAT158       87160      87875041
PAT159       78138      95531543
PAT16        108550     62745990
PAT160       144048     78087191
PAT161       168233     70790915
PAT162       121015     93305016
PAT163       103743     84898705
PAT164       166135     46769587
PAT165       270022     5130418
PAT166       269978     5129582
PAT167       269978     5129582
PAT168       237888     4519872
PAT169       269396     5118524
PAT17        47660      17038822
PAT170       235449     25551617
PAT171       203694     47175501
PAT172       12104      424974
PAT173       165310     74498391
PAT174       91503      126582622
PAT175       171357     72073196
PAT176       214404     66354931
PAT177       42874      49260630
PAT178       235138     59544089
PAT179       123750     125093767
PAT18        146771     52594264
PAT180       217504     66591902
PAT181       198097     84199370
PAT182       2346       5855451
PAT183       190271     85554469
PAT184       158609     102172052
PAT185       157481     102983510
PAT186       150868     102113084
PAT187       155098     102876402
PAT188       111645     117236976
PAT189       155407     75364543
PAT19        153714     78039687
PAT190       37336      37931354
PAT191       93110      87244389
PAT192       91789      79967796
PAT193       83789      91660872
PAT194       108685     54204939
PAT195       101025     56652559
PAT196       150189     24631215
PAT197       93817      82459162
PAT198       26010      162900357
PAT199       113938     65759860
PAT2         194517     84670519
PAT20        104716     118087764
PAT200       81619      28134712
PAT201       3631       191518875
PAT202       84408      78157905
PAT203       145069     26290546
PAT204       76922      99953842
PAT205       95339      71448928
PAT206       129838     31394819
PAT207       4941       7291501
PAT208       106322     62280040
PAT209       140009     12599769
PAT21        133760     95339884
PAT210       150515     23978138
PAT211       112953     46177518
PAT212       40369      57741255
PAT213       62579      50781445
PAT214       38048      62094635
PAT215       37804      63047094
PAT216       42852      57153085
PAT217       44249      60402117
PAT218       144779     52716373
PAT219       86785      129976438
PAT22        84658      79569499
PAT220       158937     78754509
PAT221       213344     47012213
PAT222       169348     66530164
PAT223       59815      8716469
PAT224       161863     78377268
PAT225       119782     100490233
PAT226       86768      128899853
PAT227       37958      167204138
PAT228       35970      168659354
PAT229       75398      138092775
PAT23        123518     103390697
PAT230       252324     29172044
PAT231       137109     91855139
PAT232       148263     82347921
PAT233       141932     74977067
PAT234       16873      11374457
PAT235       141695     86763404
PAT236       144995     93151551
PAT237       257285     12186129
PAT238       152526     4584721
PAT239       240738     21500238
PAT24        119459     105504450
PAT240       248574     11702646
PAT241       258799     3881985
PAT242       258799     3881985
PAT243       255429     5426138
PAT244       222346     30950692
PAT245       88200      38294446
PAT246       22406      36634328
PAT25        145016     86742510
PAT26        174984     64376970
PAT27        72023      1800575
PAT28        102085     77370987
PAT29        93961      87566282
PAT3         171992     95904578
PAT30        119905     61669188
PAT31        96692      78987153
PAT32        128058     54912819
PAT33        92434      51189181
PAT34        117827     69179372
PAT35        119659     35930835
PAT36        121817     44323228
PAT37        94325      86760334
PAT38        147250     22244915
PAT39        149447     31041825
PAT4         153752     106058463
PAT40        114662     49976671
PAT41        33897      46161678
PAT42        95722      83166454
PAT43        100230     70746430
PAT44        135982     39560964
PAT45        143799     35449217
PAT46        123840     64319136
PAT47        104450     81152803
PAT48        93089      74613582
PAT49        113258     66580329
PAT5         57129      23913162
PAT50        65584      54917199
PAT51        135191     107998311
PAT52        167082     97033437
PAT53        116397     127556980
PAT54        196343     76723060
PAT55        80303      127991082
PAT56        27631      180872621
PAT57        185409     93066654
PAT58        274258     6856450
PAT59        129447     31627433
PAT6         170645     91912459
PAT60        161320     77719729
PAT61        92640      89109823
PAT62        106092     74956197
PAT63        122369     64032804
PAT64        68014      30415871
PAT65        70748      109764944
PAT66        87946      82759037
PAT67        92971      78935157
PAT68        93164      72444136
PAT69        93383      75087244
PAT7         154885     88272129
PAT70        115770     60532287
PAT71        102747     9942058
PAT72        175927     10547425
PAT73        171510     10872561
PAT74        171496     10866737
PAT75        99865      86225427
PAT76        99         196466297
PAT77        67         192869889
PAT78        103        195600591
PAT79        1132       196318332
PAT8         131112     96964172
PAT80        97604      5772661
PAT81        151009     9636510
PAT82        151022     9621259
PAT83        151024     9622125
PAT84        151021     9620837
PAT85        94629      88051226
PAT86        92258      94523903
PAT87        37559      34675776
PAT88        83459      93185861
PAT89        15567      180450135
PAT9         129260     101026612
PAT90        164891     19209740
PAT91        178944     3399936
PAT92        177434     3371246
PAT93        175305     3330795
PAT94        101401     1926619
PAT95        169166     12412151
PAT96        178699     3395281
PAT97        178691     3395129
PAT98        178677     3394863
PAT99        140785     2674915
PHG1         5830       104175527
PHG2         2884       106368001
PHG3         1615       26490025
PLN1         59775      93428851
PLN10        47798      48076028
PLN100       75114      68286050
PLN101       81903      58356678
PLN102       81118      58595055
PLN103       23700      26542180
PLN104       73549      62844343
PLN105       71683      70943444
PLN106       64007      83392291
PLN107       54159      62006556
PLN108       94364      50934343
PLN109       72821      68972022
PLN11        72933      75673582
PLN110       68278      70970520
PLN111       32779      36195011
PLN112       70155      71440876
PLN113       61226      80581220
PLN114       66439      75070403
PLN115       18272      17974464
PLN116       68754      73673175
PLN117       67165      74098639
PLN118       54793      85658832
PLN119       10029      140967885
PLN12        37381      49225668
PLN120       78         193596192
PLN121       31363      121240773
PLN122       6          188365203
PLN123       8200       183588368
PLN124       42795      78861768
PLN125       254        241366
PLN13        40056      65298574
PLN14        22829      123021570
PLN15        21116      101069881
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        1473       11877350
PLN2         74523      77581825
PLN20        23259      121287391
PLN21        6071       150261554
PLN22        1195       166515226
PLN23        1459       167290703
PLN24        28         162105964
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        22088      105257552
PLN3         35429      106495977
PLN30        66871      69716232
PLN31        30199      32350212
PLN32        76679      76302865
PLN33        37943      42654624
PLN34        57312      72149903
PLN35        28690      28924739
PLN36        2644       102424140
PLN37        3          73585790
PLN38        30         105815221
PLN39        280        132295101
PLN4         1361       179328922
PLN40        98         127134784
PLN41        273        129899901
PLN42        164        128757324
PLN43        98         80521594
PLN44        154        127427415
PLN45        139        127837644
PLN46        169        128461921
PLN47        171        134719436
PLN48        154        152152879
PLN49        138        176904307
PLN5         1863       186040009
PLN50        5          182400284
PLN51        828        183102403
PLN52        1854       89453084
PLN53        7181       18795412
PLN54        14346      29953091
PLN55        18822      133834534
PLN56        77608      74511308
PLN57        96104      58984966
PLN58        35186      32463464
PLN59        80195      71463716
PLN6         1855       194208210
PLN60        77644      75717860
PLN61        80054      70156038
PLN62        81390      74770735
PLN63        59904      33895512
PLN64        98802      55127011
PLN65        82271      68261909
PLN66        44703      98688116
PLN67        5409       152787785
PLN68        11882      165587691
PLN69        29507      120346013
PLN7         1683       194253587
PLN70        54828      102789128
PLN71        16292      12284783
PLN72        80805      72357458
PLN73        17663      12939872
PLN74        49499      72634818
PLN75        25059      110563426
PLN76        13564      89752951
PLN77        1          774434471
PLN78        8082       28220443
PLN79        1723       148782682
PLN8         1853       193281978
PLN80        2          135217911
PLN81        2          155188403
PLN82        2          140023111
PLN83        2          154604167
PLN84        2          148753627
PLN85        3          173772618
PLN86        3          178836778
PLN87        3          176344173
PLN88        3          195539469
PLN89        12251      129353678
PLN9         50897      104137924
PLN90        81832      65478958
PLN91        92394      57800482
PLN92        22917      15563956
PLN93        77285      71119468
PLN94        69935      84216153
PLN95        76241      67701946
PLN96        71722      77003054
PLN97        80018      65072403
PLN98        7551       7243119
PLN99        78009      63325916
PRI1         23034      59762327
PRI10        1253       178780857
PRI11        860        104346432
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22251      144691706
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2080       192530869
PRI23        19484      80839800
PRI24        31502      84572862
PRI25        61939      78160840
PRI26        31359      70668943
PRI27        8758       172032991
PRI28        2265       191511011
PRI29        1665       190764297
PRI3         1440       174560446
PRI30        2074       192160303
PRI31        2195       191150383
PRI32        13091      162158571
PRI33        2067       170809233
PRI34        58140      87752535
PRI35        5452       11399748
PRI36        32171      63567574
PRI37        20510      119034274
PRI38        19005      150428992
PRI39        67638      85443309
PRI4         1278       185868863
PRI40        50071      89070207
PRI41        42102      84662488
PRI42        47217      95813558
PRI43        26994      100859124
PRI44        28627      109104022
PRI45        23043      105351056
PRI46        32093      98116558
PRI47        32960      114424320
PRI48        30054      82795102
PRI49        1          229594237
PRI5         1335       184501516
PRI50        1          190673448
PRI51        1          197221778
PRI52        64218      93844542
PRI53        354        9287752
PRI54        1          425
PRI6         1179       179994692
PRI7         1229       180208989
PRI8         1221       179042773
PRI9         1372       174851936
ROD1         37465      132758165
ROD10        989        182057170
ROD11        310        58597846
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15458      158988353
ROD2         908        176226773
ROD20        1358       2500688
ROD21        20403      157183388
ROD22        1220       193673930
ROD23        937        147781632
ROD24        15465      168719433
ROD25        37935      68974201
ROD26        20958      110603496
ROD27        1537       193206645
ROD28        146055     23767269
ROD29        77907      76151490
ROD3         910        173122492
ROD30        83807      53373668
ROD31        45083      51446487
ROD4         900        173812028
ROD5         920        174631636
ROD6         965        177300823
ROD7         974        179585798
ROD8         969        181410608
ROD9         1001       181599730
STS1         85259      36746905
STS10        57907      44420409
STS11        48921      37511590
STS12        57924      43637361
STS13        64057      42737497
STS14        93169      34132158
STS15        104293     26506082
STS16        10773      2917385
STS17        103700     27504029
STS18        97622      33595743
STS19        96610      34549273
STS2         84141      49927505
STS20        71022      25079548
STS3         65862      25925566
STS4         77854      37074671
STS5         9144       5361915
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55705      37758824
SYN1         52772      69985922
SYN2         44043      79768116
SYN3         22368      130002743
SYN4         4592       176439412
SYN5         4587       176341416
SYN6         4594       176342109
SYN7         12796      156927382
SYN8         22696      44101866
TSA1         119082     37788926
TSA10        18501      20932212
TSA100       76680      52659255
TSA101       66774      66687697
TSA102       63892      75957536
TSA103       86991      55453747
TSA104       51740      27880810
TSA105       74245      86358066
TSA106       80229      75622518
TSA107       84801      72305810
TSA108       77881      83686531
TSA109       94375      51986778
TSA11        134170     34616677
TSA110       99157      69089270
TSA111       59230      97228833
TSA112       109175     49378845
TSA113       63354      68310026
TSA114       80812      88891396
TSA115       70536      71912167
TSA116       57870      119426084
TSA117       5003       6824267
TSA118       106689     67779914
TSA119       93410      83369889
TSA12        59768      19488440
TSA120       98615      76609458
TSA121       88033      68056906
TSA122       84942      58892567
TSA123       77606      62175202
TSA124       82433      76719447
TSA125       98411      60355080
TSA126       94492      42586906
TSA127       76549      54458912
TSA128       42472      39761343
TSA129       59626      61176103
TSA13        64542      58862448
TSA130       59047      61657426
TSA131       59168      62167042
TSA132       71956      78379950
TSA133       87818      51643326
TSA134       63336      64766777
TSA135       2563       1147163
TSA136       77745      34626570
TSA137       74689      66831444
TSA138       81079      78598444
TSA139       74692      64675647
TSA14        91996      62507406
TSA140       41882      34789042
TSA141       87600      70235611
TSA142       89003      68194525
TSA143       84656      77065314
TSA144       76791      81310397
TSA145       12038      10028761
TSA146       104187     53670971
TSA147       81024      61412061
TSA148       69807      78230935
TSA149       73068      68063462
TSA15        87656      43266725
TSA150       87167      75197912
TSA151       89388      70083508
TSA152       62314      102850018
TSA153       95589      74200937
TSA154       20551      14359638
TSA155       83185      63773173
TSA156       83474      63810105
TSA157       78951      73455247
TSA158       76902      76048404
TSA159       93311      58445640
TSA16        76033      85960467
TSA160       100983     67726874
TSA161       35208      24154698
TSA162       103445     64539230
TSA163       94920      75734700
TSA164       80355      64233867
TSA165       30552      47121787
TSA166       51839      98295419
TSA167       46917      107683976
TSA168       44952      111436512
TSA169       42000      117073120
TSA17        79262      72721773
TSA170       39479      121890914
TSA171       37678      125330444
TSA172       30670      109097872
TSA173       78905      65671407
TSA174       61760      78088578
TSA175       65825      57454871
TSA176       40183      19203236
TSA177       38342      27295147
TSA178       35785      38621286
TSA179       34467      33162251
TSA18        86955      44650513
TSA180       31670      56857624
TSA181       31446      57845848
TSA182       39266      23134620
TSA183       40382      18182813
TSA184       41061      15174943
TSA185       41459      13408377
TSA186       41699      12346210
TSA187       26552      7560175
TSA188       41889      11506042
TSA189       41935      11303163
TSA19        73738      88497521
TSA190       41981      11096976
TSA191       42054      10770114
TSA192       42099      10570948
TSA193       42146      10365212
TSA194       41432      9801862
TSA2         112857     41270891
TSA20        66188      50392109
TSA21        81504      82323555
TSA22        64414      85965280
TSA23        87861      73038576
TSA24        99292      50126483
TSA25        55274      17668992
TSA26        85797      70106183
TSA27        120080     38852195
TSA28        135072     34043684
TSA29        52643      68388859
TSA3         109733     40830834
TSA30        47693      62711553
TSA31        2569       4361712
TSA32        60987      81840924
TSA33        92736      66826706
TSA34        109036     50277160
TSA35        106046     49573929
TSA36        101812     53917489
TSA37        104284     47753675
TSA38        25389      16338232
TSA39        66195      59263498
TSA4         110494     47448465
TSA40        92195      67722162
TSA41        92732      62207585
TSA42        79993      85992869
TSA43        99500      49867771
TSA44        113591     34204106
TSA45        95201      67568206
TSA46        13667      8496844
TSA47        94376      35380174
TSA48        77496      35938873
TSA49        106331     43405855
TSA5         78308      23625982
TSA50        113836     45499687
TSA51        29689      20438208
TSA52        105735     50140224
TSA53        100655     54491793
TSA54        94817      63356575
TSA55        83277      83596257
TSA56        63297      25469672
TSA57        90365      71288560
TSA58        97520      54422413
TSA59        60100      105474646
TSA6         111583     58975350
TSA60        86932      65069884
TSA61        78619      70637275
TSA62        83058      72217122
TSA63        82797      72052194
TSA64        68995      90904935
TSA65        90777      66753345
TSA66        75897      84474971
TSA67        71863      73184540
TSA68        68804      60806651
TSA69        84938      78092730
TSA7         87421      57901423
TSA70        85242      78226283
TSA71        70135      97561426
TSA72        85540      69665112
TSA73        84998      51586540
TSA74        102004     68493695
TSA75        87257      58729411
TSA76        103898     56923600
TSA77        73354      73067084
TSA78        79195      44938733
TSA79        87334      79220475
TSA8         104450     72517643
TSA80        91719      69206004
TSA81        78362      53147378
TSA82        78400      56954579
TSA83        97317      60069251
TSA84        38937      36173906
TSA85        88948      76782378
TSA86        95034      55397472
TSA87        110915     44811175
TSA88        97305      57964555
TSA89        65129      97030273
TSA9         109298     60842426
TSA90        15369      14817152
TSA91        101297     55494442
TSA92        91074      53960295
TSA93        93807      43529224
TSA94        85784      74014953
TSA95        73184      72093947
TSA96        39931      46731303
TSA97        77159      80203977
TSA98        77312      55431136
TSA99        84109      38689281
UNA1         333        195354
VRL1         64968      70741333
VRL10        43230      72883891
VRL11        61261      72589569
VRL12        68077      67169937
VRL13        63365      70399134
VRL14        31881      45793434
VRL15        62752      70835194
VRL16        57124      72670849
VRL17        62990      64141652
VRL18        56507      73365120
VRL19        51912      65012467
VRL2         66589      66347866
VRL20        54671      72255655
VRL21        58407      71312985
VRL22        56104      73190125
VRL23        55226      73840144
VRL24        28290      45956939
VRL25        52395      75254398
VRL26        37916      81586717
VRL27        47591      74790107
VRL28        48007      74061805
VRL29        48788      76849617
VRL3         71038      62461922
VRL30        13119      23964623
VRL31        49741      77678047
VRL32        42070      87150648
VRL33        42331      81491705
VRL34        48511      78891974
VRL35        35526      89591568
VRL36        39167      86831539
VRL37        45486      82800986
VRL38        42881      78439777
VRL39        58998      76130652
VRL4         70000      64782260
VRL40        77         73303
VRL5         68807      68232516
VRL6         16500      22316422
VRL7         47937      77150507
VRL8         46506      71646363
VRL9         43809      71163530
VRT1         67260      79156076
VRT10        1318       193270233
VRT11        8958       180815019
VRT12        3156       104226872
VRT13        13369      172269511
VRT14        5825       185082823
VRT15        3794       188790242
VRT16        49450      115634362
VRT17        79254      69263886
VRT18        77278      66383012
VRT19        20385      15111264
VRT2         1250       194149605
VRT20        71538      76445915
VRT21        44817      123146965
VRT22        77249      63296565
VRT23        79070      62196432
VRT24        81682      58049396
VRT25        35061      24098978
VRT26        102782     66115281
VRT27        81169      56376038
VRT28        85608      58035816
VRT29        62346      46927664
VRT3         51990      115336225
VRT30        90735      54067585
VRT31        75870      58082110
VRT32        7580       6394986
VRT33        74262      58570532
VRT34        52663      41691854
VRT35        80930      56650238
VRT36        74711      59737856
VRT37        94194      54064583
VRT38        8536       2975345
VRT39        110290     53141164
VRT4         21886      154452190
VRT40        50686      117478459
VRT41        44         188937391
VRT42        103        192313346
VRT43        130        193761317
VRT44        296        192673693
VRT45        591        194013929
VRT46        1882       192089736
VRT47        33970      161806577
VRT48        58738      17524994
VRT49        177067     28429798
VRT5         39308      85550832
VRT50        53955      90444098
VRT51        3136       189116987
VRT52        9          178794778
VRT53        10         196480447
VRT54        11         184541365
VRT55        28         196498040
VRT56        389        196385145
VRT57        1315       195608731
VRT58        2566       194640733
VRT59        3378       193090756
VRT6         72963      66696422
VRT60        19269      74931962
VRT61        246        212969
VRT7         31803      63626500
VRT8         30490      114267875
VRT9         1266       193359410

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 212.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

22821038 17993248772   Homo sapiens
9733677  10011515720   Mus musculus
2196891   6527594216   Rattus norvegicus
2228035   5413556756   Bos taurus
4178269   5204670077   Zea mays
3297692   4895820358   Sus scrofa
1346769   3234467279   Hordeum vulgare subsp. vulgare
1728569   3178218921   Danio rerio
62        2590569059   Ovis canadensis canadensis
1809331   1938845618   Triticum aestivum
205120    1836079918   Cyprinus carpio
744857    1744884049   Solanum lycopersicum
1373880   1640395333   Oryza sativa Japonica Group
326939    1595384171   Apteryx australis mantelli
258076    1436118209   Strongylocentrotus purpuratus
461036    1334194523   Macaca mulatta
490068    1264189828   Spirometra erinaceieuropaei
1588027   1249315555   Xenopus tropicalis
2579950   1203934161   Arabidopsis thaliana
1779943   1201581441   Nicotiana tabacum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled, as time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          February 15 2016

                NCBI-GenBank Flat File Release 212.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ04).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


   Benson DA, Clark K, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW.
   GenBank. Nucleic Acids Res. 42(Database issue):D32-7 (2014)

   DOI:  10.1093/nar/gkt1030
   PMID: 24217914

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 42(Database issue), D32-7 (2014)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 212.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Irene Fang, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, J. Bradley Holmes,
	Jonathan Kans, Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh,
	Jim Ostell, Vasuki Palanigobu, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov,
	Elena Starchenko, Hanzhen Sun, Tatiana Tatusova, Kamen Todorov,
	Eugene Yaschenko, Sergey Zhdanov, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center