Release Notes For GenBank Release 216

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2016

               NCBI-GenBank Flat File Release 216.0

                    Distribution Release Notes

 197390691 loci, 220731315250 bases, from 197390691 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 216.0
1.2 Cutoff Date
1.3 Important Changes in Release 216.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 216.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 216.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 216.0, incorporates data processed by the INSDC databases
as of Tuesday, October 11, 2016 at approximately 1:33am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 216.0

1.3.1 Organizational changes

The total number of sequence data files increased by 30 with this release:

  - the BCT division is now composed of 281 267 files (+14)
  - the CON division is now composed of 352 files (+1)
  - the INV division is now composed of 151 144 files (+7)
  - the PAT division is now composed of 268 263 files (+5)
  - the PLN division is now composed of 135 files (+1)
  - the ROD division is now composed of  30 files (-1)
  - the VRL division is now composed of  44 files (+1)
  - the VRL division is now composed of  63 files (+2)

  Note : The decrease in the number of ROD division files is due to an
on-going effort to convert legacy "segmented set" GenBank records to
a simpler gapped-sequence representation.

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 128
of the GSS flatfiles in Release 216.0. Consider gbgss174.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                         October 15 2016

                NCBI-GenBank Flat File Release 216.0

                           GSS Sequences (Part 1)

   87032 loci,    63853715 bases, from    87032 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "174" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New feature introduced : propeptide

  A new feature, propeptide, will be added to the INSDC Feature Table Document
as of October 2016. Here is a preliminary definition of the new feature:

Feature Key           propeptide

Definition            propeptide coding sequence; coding sequence for the
                      domain of a proprotein that is cleaved to form the mature protein product

Optional qualifiers   /allele="text"
                      /citation=[number]
                      /db_xref="<database>:<identifier>"
                      /experiment="[CATEGORY:]text"
                      /function="text"
                      /gene="text"
                      /gene_synonym="text"
                      /inference="[CATEGORY:]TYPE[ (same species)][:EVIDENCE_BASIS]"
                      /locus_tag="text" (single token)
                      /map="text"
                      /note="text"
                      /old_locus_tag="text" (single token)
                      /product="text"
                      /pseudo
                      /pseudogene="TYPE"
                      /standard_name="text"

  Although propeptide will technically be legal as of October, implementation
of the new feature key is likely to require several months.

1.4.2 New qualifier introduced : /recombination_class

  A new qualifier, /recombination_class, will be added to the INSDC Feature
Table Document as of October 2016, for use with the misc_recomb feature. Here
is a preliminary definition of the new qualifier:

Qualifier       /recombination_class

Definition      a structured description of the classification of recombination 
                hotspot region within a sequence

Value format    "TYPE"

Example         /recombination_class="meiotic recombination"
                /recombination_class="breakpoint_junction"

Comment         TYPE is a term taken from the INSDC controlled vocabulary for
                recombination classes. On 15-OCT-2016 the following terms
                were valid:

                meiotic_recombination
                mitotic_recombination
                non_allelic_homologous_recombination
                breakpoint_junction
                other	

  Although /recombination_class will technically be legal as of October,
implementation of the new qualifier is likely to require several months.

1.4.3 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats
      and FASTA header to be simplified

                        **NOTE**
  The removal of GI identifiers from GenBank (and RefSeq) Release and
  Update products has been postponed until March of 2017. NCBI will initially
  implement this change only in the Entrez system, in order to better gauge
  the impact that it will have on users. We expect that the Entrez change will
  take place in late October or early November of 2016.
                        **NOTE**

  As of March 15 2017, the integer sequence identifiers known as "GIs" will
no longer be included in the GenBank, GenPept, and FASTA formats for GenBank
Release and GenBank Update products. The FASTA header will be further simplified,
to report only the sequence Accession.Version for records that originate within
the International Sequence Database Collaboration (INSDC).

  As first described in the Release Notes for GenBank 199.0 in December 2013,
NCBI is in the process of moving to storage solutions which utilize only
Accession.Version identifiers. See Section 1.4.4 of these release notes for
additional background information about those developments.

  Given this shift to non-GI-based systems, the importance of using
Accession.Version identifiers cannot be overstated. As early as October 2016,
NCBI will cease displaying GI identifiers in the flatfile and FASTA views
generated within the Entrez:Nucleotide and Entrez:Protein resources. So
any web-related processes solely dependent on GIs will need to be adjusted
before that time or they will cease to work.  

  Previously-assigned GI sequence identifiers will continue to exist
'behind the scenes', and NCBI services which accept GIs as inputs will
continue to be supported. NCBI will be adding support for Accession.Version
identifiers to any services that currently do not support them. As NCBI
makes this transition, we encourage any users who have workflows that
depend on GIs to begin planning to use Accession.Version identifiers instead.

  The FASTA format will also be changed for all sequence records originating
within the INSDC, to report only the Accession.Version and the record title.
This will improve compatibility with other file types provided by NCBI and
others, including GFF3, Gene, and dbSNP download files. This FASTA format
change has already been made for the redesigned genomes FTP site based on
user requests to have a single consistent sequence identifier for both GFF3
and FASTA formats.

  At this time, we plan to continue to provide database source information in
the FASTA header/definition line for non-INSDC sources of sequence data,
including UniProt, PDB structures, PIR, and Patent sequences.

Example 1 : An INSDC nucleotide record

  In the sample record below, nucleotide sequence AF123456 was assigned a
GI of 6633795, and the protein translated from its coding region feature
was assigned a GI of 6633796 :

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2  GI:6633795
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /db_xref="GI:6633796"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  After September 15 2016, the Accession.Version will be the sole sequence
version identifier. The GI value on the VERSION line and the GI /db_xref
qualifier for the coding region feature will no longer be visible:

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

Example 2 : A GenPept record for an INSDC sequence

The current GenPept display format includes GI identifiers in the VERSION lines
(note that the coding region feature for GenPept has never included the display
of GI identifiers) :

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1  GI:6633796
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

After September 15 2016, the VERSION line will no longer include the GI value:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

Example 3: FASTA format for an INSDC nucleotide and protein sequence

The current FASTA display, for most products, includes GI and database
source information (eg, 'gb' for GenBank, 'emb' for ENA, 'dbj' for
DDBJ), using the '|' character as a delimiter:

>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE


As of September 15 2016, just the Accession.Version will be provided:

>AF123456.2 Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>AAF19666.1 doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

Please direct any inquiries about these changes to the NCBI Service Desk:

  info@ncbi.nlm.nih.gov

1.4.4 GI sequence identifiers are being phased out at NCBI

  The numeric GI sequence identifier that NCBI used to assign to all
nucleotide and protein sequences was first introduced for GenBank Release
products as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for over 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who
utilize GIs in their own information systems and analysis pipelines, so it is
being implemented gradually. Unannotated WGS projects consisting of millions
of contigs and scaffolds, and unannotated TSA projects, are the first two
classes of records for which GIs are no longer being assigned. But the practice
will ultimately expand to include other classes of records.

  If GIs are central to your operations, NCBI strongly urges that you begin
planning a switch to the use of Accession.Version identifiers instead.

  The contigs and scaffolds of the ALWZ04 WGS project are good examples of
sequences that lack GIs. Below are excerpts from the flatfile representation
of the first ALWZ04 contig, and the 'singleton scaffold' which is constructed
from it. Note the absence of a GI value on the VERSION line of these two
records:

LOCUS       ALWZ040000001           1191 bp    DNA     linear   PLN 13-MAR-2015
DEFINITION  Picea glauca, whole genome shotgun sequence.
ACCESSION   ALWZ040000001 ALWZ040000000
VERSION     ALWZ040000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
ORIGIN      
        1 ctataatacc cctatgccaa acgaacccaa ttgtaaatgt aaatgcaaat gtacttaggc
       61 tggttagttg tttaatatca ttttttgtat gcaccttcca tggtataatg cgcacatgta
      121 tagcgcacta aaattatgaa gtgtgcccat tccaagatat tgcgcgtaaa aaacttaagt
      181 gtgcatgatt ttgagactag ggagactttg tgtatatgtt gtgttttata tgctggagag
      241 acaattatta ttagttagga ggattatgtt ttgtactagg caagagagcc tagatgttaa
      301 aggctagtga gcctattttt gtatatgtct catcattaat ataatacatc attgtgtgta
....
      901 ttgttgggaa ttgatttcct gaatgtgtta aactgcattg atagggatct gagaattcct
      961 ttctggccta ttgctgaagc tttggaaggg aggtggggca accgagggac tgttgagaag
     1021 agaagggtca cacttcctgg ggtgggacaa gcatgtgggg aattagggat tgcaggatgt
     1081 tagtttgaat tggcacctat gacagagtct ttcctattgt ctgagatatg tcagcttggt
     1141 taggaaaccc tttacctggg tagagtttag tcccagctcg ggggtgaccc a
//

LOCUS       ALWZ04S0000001          1191 bp    DNA     linear   CON 13-MAR-2015
DEFINITION  Picea glauca Pg-01r141201s0000001, whole genome shotgun sequence.
ACCESSION   ALWZ04S0000001 ALWZ0400000000
VERSION     ALWZ04S0000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
CONTIG      join(ALWZ040000001.1:1..1191)
//

Sample URLs from which ALWZ04 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.*.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.*.gbff.gz

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2725 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct29.seq - Bacterial sequence entries, part 29.
205. gbbct3.seq - Bacterial sequence entries, part 3.
206. gbbct30.seq - Bacterial sequence entries, part 30.
207. gbbct31.seq - Bacterial sequence entries, part 31.
208. gbbct32.seq - Bacterial sequence entries, part 32.
209. gbbct33.seq - Bacterial sequence entries, part 33.
210. gbbct34.seq - Bacterial sequence entries, part 34.
211. gbbct35.seq - Bacterial sequence entries, part 35.
212. gbbct36.seq - Bacterial sequence entries, part 36.
213. gbbct37.seq - Bacterial sequence entries, part 37.
214. gbbct38.seq - Bacterial sequence entries, part 38.
215. gbbct39.seq - Bacterial sequence entries, part 39.
216. gbbct4.seq - Bacterial sequence entries, part 4.
217. gbbct40.seq - Bacterial sequence entries, part 40.
218. gbbct41.seq - Bacterial sequence entries, part 41.
219. gbbct42.seq - Bacterial sequence entries, part 42.
220. gbbct43.seq - Bacterial sequence entries, part 43.
221. gbbct44.seq - Bacterial sequence entries, part 44.
222. gbbct45.seq - Bacterial sequence entries, part 45.
223. gbbct46.seq - Bacterial sequence entries, part 46.
224. gbbct47.seq - Bacterial sequence entries, part 47.
225. gbbct48.seq - Bacterial sequence entries, part 48.
226. gbbct49.seq - Bacterial sequence entries, part 49.
227. gbbct5.seq - Bacterial sequence entries, part 5.
228. gbbct50.seq - Bacterial sequence entries, part 50.
229. gbbct51.seq - Bacterial sequence entries, part 51.
230. gbbct52.seq - Bacterial sequence entries, part 52.
231. gbbct53.seq - Bacterial sequence entries, part 53.
232. gbbct54.seq - Bacterial sequence entries, part 54.
233. gbbct55.seq - Bacterial sequence entries, part 55.
234. gbbct56.seq - Bacterial sequence entries, part 56.
235. gbbct57.seq - Bacterial sequence entries, part 57.
236. gbbct58.seq - Bacterial sequence entries, part 58.
237. gbbct59.seq - Bacterial sequence entries, part 59.
238. gbbct6.seq - Bacterial sequence entries, part 6.
239. gbbct60.seq - Bacterial sequence entries, part 60.
240. gbbct61.seq - Bacterial sequence entries, part 61.
241. gbbct62.seq - Bacterial sequence entries, part 62.
242. gbbct63.seq - Bacterial sequence entries, part 63.
243. gbbct64.seq - Bacterial sequence entries, part 64.
244. gbbct65.seq - Bacterial sequence entries, part 65.
245. gbbct66.seq - Bacterial sequence entries, part 66.
246. gbbct67.seq - Bacterial sequence entries, part 67.
247. gbbct68.seq - Bacterial sequence entries, part 68.
248. gbbct69.seq - Bacterial sequence entries, part 69.
249. gbbct7.seq - Bacterial sequence entries, part 7.
250. gbbct70.seq - Bacterial sequence entries, part 70.
251. gbbct71.seq - Bacterial sequence entries, part 71.
252. gbbct72.seq - Bacterial sequence entries, part 72.
253. gbbct73.seq - Bacterial sequence entries, part 73.
254. gbbct74.seq - Bacterial sequence entries, part 74.
255. gbbct75.seq - Bacterial sequence entries, part 75.
256. gbbct76.seq - Bacterial sequence entries, part 76.
257. gbbct77.seq - Bacterial sequence entries, part 77.
258. gbbct78.seq - Bacterial sequence entries, part 78.
259. gbbct79.seq - Bacterial sequence entries, part 79.
260. gbbct8.seq - Bacterial sequence entries, part 8.
261. gbbct80.seq - Bacterial sequence entries, part 80.
262. gbbct81.seq - Bacterial sequence entries, part 81.
263. gbbct82.seq - Bacterial sequence entries, part 82.
264. gbbct83.seq - Bacterial sequence entries, part 83.
265. gbbct84.seq - Bacterial sequence entries, part 84.
266. gbbct85.seq - Bacterial sequence entries, part 85.
267. gbbct86.seq - Bacterial sequence entries, part 86.
268. gbbct87.seq - Bacterial sequence entries, part 87.
269. gbbct88.seq - Bacterial sequence entries, part 88.
270. gbbct89.seq - Bacterial sequence entries, part 89.
271. gbbct9.seq - Bacterial sequence entries, part 9.
272. gbbct90.seq - Bacterial sequence entries, part 90.
273. gbbct91.seq - Bacterial sequence entries, part 91.
274. gbbct92.seq - Bacterial sequence entries, part 92.
275. gbbct93.seq - Bacterial sequence entries, part 93.
276. gbbct94.seq - Bacterial sequence entries, part 94.
277. gbbct95.seq - Bacterial sequence entries, part 95.
278. gbbct96.seq - Bacterial sequence entries, part 96.
279. gbbct97.seq - Bacterial sequence entries, part 97.
280. gbbct98.seq - Bacterial sequence entries, part 98.
281. gbbct99.seq - Bacterial sequence entries, part 99.
282. gbchg.txt - Accession numbers of entries updated since the previous release.
283. gbcon1.seq - Constructed sequence entries, part 1.
284. gbcon10.seq - Constructed sequence entries, part 10.
285. gbcon100.seq - Constructed sequence entries, part 100.
286. gbcon101.seq - Constructed sequence entries, part 101.
287. gbcon102.seq - Constructed sequence entries, part 102.
288. gbcon103.seq - Constructed sequence entries, part 103.
289. gbcon104.seq - Constructed sequence entries, part 104.
290. gbcon105.seq - Constructed sequence entries, part 105.
291. gbcon106.seq - Constructed sequence entries, part 106.
292. gbcon107.seq - Constructed sequence entries, part 107.
293. gbcon108.seq - Constructed sequence entries, part 108.
294. gbcon109.seq - Constructed sequence entries, part 109.
295. gbcon11.seq - Constructed sequence entries, part 11.
296. gbcon110.seq - Constructed sequence entries, part 110.
297. gbcon111.seq - Constructed sequence entries, part 111.
298. gbcon112.seq - Constructed sequence entries, part 112.
299. gbcon113.seq - Constructed sequence entries, part 113.
300. gbcon114.seq - Constructed sequence entries, part 114.
301. gbcon115.seq - Constructed sequence entries, part 115.
302. gbcon116.seq - Constructed sequence entries, part 116.
303. gbcon117.seq - Constructed sequence entries, part 117.
304. gbcon118.seq - Constructed sequence entries, part 118.
305. gbcon119.seq - Constructed sequence entries, part 119.
306. gbcon12.seq - Constructed sequence entries, part 12.
307. gbcon120.seq - Constructed sequence entries, part 120.
308. gbcon121.seq - Constructed sequence entries, part 121.
309. gbcon122.seq - Constructed sequence entries, part 122.
310. gbcon123.seq - Constructed sequence entries, part 123.
311. gbcon124.seq - Constructed sequence entries, part 124.
312. gbcon125.seq - Constructed sequence entries, part 125.
313. gbcon126.seq - Constructed sequence entries, part 126.
314. gbcon127.seq - Constructed sequence entries, part 127.
315. gbcon128.seq - Constructed sequence entries, part 128.
316. gbcon129.seq - Constructed sequence entries, part 129.
317. gbcon13.seq - Constructed sequence entries, part 13.
318. gbcon130.seq - Constructed sequence entries, part 130.
319. gbcon131.seq - Constructed sequence entries, part 131.
320. gbcon132.seq - Constructed sequence entries, part 132.
321. gbcon133.seq - Constructed sequence entries, part 133.
322. gbcon134.seq - Constructed sequence entries, part 134.
323. gbcon135.seq - Constructed sequence entries, part 135.
324. gbcon136.seq - Constructed sequence entries, part 136.
325. gbcon137.seq - Constructed sequence entries, part 137.
326. gbcon138.seq - Constructed sequence entries, part 138.
327. gbcon139.seq - Constructed sequence entries, part 139.
328. gbcon14.seq - Constructed sequence entries, part 14.
329. gbcon140.seq - Constructed sequence entries, part 140.
330. gbcon141.seq - Constructed sequence entries, part 141.
331. gbcon142.seq - Constructed sequence entries, part 142.
332. gbcon143.seq - Constructed sequence entries, part 143.
333. gbcon144.seq - Constructed sequence entries, part 144.
334. gbcon145.seq - Constructed sequence entries, part 145.
335. gbcon146.seq - Constructed sequence entries, part 146.
336. gbcon147.seq - Constructed sequence entries, part 147.
337. gbcon148.seq - Constructed sequence entries, part 148.
338. gbcon149.seq - Constructed sequence entries, part 149.
339. gbcon15.seq - Constructed sequence entries, part 15.
340. gbcon150.seq - Constructed sequence entries, part 150.
341. gbcon151.seq - Constructed sequence entries, part 151.
342. gbcon152.seq - Constructed sequence entries, part 152.
343. gbcon153.seq - Constructed sequence entries, part 153.
344. gbcon154.seq - Constructed sequence entries, part 154.
345. gbcon155.seq - Constructed sequence entries, part 155.
346. gbcon156.seq - Constructed sequence entries, part 156.
347. gbcon157.seq - Constructed sequence entries, part 157.
348. gbcon158.seq - Constructed sequence entries, part 158.
349. gbcon159.seq - Constructed sequence entries, part 159.
350. gbcon16.seq - Constructed sequence entries, part 16.
351. gbcon160.seq - Constructed sequence entries, part 160.
352. gbcon161.seq - Constructed sequence entries, part 161.
353. gbcon162.seq - Constructed sequence entries, part 162.
354. gbcon163.seq - Constructed sequence entries, part 163.
355. gbcon164.seq - Constructed sequence entries, part 164.
356. gbcon165.seq - Constructed sequence entries, part 165.
357. gbcon166.seq - Constructed sequence entries, part 166.
358. gbcon167.seq - Constructed sequence entries, part 167.
359. gbcon168.seq - Constructed sequence entries, part 168.
360. gbcon169.seq - Constructed sequence entries, part 169.
361. gbcon17.seq - Constructed sequence entries, part 17.
362. gbcon170.seq - Constructed sequence entries, part 170.
363. gbcon171.seq - Constructed sequence entries, part 171.
364. gbcon172.seq - Constructed sequence entries, part 172.
365. gbcon173.seq - Constructed sequence entries, part 173.
366. gbcon174.seq - Constructed sequence entries, part 174.
367. gbcon175.seq - Constructed sequence entries, part 175.
368. gbcon176.seq - Constructed sequence entries, part 176.
369. gbcon177.seq - Constructed sequence entries, part 177.
370. gbcon178.seq - Constructed sequence entries, part 178.
371. gbcon179.seq - Constructed sequence entries, part 179.
372. gbcon18.seq - Constructed sequence entries, part 18.
373. gbcon180.seq - Constructed sequence entries, part 180.
374. gbcon181.seq - Constructed sequence entries, part 181.
375. gbcon182.seq - Constructed sequence entries, part 182.
376. gbcon183.seq - Constructed sequence entries, part 183.
377. gbcon184.seq - Constructed sequence entries, part 184.
378. gbcon185.seq - Constructed sequence entries, part 185.
379. gbcon186.seq - Constructed sequence entries, part 186.
380. gbcon187.seq - Constructed sequence entries, part 187.
381. gbcon188.seq - Constructed sequence entries, part 188.
382. gbcon189.seq - Constructed sequence entries, part 189.
383. gbcon19.seq - Constructed sequence entries, part 19.
384. gbcon190.seq - Constructed sequence entries, part 190.
385. gbcon191.seq - Constructed sequence entries, part 191.
386. gbcon192.seq - Constructed sequence entries, part 192.
387. gbcon193.seq - Constructed sequence entries, part 193.
388. gbcon194.seq - Constructed sequence entries, part 194.
389. gbcon195.seq - Constructed sequence entries, part 195.
390. gbcon196.seq - Constructed sequence entries, part 196.
391. gbcon197.seq - Constructed sequence entries, part 197.
392. gbcon198.seq - Constructed sequence entries, part 198.
393. gbcon199.seq - Constructed sequence entries, part 199.
394. gbcon2.seq - Constructed sequence entries, part 2.
395. gbcon20.seq - Constructed sequence entries, part 20.
396. gbcon200.seq - Constructed sequence entries, part 200.
397. gbcon201.seq - Constructed sequence entries, part 201.
398. gbcon202.seq - Constructed sequence entries, part 202.
399. gbcon203.seq - Constructed sequence entries, part 203.
400. gbcon204.seq - Constructed sequence entries, part 204.
401. gbcon205.seq - Constructed sequence entries, part 205.
402. gbcon206.seq - Constructed sequence entries, part 206.
403. gbcon207.seq - Constructed sequence entries, part 207.
404. gbcon208.seq - Constructed sequence entries, part 208.
405. gbcon209.seq - Constructed sequence entries, part 209.
406. gbcon21.seq - Constructed sequence entries, part 21.
407. gbcon210.seq - Constructed sequence entries, part 210.
408. gbcon211.seq - Constructed sequence entries, part 211.
409. gbcon212.seq - Constructed sequence entries, part 212.
410. gbcon213.seq - Constructed sequence entries, part 213.
411. gbcon214.seq - Constructed sequence entries, part 214.
412. gbcon215.seq - Constructed sequence entries, part 215.
413. gbcon216.seq - Constructed sequence entries, part 216.
414. gbcon217.seq - Constructed sequence entries, part 217.
415. gbcon218.seq - Constructed sequence entries, part 218.
416. gbcon219.seq - Constructed sequence entries, part 219.
417. gbcon22.seq - Constructed sequence entries, part 22.
418. gbcon220.seq - Constructed sequence entries, part 220.
419. gbcon221.seq - Constructed sequence entries, part 221.
420. gbcon222.seq - Constructed sequence entries, part 222.
421. gbcon223.seq - Constructed sequence entries, part 223.
422. gbcon224.seq - Constructed sequence entries, part 224.
423. gbcon225.seq - Constructed sequence entries, part 225.
424. gbcon226.seq - Constructed sequence entries, part 226.
425. gbcon227.seq - Constructed sequence entries, part 227.
426. gbcon228.seq - Constructed sequence entries, part 228.
427. gbcon229.seq - Constructed sequence entries, part 229.
428. gbcon23.seq - Constructed sequence entries, part 23.
429. gbcon230.seq - Constructed sequence entries, part 230.
430. gbcon231.seq - Constructed sequence entries, part 231.
431. gbcon232.seq - Constructed sequence entries, part 232.
432. gbcon233.seq - Constructed sequence entries, part 233.
433. gbcon234.seq - Constructed sequence entries, part 234.
434. gbcon235.seq - Constructed sequence entries, part 235.
435. gbcon236.seq - Constructed sequence entries, part 236.
436. gbcon237.seq - Constructed sequence entries, part 237.
437. gbcon238.seq - Constructed sequence entries, part 238.
438. gbcon239.seq - Constructed sequence entries, part 239.
439. gbcon24.seq - Constructed sequence entries, part 24.
440. gbcon240.seq - Constructed sequence entries, part 240.
441. gbcon241.seq - Constructed sequence entries, part 241.
442. gbcon242.seq - Constructed sequence entries, part 242.
443. gbcon243.seq - Constructed sequence entries, part 243.
444. gbcon244.seq - Constructed sequence entries, part 244.
445. gbcon245.seq - Constructed sequence entries, part 245.
446. gbcon246.seq - Constructed sequence entries, part 246.
447. gbcon247.seq - Constructed sequence entries, part 247.
448. gbcon248.seq - Constructed sequence entries, part 248.
449. gbcon249.seq - Constructed sequence entries, part 249.
450. gbcon25.seq - Constructed sequence entries, part 25.
451. gbcon250.seq - Constructed sequence entries, part 250.
452. gbcon251.seq - Constructed sequence entries, part 251.
453. gbcon252.seq - Constructed sequence entries, part 252.
454. gbcon253.seq - Constructed sequence entries, part 253.
455. gbcon254.seq - Constructed sequence entries, part 254.
456. gbcon255.seq - Constructed sequence entries, part 255.
457. gbcon256.seq - Constructed sequence entries, part 256.
458. gbcon257.seq - Constructed sequence entries, part 257.
459. gbcon258.seq - Constructed sequence entries, part 258.
460. gbcon259.seq - Constructed sequence entries, part 259.
461. gbcon26.seq - Constructed sequence entries, part 26.
462. gbcon260.seq - Constructed sequence entries, part 260.
463. gbcon261.seq - Constructed sequence entries, part 261.
464. gbcon262.seq - Constructed sequence entries, part 262.
465. gbcon263.seq - Constructed sequence entries, part 263.
466. gbcon264.seq - Constructed sequence entries, part 264.
467. gbcon265.seq - Constructed sequence entries, part 265.
468. gbcon266.seq - Constructed sequence entries, part 266.
469. gbcon267.seq - Constructed sequence entries, part 267.
470. gbcon268.seq - Constructed sequence entries, part 268.
471. gbcon269.seq - Constructed sequence entries, part 269.
472. gbcon27.seq - Constructed sequence entries, part 27.
473. gbcon270.seq - Constructed sequence entries, part 270.
474. gbcon271.seq - Constructed sequence entries, part 271.
475. gbcon272.seq - Constructed sequence entries, part 272.
476. gbcon273.seq - Constructed sequence entries, part 273.
477. gbcon274.seq - Constructed sequence entries, part 274.
478. gbcon275.seq - Constructed sequence entries, part 275.
479. gbcon276.seq - Constructed sequence entries, part 276.
480. gbcon277.seq - Constructed sequence entries, part 277.
481. gbcon278.seq - Constructed sequence entries, part 278.
482. gbcon279.seq - Constructed sequence entries, part 279.
483. gbcon28.seq - Constructed sequence entries, part 28.
484. gbcon280.seq - Constructed sequence entries, part 280.
485. gbcon281.seq - Constructed sequence entries, part 281.
486. gbcon282.seq - Constructed sequence entries, part 282.
487. gbcon283.seq - Constructed sequence entries, part 283.
488. gbcon284.seq - Constructed sequence entries, part 284.
489. gbcon285.seq - Constructed sequence entries, part 285.
490. gbcon286.seq - Constructed sequence entries, part 286.
491. gbcon287.seq - Constructed sequence entries, part 287.
492. gbcon288.seq - Constructed sequence entries, part 288.
493. gbcon289.seq - Constructed sequence entries, part 289.
494. gbcon29.seq - Constructed sequence entries, part 29.
495. gbcon290.seq - Constructed sequence entries, part 290.
496. gbcon291.seq - Constructed sequence entries, part 291.
497. gbcon292.seq - Constructed sequence entries, part 292.
498. gbcon293.seq - Constructed sequence entries, part 293.
499. gbcon294.seq - Constructed sequence entries, part 294.
500. gbcon295.seq - Constructed sequence entries, part 295.
501. gbcon296.seq - Constructed sequence entries, part 296.
502. gbcon297.seq - Constructed sequence entries, part 297.
503. gbcon298.seq - Constructed sequence entries, part 298.
504. gbcon299.seq - Constructed sequence entries, part 299.
505. gbcon3.seq - Constructed sequence entries, part 3.
506. gbcon30.seq - Constructed sequence entries, part 30.
507. gbcon300.seq - Constructed sequence entries, part 300.
508. gbcon301.seq - Constructed sequence entries, part 301.
509. gbcon302.seq - Constructed sequence entries, part 302.
510. gbcon303.seq - Constructed sequence entries, part 303.
511. gbcon304.seq - Constructed sequence entries, part 304.
512. gbcon305.seq - Constructed sequence entries, part 305.
513. gbcon306.seq - Constructed sequence entries, part 306.
514. gbcon307.seq - Constructed sequence entries, part 307.
515. gbcon308.seq - Constructed sequence entries, part 308.
516. gbcon309.seq - Constructed sequence entries, part 309.
517. gbcon31.seq - Constructed sequence entries, part 31.
518. gbcon310.seq - Constructed sequence entries, part 310.
519. gbcon311.seq - Constructed sequence entries, part 311.
520. gbcon312.seq - Constructed sequence entries, part 312.
521. gbcon313.seq - Constructed sequence entries, part 313.
522. gbcon314.seq - Constructed sequence entries, part 314.
523. gbcon315.seq - Constructed sequence entries, part 315.
524. gbcon316.seq - Constructed sequence entries, part 316.
525. gbcon317.seq - Constructed sequence entries, part 317.
526. gbcon318.seq - Constructed sequence entries, part 318.
527. gbcon319.seq - Constructed sequence entries, part 319.
528. gbcon32.seq - Constructed sequence entries, part 32.
529. gbcon320.seq - Constructed sequence entries, part 320.
530. gbcon321.seq - Constructed sequence entries, part 321.
531. gbcon322.seq - Constructed sequence entries, part 322.
532. gbcon323.seq - Constructed sequence entries, part 323.
533. gbcon324.seq - Constructed sequence entries, part 324.
534. gbcon325.seq - Constructed sequence entries, part 325.
535. gbcon326.seq - Constructed sequence entries, part 326.
536. gbcon327.seq - Constructed sequence entries, part 327.
537. gbcon328.seq - Constructed sequence entries, part 328.
538. gbcon329.seq - Constructed sequence entries, part 329.
539. gbcon33.seq - Constructed sequence entries, part 33.
540. gbcon330.seq - Constructed sequence entries, part 330.
541. gbcon331.seq - Constructed sequence entries, part 331.
542. gbcon332.seq - Constructed sequence entries, part 332.
543. gbcon333.seq - Constructed sequence entries, part 333.
544. gbcon334.seq - Constructed sequence entries, part 334.
545. gbcon335.seq - Constructed sequence entries, part 335.
546. gbcon336.seq - Constructed sequence entries, part 336.
547. gbcon337.seq - Constructed sequence entries, part 337.
548. gbcon338.seq - Constructed sequence entries, part 338.
549. gbcon339.seq - Constructed sequence entries, part 339.
550. gbcon34.seq - Constructed sequence entries, part 34.
551. gbcon340.seq - Constructed sequence entries, part 340.
552. gbcon341.seq - Constructed sequence entries, part 341.
553. gbcon342.seq - Constructed sequence entries, part 342.
554. gbcon343.seq - Constructed sequence entries, part 343.
555. gbcon344.seq - Constructed sequence entries, part 344.
556. gbcon345.seq - Constructed sequence entries, part 345.
557. gbcon346.seq - Constructed sequence entries, part 346.
558. gbcon347.seq - Constructed sequence entries, part 347.
559. gbcon348.seq - Constructed sequence entries, part 348.
560. gbcon349.seq - Constructed sequence entries, part 349.
561. gbcon35.seq - Constructed sequence entries, part 35.
562. gbcon350.seq - Constructed sequence entries, part 350.
563. gbcon351.seq - Constructed sequence entries, part 351.
564. gbcon352.seq - Constructed sequence entries, part 352.
565. gbcon36.seq - Constructed sequence entries, part 36.
566. gbcon37.seq - Constructed sequence entries, part 37.
567. gbcon38.seq - Constructed sequence entries, part 38.
568. gbcon39.seq - Constructed sequence entries, part 39.
569. gbcon4.seq - Constructed sequence entries, part 4.
570. gbcon40.seq - Constructed sequence entries, part 40.
571. gbcon41.seq - Constructed sequence entries, part 41.
572. gbcon42.seq - Constructed sequence entries, part 42.
573. gbcon43.seq - Constructed sequence entries, part 43.
574. gbcon44.seq - Constructed sequence entries, part 44.
575. gbcon45.seq - Constructed sequence entries, part 45.
576. gbcon46.seq - Constructed sequence entries, part 46.
577. gbcon47.seq - Constructed sequence entries, part 47.
578. gbcon48.seq - Constructed sequence entries, part 48.
579. gbcon49.seq - Constructed sequence entries, part 49.
580. gbcon5.seq - Constructed sequence entries, part 5.
581. gbcon50.seq - Constructed sequence entries, part 50.
582. gbcon51.seq - Constructed sequence entries, part 51.
583. gbcon52.seq - Constructed sequence entries, part 52.
584. gbcon53.seq - Constructed sequence entries, part 53.
585. gbcon54.seq - Constructed sequence entries, part 54.
586. gbcon55.seq - Constructed sequence entries, part 55.
587. gbcon56.seq - Constructed sequence entries, part 56.
588. gbcon57.seq - Constructed sequence entries, part 57.
589. gbcon58.seq - Constructed sequence entries, part 58.
590. gbcon59.seq - Constructed sequence entries, part 59.
591. gbcon6.seq - Constructed sequence entries, part 6.
592. gbcon60.seq - Constructed sequence entries, part 60.
593. gbcon61.seq - Constructed sequence entries, part 61.
594. gbcon62.seq - Constructed sequence entries, part 62.
595. gbcon63.seq - Constructed sequence entries, part 63.
596. gbcon64.seq - Constructed sequence entries, part 64.
597. gbcon65.seq - Constructed sequence entries, part 65.
598. gbcon66.seq - Constructed sequence entries, part 66.
599. gbcon67.seq - Constructed sequence entries, part 67.
600. gbcon68.seq - Constructed sequence entries, part 68.
601. gbcon69.seq - Constructed sequence entries, part 69.
602. gbcon7.seq - Constructed sequence entries, part 7.
603. gbcon70.seq - Constructed sequence entries, part 70.
604. gbcon71.seq - Constructed sequence entries, part 71.
605. gbcon72.seq - Constructed sequence entries, part 72.
606. gbcon73.seq - Constructed sequence entries, part 73.
607. gbcon74.seq - Constructed sequence entries, part 74.
608. gbcon75.seq - Constructed sequence entries, part 75.
609. gbcon76.seq - Constructed sequence entries, part 76.
610. gbcon77.seq - Constructed sequence entries, part 77.
611. gbcon78.seq - Constructed sequence entries, part 78.
612. gbcon79.seq - Constructed sequence entries, part 79.
613. gbcon8.seq - Constructed sequence entries, part 8.
614. gbcon80.seq - Constructed sequence entries, part 80.
615. gbcon81.seq - Constructed sequence entries, part 81.
616. gbcon82.seq - Constructed sequence entries, part 82.
617. gbcon83.seq - Constructed sequence entries, part 83.
618. gbcon84.seq - Constructed sequence entries, part 84.
619. gbcon85.seq - Constructed sequence entries, part 85.
620. gbcon86.seq - Constructed sequence entries, part 86.
621. gbcon87.seq - Constructed sequence entries, part 87.
622. gbcon88.seq - Constructed sequence entries, part 88.
623. gbcon89.seq - Constructed sequence entries, part 89.
624. gbcon9.seq - Constructed sequence entries, part 9.
625. gbcon90.seq - Constructed sequence entries, part 90.
626. gbcon91.seq - Constructed sequence entries, part 91.
627. gbcon92.seq - Constructed sequence entries, part 92.
628. gbcon93.seq - Constructed sequence entries, part 93.
629. gbcon94.seq - Constructed sequence entries, part 94.
630. gbcon95.seq - Constructed sequence entries, part 95.
631. gbcon96.seq - Constructed sequence entries, part 96.
632. gbcon97.seq - Constructed sequence entries, part 97.
633. gbcon98.seq - Constructed sequence entries, part 98.
634. gbcon99.seq - Constructed sequence entries, part 99.
635. gbdel.txt - Accession numbers of entries deleted since the previous release.
636. gbenv1.seq - Environmental sampling sequence entries, part 1.
637. gbenv10.seq - Environmental sampling sequence entries, part 10.
638. gbenv11.seq - Environmental sampling sequence entries, part 11.
639. gbenv12.seq - Environmental sampling sequence entries, part 12.
640. gbenv13.seq - Environmental sampling sequence entries, part 13.
641. gbenv14.seq - Environmental sampling sequence entries, part 14.
642. gbenv15.seq - Environmental sampling sequence entries, part 15.
643. gbenv16.seq - Environmental sampling sequence entries, part 16.
644. gbenv17.seq - Environmental sampling sequence entries, part 17.
645. gbenv18.seq - Environmental sampling sequence entries, part 18.
646. gbenv19.seq - Environmental sampling sequence entries, part 19.
647. gbenv2.seq - Environmental sampling sequence entries, part 2.
648. gbenv20.seq - Environmental sampling sequence entries, part 20.
649. gbenv21.seq - Environmental sampling sequence entries, part 21.
650. gbenv22.seq - Environmental sampling sequence entries, part 22.
651. gbenv23.seq - Environmental sampling sequence entries, part 23.
652. gbenv24.seq - Environmental sampling sequence entries, part 24.
653. gbenv25.seq - Environmental sampling sequence entries, part 25.
654. gbenv26.seq - Environmental sampling sequence entries, part 26.
655. gbenv27.seq - Environmental sampling sequence entries, part 27.
656. gbenv28.seq - Environmental sampling sequence entries, part 28.
657. gbenv29.seq - Environmental sampling sequence entries, part 29.
658. gbenv3.seq - Environmental sampling sequence entries, part 3.
659. gbenv30.seq - Environmental sampling sequence entries, part 30.
660. gbenv31.seq - Environmental sampling sequence entries, part 31.
661. gbenv32.seq - Environmental sampling sequence entries, part 32.
662. gbenv33.seq - Environmental sampling sequence entries, part 33.
663. gbenv34.seq - Environmental sampling sequence entries, part 34.
664. gbenv35.seq - Environmental sampling sequence entries, part 35.
665. gbenv36.seq - Environmental sampling sequence entries, part 36.
666. gbenv37.seq - Environmental sampling sequence entries, part 37.
667. gbenv38.seq - Environmental sampling sequence entries, part 38.
668. gbenv39.seq - Environmental sampling sequence entries, part 39.
669. gbenv4.seq - Environmental sampling sequence entries, part 4.
670. gbenv40.seq - Environmental sampling sequence entries, part 40.
671. gbenv41.seq - Environmental sampling sequence entries, part 41.
672. gbenv42.seq - Environmental sampling sequence entries, part 42.
673. gbenv43.seq - Environmental sampling sequence entries, part 43.
674. gbenv44.seq - Environmental sampling sequence entries, part 44.
675. gbenv45.seq - Environmental sampling sequence entries, part 45.
676. gbenv46.seq - Environmental sampling sequence entries, part 46.
677. gbenv47.seq - Environmental sampling sequence entries, part 47.
678. gbenv48.seq - Environmental sampling sequence entries, part 48.
679. gbenv49.seq - Environmental sampling sequence entries, part 49.
680. gbenv5.seq - Environmental sampling sequence entries, part 5.
681. gbenv50.seq - Environmental sampling sequence entries, part 50.
682. gbenv51.seq - Environmental sampling sequence entries, part 51.
683. gbenv52.seq - Environmental sampling sequence entries, part 52.
684. gbenv53.seq - Environmental sampling sequence entries, part 53.
685. gbenv54.seq - Environmental sampling sequence entries, part 54.
686. gbenv55.seq - Environmental sampling sequence entries, part 55.
687. gbenv56.seq - Environmental sampling sequence entries, part 56.
688. gbenv57.seq - Environmental sampling sequence entries, part 57.
689. gbenv58.seq - Environmental sampling sequence entries, part 58.
690. gbenv59.seq - Environmental sampling sequence entries, part 59.
691. gbenv6.seq - Environmental sampling sequence entries, part 6.
692. gbenv60.seq - Environmental sampling sequence entries, part 60.
693. gbenv61.seq - Environmental sampling sequence entries, part 61.
694. gbenv62.seq - Environmental sampling sequence entries, part 62.
695. gbenv63.seq - Environmental sampling sequence entries, part 63.
696. gbenv64.seq - Environmental sampling sequence entries, part 64.
697. gbenv65.seq - Environmental sampling sequence entries, part 65.
698. gbenv66.seq - Environmental sampling sequence entries, part 66.
699. gbenv67.seq - Environmental sampling sequence entries, part 67.
700. gbenv68.seq - Environmental sampling sequence entries, part 68.
701. gbenv69.seq - Environmental sampling sequence entries, part 69.
702. gbenv7.seq - Environmental sampling sequence entries, part 7.
703. gbenv70.seq - Environmental sampling sequence entries, part 70.
704. gbenv71.seq - Environmental sampling sequence entries, part 71.
705. gbenv72.seq - Environmental sampling sequence entries, part 72.
706. gbenv73.seq - Environmental sampling sequence entries, part 73.
707. gbenv74.seq - Environmental sampling sequence entries, part 74.
708. gbenv75.seq - Environmental sampling sequence entries, part 75.
709. gbenv76.seq - Environmental sampling sequence entries, part 76.
710. gbenv77.seq - Environmental sampling sequence entries, part 77.
711. gbenv78.seq - Environmental sampling sequence entries, part 78.
712. gbenv79.seq - Environmental sampling sequence entries, part 79.
713. gbenv8.seq - Environmental sampling sequence entries, part 8.
714. gbenv80.seq - Environmental sampling sequence entries, part 80.
715. gbenv81.seq - Environmental sampling sequence entries, part 81.
716. gbenv82.seq - Environmental sampling sequence entries, part 82.
717. gbenv83.seq - Environmental sampling sequence entries, part 83.
718. gbenv84.seq - Environmental sampling sequence entries, part 84.
719. gbenv85.seq - Environmental sampling sequence entries, part 85.
720. gbenv86.seq - Environmental sampling sequence entries, part 86.
721. gbenv87.seq - Environmental sampling sequence entries, part 87.
722. gbenv88.seq - Environmental sampling sequence entries, part 88.
723. gbenv89.seq - Environmental sampling sequence entries, part 89.
724. gbenv9.seq - Environmental sampling sequence entries, part 9.
725. gbenv90.seq - Environmental sampling sequence entries, part 90.
726. gbenv91.seq - Environmental sampling sequence entries, part 91.
727. gbenv92.seq - Environmental sampling sequence entries, part 92.
728. gbenv93.seq - Environmental sampling sequence entries, part 93.
729. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
730. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
731. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
732. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
733. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
734. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
735. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
736. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
737. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
738. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
739. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
740. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
741. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
742. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
743. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
744. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
745. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
746. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
747. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
748. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
749. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
750. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
751. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
752. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
753. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
754. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
755. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
756. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
757. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
758. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
759. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
760. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
761. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
762. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
763. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
764. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
765. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
766. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
767. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
768. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
769. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
770. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
771. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
772. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
773. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
774. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
775. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
776. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
777. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
778. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
779. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
780. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
781. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
782. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
783. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
784. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
785. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
786. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
787. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
788. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
789. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
790. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
791. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
792. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
793. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
794. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
795. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
796. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
797. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
798. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
799. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
800. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
801. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
802. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
803. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
804. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
805. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
806. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
807. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
808. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
809. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
810. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
811. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
812. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
813. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
814. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
815. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
816. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
817. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
818. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
819. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
820. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
821. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
822. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
823. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
824. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
825. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
826. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
827. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
828. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
829. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
830. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
831. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
832. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
833. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
834. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
835. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
836. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
837. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
838. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
839. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
840. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
841. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
842. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
843. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
844. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
845. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
846. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
847. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
848. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
849. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
850. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
851. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
852. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
853. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
854. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
855. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
856. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
857. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
858. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
859. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
860. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
861. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
862. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
863. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
864. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
865. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
866. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
867. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
868. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
869. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
870. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
871. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
872. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
873. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
874. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
875. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
876. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
877. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
878. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
879. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
880. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
881. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
882. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
883. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
884. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
885. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
886. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
887. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
888. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
889. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
890. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
891. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
892. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
893. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
894. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
895. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
896. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
897. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
898. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
899. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
900. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
901. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
902. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
903. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
904. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
905. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
906. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
907. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
908. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
909. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
910. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
911. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
912. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
913. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
914. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
915. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
916. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
917. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
918. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
919. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
920. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
921. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
922. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
923. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
924. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
925. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
926. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
927. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
928. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
929. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
930. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
931. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
932. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
933. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
934. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
935. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
936. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
937. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
938. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
939. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
940. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
941. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
942. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
943. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
944. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
945. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
946. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
947. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
948. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
949. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
950. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
951. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
952. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
953. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
954. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
955. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
956. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
957. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
958. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
959. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
960. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
961. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
962. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
963. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
964. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
965. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
966. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
967. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
968. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
969. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
970. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
971. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
972. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
973. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
974. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
975. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
976. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
977. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
978. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
979. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
980. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
981. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
982. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
983. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
984. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
985. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
986. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
987. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
988. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
989. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
990. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
991. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
992. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
993. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
994. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
995. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
996. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
997. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
998. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
999. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1000. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1001. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1002. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1003. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1004. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1005. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1006. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1007. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1008. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1009. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1010. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1011. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1012. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1013. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1014. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1015. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1016. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1017. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1018. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1019. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1020. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1021. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1022. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1023. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1024. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1025. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1026. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1027. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1028. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1029. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1030. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1031. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1032. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1033. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1034. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1035. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1036. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1037. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1038. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1039. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1040. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1041. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1042. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1043. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1044. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1045. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1046. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1047. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1048. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1049. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1050. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1051. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1052. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1053. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1054. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1055. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1056. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1057. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1058. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1059. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1060. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1061. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1062. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1063. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1064. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1065. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1066. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1067. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1068. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1069. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1070. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1071. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1072. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1073. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1074. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1075. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1076. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1077. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1078. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1079. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1080. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1081. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1082. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1083. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1084. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1085. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1086. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1087. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1088. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1089. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1090. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1091. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1092. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1093. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1094. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1095. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1096. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1097. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1098. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1099. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1100. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1101. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1102. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1103. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1104. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1105. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1106. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1107. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1108. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1109. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1110. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1111. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1112. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1113. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1114. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1115. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1116. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1117. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1118. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1119. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1120. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1121. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1122. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1123. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1124. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1125. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1126. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1127. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1128. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1129. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1130. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1131. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1132. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1133. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1134. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1135. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1136. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1137. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1138. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1139. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1140. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1141. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1142. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1143. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1144. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1145. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1146. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1147. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1148. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1149. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1150. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1151. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1152. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1153. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1154. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1155. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1156. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1157. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1158. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1159. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1160. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1161. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1162. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1163. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1164. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1165. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1166. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1167. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1168. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1169. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1170. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1171. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1172. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1173. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1174. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1175. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1176. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1177. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1178. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1179. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1180. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1181. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1182. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1183. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1184. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1185. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1186. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1187. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1188. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1189. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1190. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1191. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1192. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1193. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1194. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1195. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1196. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1197. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1198. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1199. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1200. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1201. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1202. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1203. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1204. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1205. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1206. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1207. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1208. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1209. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1210. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1211. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1212. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1213. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1214. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1215. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1216. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1217. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1218. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1219. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1220. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1221. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1222. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1223. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1224. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1225. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1226. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1227. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1228. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1229. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1230. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1231. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1232. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1233. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1234. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1235. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1236. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1237. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1238. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1239. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1240. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1241. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1242. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1243. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1244. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1245. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1246. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1247. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1248. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1249. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1250. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1251. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1252. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1253. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1254. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1255. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1256. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1257. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1258. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1259. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1260. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1261. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1262. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1263. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1264. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1265. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1266. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1267. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1268. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1269. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1270. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1271. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1272. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1273. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1274. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1275. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1276. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1277. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1278. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1279. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1280. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1281. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1282. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1283. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1284. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1285. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1286. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1287. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1288. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1289. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1290. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1291. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1292. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1293. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1294. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1295. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1296. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1297. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1298. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1299. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1300. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1301. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1302. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1303. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1304. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1305. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1306. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1307. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1308. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1309. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1310. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1311. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1312. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1313. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1314. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1315. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1316. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1317. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1318. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1319. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1320. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1321. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1322. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1323. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1324. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1325. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1326. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1327. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1328. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1329. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1330. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1331. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1332. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1333. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1334. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1335. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1336. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1337. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1338. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1339. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1340. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1341. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1342. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1343. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1344. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1345. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1346. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1347. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1348. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1349. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1350. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1351. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1352. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1353. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1354. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1355. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1356. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1357. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1358. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1359. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1360. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1361. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1362. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1363. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1364. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1365. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1366. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1367. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1368. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1369. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1370. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1371. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1372. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1373. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1374. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1375. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1376. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1377. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1378. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1379. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1380. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1381. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1382. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1383. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1384. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1385. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1386. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1387. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1388. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1389. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1390. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1391. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1392. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1393. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1394. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1395. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1396. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1397. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1398. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1399. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1400. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1401. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1402. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1403. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1404. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1405. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1406. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1407. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1408. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1409. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1410. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1411. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1412. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1413. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1414. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1415. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1416. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1417. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1418. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1419. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1420. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1421. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1422. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1423. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1424. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1425. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1426. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1427. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1428. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1429. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1430. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1431. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1432. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1433. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1434. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1435. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1436. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1437. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1438. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1439. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1440. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1441. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1442. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1443. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1444. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1445. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1446. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1447. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1448. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1449. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1450. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1451. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1452. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1453. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1454. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1455. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1456. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1457. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1458. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1459. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1460. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1461. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1462. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1463. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1464. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1465. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1466. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1467. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1468. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1469. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1470. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1471. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1472. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1473. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1474. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1475. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1476. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1477. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1478. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1479. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1480. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1481. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1482. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1483. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1484. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1485. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1486. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1487. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1488. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1489. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1490. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1491. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1492. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1493. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1494. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1495. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1496. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1497. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1498. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1499. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1500. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1501. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1502. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1503. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1504. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1505. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1506. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1507. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1508. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1509. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1510. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1511. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1512. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1513. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1514. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1515. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1516. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1517. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1518. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1519. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1520. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1521. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1522. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1523. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1524. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1525. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1526. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1527. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1528. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1529. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1530. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1531. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1532. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1533. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1534. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1535. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1536. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1537. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1538. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1539. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1540. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1541. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1542. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1543. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1544. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1545. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1546. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1547. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1548. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1549. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1550. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1551. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1552. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1553. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1554. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1555. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1556. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1557. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1558. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1559. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1560. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1561. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1562. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1563. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1564. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1565. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1566. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1567. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1568. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1569. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1570. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1571. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1572. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1573. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1574. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1575. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1576. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1577. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1578. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1579. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1580. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1581. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1582. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1583. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1584. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1585. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1586. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1587. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1588. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1589. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1590. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1591. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1592. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1593. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1594. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1595. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1596. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1597. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1598. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1599. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1600. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1601. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1602. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1603. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1604. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1605. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1606. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1607. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1608. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1609. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1610. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1611. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1612. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1613. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1614. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1615. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1616. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1617. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1618. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1619. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1620. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1621. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1622. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1623. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1624. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1625. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1626. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1627. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1628. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1629. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1630. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1631. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1632. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1633. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1634. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1635. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1636. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1637. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1638. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1639. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1640. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1641. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1642. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1643. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1644. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1645. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1646. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1647. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1648. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1649. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1650. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1651. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1652. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1653. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1654. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1655. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1656. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1657. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1658. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1659. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1660. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1661. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1662. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1663. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1664. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1665. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1666. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1667. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1668. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1669. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1670. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1671. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1672. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1673. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1674. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1675. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1676. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1677. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1678. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1679. gbinv1.seq - Invertebrate sequence entries, part 1.
1680. gbinv10.seq - Invertebrate sequence entries, part 10.
1681. gbinv100.seq - Invertebrate sequence entries, part 100.
1682. gbinv101.seq - Invertebrate sequence entries, part 101.
1683. gbinv102.seq - Invertebrate sequence entries, part 102.
1684. gbinv103.seq - Invertebrate sequence entries, part 103.
1685. gbinv104.seq - Invertebrate sequence entries, part 104.
1686. gbinv105.seq - Invertebrate sequence entries, part 105.
1687. gbinv106.seq - Invertebrate sequence entries, part 106.
1688. gbinv107.seq - Invertebrate sequence entries, part 107.
1689. gbinv108.seq - Invertebrate sequence entries, part 108.
1690. gbinv109.seq - Invertebrate sequence entries, part 109.
1691. gbinv11.seq - Invertebrate sequence entries, part 11.
1692. gbinv110.seq - Invertebrate sequence entries, part 110.
1693. gbinv111.seq - Invertebrate sequence entries, part 111.
1694. gbinv112.seq - Invertebrate sequence entries, part 112.
1695. gbinv113.seq - Invertebrate sequence entries, part 113.
1696. gbinv114.seq - Invertebrate sequence entries, part 114.
1697. gbinv115.seq - Invertebrate sequence entries, part 115.
1698. gbinv116.seq - Invertebrate sequence entries, part 116.
1699. gbinv117.seq - Invertebrate sequence entries, part 117.
1700. gbinv118.seq - Invertebrate sequence entries, part 118.
1701. gbinv119.seq - Invertebrate sequence entries, part 119.
1702. gbinv12.seq - Invertebrate sequence entries, part 12.
1703. gbinv120.seq - Invertebrate sequence entries, part 120.
1704. gbinv121.seq - Invertebrate sequence entries, part 121.
1705. gbinv122.seq - Invertebrate sequence entries, part 122.
1706. gbinv123.seq - Invertebrate sequence entries, part 123.
1707. gbinv124.seq - Invertebrate sequence entries, part 124.
1708. gbinv125.seq - Invertebrate sequence entries, part 125.
1709. gbinv126.seq - Invertebrate sequence entries, part 126.
1710. gbinv127.seq - Invertebrate sequence entries, part 127.
1711. gbinv128.seq - Invertebrate sequence entries, part 128.
1712. gbinv129.seq - Invertebrate sequence entries, part 129.
1713. gbinv13.seq - Invertebrate sequence entries, part 13.
1714. gbinv130.seq - Invertebrate sequence entries, part 130.
1715. gbinv131.seq - Invertebrate sequence entries, part 131.
1716. gbinv132.seq - Invertebrate sequence entries, part 132.
1717. gbinv133.seq - Invertebrate sequence entries, part 133.
1718. gbinv134.seq - Invertebrate sequence entries, part 134.
1719. gbinv135.seq - Invertebrate sequence entries, part 135.
1720. gbinv136.seq - Invertebrate sequence entries, part 136.
1721. gbinv137.seq - Invertebrate sequence entries, part 137.
1722. gbinv138.seq - Invertebrate sequence entries, part 138.
1723. gbinv139.seq - Invertebrate sequence entries, part 139.
1724. gbinv14.seq - Invertebrate sequence entries, part 14.
1725. gbinv140.seq - Invertebrate sequence entries, part 140.
1726. gbinv141.seq - Invertebrate sequence entries, part 141.
1727. gbinv142.seq - Invertebrate sequence entries, part 142.
1728. gbinv143.seq - Invertebrate sequence entries, part 143.
1729. gbinv144.seq - Invertebrate sequence entries, part 144.
1730. gbinv145.seq - Invertebrate sequence entries, part 145.
1731. gbinv146.seq - Invertebrate sequence entries, part 146.
1732. gbinv147.seq - Invertebrate sequence entries, part 147.
1733. gbinv148.seq - Invertebrate sequence entries, part 148.
1734. gbinv149.seq - Invertebrate sequence entries, part 149.
1735. gbinv15.seq - Invertebrate sequence entries, part 15.
1736. gbinv150.seq - Invertebrate sequence entries, part 150.
1737. gbinv151.seq - Invertebrate sequence entries, part 151.
1738. gbinv16.seq - Invertebrate sequence entries, part 16.
1739. gbinv17.seq - Invertebrate sequence entries, part 17.
1740. gbinv18.seq - Invertebrate sequence entries, part 18.
1741. gbinv19.seq - Invertebrate sequence entries, part 19.
1742. gbinv2.seq - Invertebrate sequence entries, part 2.
1743. gbinv20.seq - Invertebrate sequence entries, part 20.
1744. gbinv21.seq - Invertebrate sequence entries, part 21.
1745. gbinv22.seq - Invertebrate sequence entries, part 22.
1746. gbinv23.seq - Invertebrate sequence entries, part 23.
1747. gbinv24.seq - Invertebrate sequence entries, part 24.
1748. gbinv25.seq - Invertebrate sequence entries, part 25.
1749. gbinv26.seq - Invertebrate sequence entries, part 26.
1750. gbinv27.seq - Invertebrate sequence entries, part 27.
1751. gbinv28.seq - Invertebrate sequence entries, part 28.
1752. gbinv29.seq - Invertebrate sequence entries, part 29.
1753. gbinv3.seq - Invertebrate sequence entries, part 3.
1754. gbinv30.seq - Invertebrate sequence entries, part 30.
1755. gbinv31.seq - Invertebrate sequence entries, part 31.
1756. gbinv32.seq - Invertebrate sequence entries, part 32.
1757. gbinv33.seq - Invertebrate sequence entries, part 33.
1758. gbinv34.seq - Invertebrate sequence entries, part 34.
1759. gbinv35.seq - Invertebrate sequence entries, part 35.
1760. gbinv36.seq - Invertebrate sequence entries, part 36.
1761. gbinv37.seq - Invertebrate sequence entries, part 37.
1762. gbinv38.seq - Invertebrate sequence entries, part 38.
1763. gbinv39.seq - Invertebrate sequence entries, part 39.
1764. gbinv4.seq - Invertebrate sequence entries, part 4.
1765. gbinv40.seq - Invertebrate sequence entries, part 40.
1766. gbinv41.seq - Invertebrate sequence entries, part 41.
1767. gbinv42.seq - Invertebrate sequence entries, part 42.
1768. gbinv43.seq - Invertebrate sequence entries, part 43.
1769. gbinv44.seq - Invertebrate sequence entries, part 44.
1770. gbinv45.seq - Invertebrate sequence entries, part 45.
1771. gbinv46.seq - Invertebrate sequence entries, part 46.
1772. gbinv47.seq - Invertebrate sequence entries, part 47.
1773. gbinv48.seq - Invertebrate sequence entries, part 48.
1774. gbinv49.seq - Invertebrate sequence entries, part 49.
1775. gbinv5.seq - Invertebrate sequence entries, part 5.
1776. gbinv50.seq - Invertebrate sequence entries, part 50.
1777. gbinv51.seq - Invertebrate sequence entries, part 51.
1778. gbinv52.seq - Invertebrate sequence entries, part 52.
1779. gbinv53.seq - Invertebrate sequence entries, part 53.
1780. gbinv54.seq - Invertebrate sequence entries, part 54.
1781. gbinv55.seq - Invertebrate sequence entries, part 55.
1782. gbinv56.seq - Invertebrate sequence entries, part 56.
1783. gbinv57.seq - Invertebrate sequence entries, part 57.
1784. gbinv58.seq - Invertebrate sequence entries, part 58.
1785. gbinv59.seq - Invertebrate sequence entries, part 59.
1786. gbinv6.seq - Invertebrate sequence entries, part 6.
1787. gbinv60.seq - Invertebrate sequence entries, part 60.
1788. gbinv61.seq - Invertebrate sequence entries, part 61.
1789. gbinv62.seq - Invertebrate sequence entries, part 62.
1790. gbinv63.seq - Invertebrate sequence entries, part 63.
1791. gbinv64.seq - Invertebrate sequence entries, part 64.
1792. gbinv65.seq - Invertebrate sequence entries, part 65.
1793. gbinv66.seq - Invertebrate sequence entries, part 66.
1794. gbinv67.seq - Invertebrate sequence entries, part 67.
1795. gbinv68.seq - Invertebrate sequence entries, part 68.
1796. gbinv69.seq - Invertebrate sequence entries, part 69.
1797. gbinv7.seq - Invertebrate sequence entries, part 7.
1798. gbinv70.seq - Invertebrate sequence entries, part 70.
1799. gbinv71.seq - Invertebrate sequence entries, part 71.
1800. gbinv72.seq - Invertebrate sequence entries, part 72.
1801. gbinv73.seq - Invertebrate sequence entries, part 73.
1802. gbinv74.seq - Invertebrate sequence entries, part 74.
1803. gbinv75.seq - Invertebrate sequence entries, part 75.
1804. gbinv76.seq - Invertebrate sequence entries, part 76.
1805. gbinv77.seq - Invertebrate sequence entries, part 77.
1806. gbinv78.seq - Invertebrate sequence entries, part 78.
1807. gbinv79.seq - Invertebrate sequence entries, part 79.
1808. gbinv8.seq - Invertebrate sequence entries, part 8.
1809. gbinv80.seq - Invertebrate sequence entries, part 80.
1810. gbinv81.seq - Invertebrate sequence entries, part 81.
1811. gbinv82.seq - Invertebrate sequence entries, part 82.
1812. gbinv83.seq - Invertebrate sequence entries, part 83.
1813. gbinv84.seq - Invertebrate sequence entries, part 84.
1814. gbinv85.seq - Invertebrate sequence entries, part 85.
1815. gbinv86.seq - Invertebrate sequence entries, part 86.
1816. gbinv87.seq - Invertebrate sequence entries, part 87.
1817. gbinv88.seq - Invertebrate sequence entries, part 88.
1818. gbinv89.seq - Invertebrate sequence entries, part 89.
1819. gbinv9.seq - Invertebrate sequence entries, part 9.
1820. gbinv90.seq - Invertebrate sequence entries, part 90.
1821. gbinv91.seq - Invertebrate sequence entries, part 91.
1822. gbinv92.seq - Invertebrate sequence entries, part 92.
1823. gbinv93.seq - Invertebrate sequence entries, part 93.
1824. gbinv94.seq - Invertebrate sequence entries, part 94.
1825. gbinv95.seq - Invertebrate sequence entries, part 95.
1826. gbinv96.seq - Invertebrate sequence entries, part 96.
1827. gbinv97.seq - Invertebrate sequence entries, part 97.
1828. gbinv98.seq - Invertebrate sequence entries, part 98.
1829. gbinv99.seq - Invertebrate sequence entries, part 99.
1830. gbmam1.seq - Other mammalian sequence entries, part 1.
1831. gbmam10.seq - Other mammalian sequence entries, part 10.
1832. gbmam11.seq - Other mammalian sequence entries, part 11.
1833. gbmam12.seq - Other mammalian sequence entries, part 12.
1834. gbmam13.seq - Other mammalian sequence entries, part 13.
1835. gbmam14.seq - Other mammalian sequence entries, part 14.
1836. gbmam15.seq - Other mammalian sequence entries, part 15.
1837. gbmam16.seq - Other mammalian sequence entries, part 16.
1838. gbmam17.seq - Other mammalian sequence entries, part 17.
1839. gbmam18.seq - Other mammalian sequence entries, part 18.
1840. gbmam19.seq - Other mammalian sequence entries, part 19.
1841. gbmam2.seq - Other mammalian sequence entries, part 2.
1842. gbmam20.seq - Other mammalian sequence entries, part 20.
1843. gbmam21.seq - Other mammalian sequence entries, part 21.
1844. gbmam22.seq - Other mammalian sequence entries, part 22.
1845. gbmam23.seq - Other mammalian sequence entries, part 23.
1846. gbmam24.seq - Other mammalian sequence entries, part 24.
1847. gbmam25.seq - Other mammalian sequence entries, part 25.
1848. gbmam26.seq - Other mammalian sequence entries, part 26.
1849. gbmam27.seq - Other mammalian sequence entries, part 27.
1850. gbmam28.seq - Other mammalian sequence entries, part 28.
1851. gbmam29.seq - Other mammalian sequence entries, part 29.
1852. gbmam3.seq - Other mammalian sequence entries, part 3.
1853. gbmam30.seq - Other mammalian sequence entries, part 30.
1854. gbmam31.seq - Other mammalian sequence entries, part 31.
1855. gbmam32.seq - Other mammalian sequence entries, part 32.
1856. gbmam33.seq - Other mammalian sequence entries, part 33.
1857. gbmam34.seq - Other mammalian sequence entries, part 34.
1858. gbmam35.seq - Other mammalian sequence entries, part 35.
1859. gbmam36.seq - Other mammalian sequence entries, part 36.
1860. gbmam37.seq - Other mammalian sequence entries, part 37.
1861. gbmam4.seq - Other mammalian sequence entries, part 4.
1862. gbmam5.seq - Other mammalian sequence entries, part 5.
1863. gbmam6.seq - Other mammalian sequence entries, part 6.
1864. gbmam7.seq - Other mammalian sequence entries, part 7.
1865. gbmam8.seq - Other mammalian sequence entries, part 8.
1866. gbmam9.seq - Other mammalian sequence entries, part 9.
1867. gbnew.txt - Accession numbers of entries new since the previous release.
1868. gbpat1.seq - Patent sequence entries, part 1.
1869. gbpat10.seq - Patent sequence entries, part 10.
1870. gbpat100.seq - Patent sequence entries, part 100.
1871. gbpat101.seq - Patent sequence entries, part 101.
1872. gbpat102.seq - Patent sequence entries, part 102.
1873. gbpat103.seq - Patent sequence entries, part 103.
1874. gbpat104.seq - Patent sequence entries, part 104.
1875. gbpat105.seq - Patent sequence entries, part 105.
1876. gbpat106.seq - Patent sequence entries, part 106.
1877. gbpat107.seq - Patent sequence entries, part 107.
1878. gbpat108.seq - Patent sequence entries, part 108.
1879. gbpat109.seq - Patent sequence entries, part 109.
1880. gbpat11.seq - Patent sequence entries, part 11.
1881. gbpat110.seq - Patent sequence entries, part 110.
1882. gbpat111.seq - Patent sequence entries, part 111.
1883. gbpat112.seq - Patent sequence entries, part 112.
1884. gbpat113.seq - Patent sequence entries, part 113.
1885. gbpat114.seq - Patent sequence entries, part 114.
1886. gbpat115.seq - Patent sequence entries, part 115.
1887. gbpat116.seq - Patent sequence entries, part 116.
1888. gbpat117.seq - Patent sequence entries, part 117.
1889. gbpat118.seq - Patent sequence entries, part 118.
1890. gbpat119.seq - Patent sequence entries, part 119.
1891. gbpat12.seq - Patent sequence entries, part 12.
1892. gbpat120.seq - Patent sequence entries, part 120.
1893. gbpat121.seq - Patent sequence entries, part 121.
1894. gbpat122.seq - Patent sequence entries, part 122.
1895. gbpat123.seq - Patent sequence entries, part 123.
1896. gbpat124.seq - Patent sequence entries, part 124.
1897. gbpat125.seq - Patent sequence entries, part 125.
1898. gbpat126.seq - Patent sequence entries, part 126.
1899. gbpat127.seq - Patent sequence entries, part 127.
1900. gbpat128.seq - Patent sequence entries, part 128.
1901. gbpat129.seq - Patent sequence entries, part 129.
1902. gbpat13.seq - Patent sequence entries, part 13.
1903. gbpat130.seq - Patent sequence entries, part 130.
1904. gbpat131.seq - Patent sequence entries, part 131.
1905. gbpat132.seq - Patent sequence entries, part 132.
1906. gbpat133.seq - Patent sequence entries, part 133.
1907. gbpat134.seq - Patent sequence entries, part 134.
1908. gbpat135.seq - Patent sequence entries, part 135.
1909. gbpat136.seq - Patent sequence entries, part 136.
1910. gbpat137.seq - Patent sequence entries, part 137.
1911. gbpat138.seq - Patent sequence entries, part 138.
1912. gbpat139.seq - Patent sequence entries, part 139.
1913. gbpat14.seq - Patent sequence entries, part 14.
1914. gbpat140.seq - Patent sequence entries, part 140.
1915. gbpat141.seq - Patent sequence entries, part 141.
1916. gbpat142.seq - Patent sequence entries, part 142.
1917. gbpat143.seq - Patent sequence entries, part 143.
1918. gbpat144.seq - Patent sequence entries, part 144.
1919. gbpat145.seq - Patent sequence entries, part 145.
1920. gbpat146.seq - Patent sequence entries, part 146.
1921. gbpat147.seq - Patent sequence entries, part 147.
1922. gbpat148.seq - Patent sequence entries, part 148.
1923. gbpat149.seq - Patent sequence entries, part 149.
1924. gbpat15.seq - Patent sequence entries, part 15.
1925. gbpat150.seq - Patent sequence entries, part 150.
1926. gbpat151.seq - Patent sequence entries, part 151.
1927. gbpat152.seq - Patent sequence entries, part 152.
1928. gbpat153.seq - Patent sequence entries, part 153.
1929. gbpat154.seq - Patent sequence entries, part 154.
1930. gbpat155.seq - Patent sequence entries, part 155.
1931. gbpat156.seq - Patent sequence entries, part 156.
1932. gbpat157.seq - Patent sequence entries, part 157.
1933. gbpat158.seq - Patent sequence entries, part 158.
1934. gbpat159.seq - Patent sequence entries, part 159.
1935. gbpat16.seq - Patent sequence entries, part 16.
1936. gbpat160.seq - Patent sequence entries, part 160.
1937. gbpat161.seq - Patent sequence entries, part 161.
1938. gbpat162.seq - Patent sequence entries, part 162.
1939. gbpat163.seq - Patent sequence entries, part 163.
1940. gbpat164.seq - Patent sequence entries, part 164.
1941. gbpat165.seq - Patent sequence entries, part 165.
1942. gbpat166.seq - Patent sequence entries, part 166.
1943. gbpat167.seq - Patent sequence entries, part 167.
1944. gbpat168.seq - Patent sequence entries, part 168.
1945. gbpat169.seq - Patent sequence entries, part 169.
1946. gbpat17.seq - Patent sequence entries, part 17.
1947. gbpat170.seq - Patent sequence entries, part 170.
1948. gbpat171.seq - Patent sequence entries, part 171.
1949. gbpat172.seq - Patent sequence entries, part 172.
1950. gbpat173.seq - Patent sequence entries, part 173.
1951. gbpat174.seq - Patent sequence entries, part 174.
1952. gbpat175.seq - Patent sequence entries, part 175.
1953. gbpat176.seq - Patent sequence entries, part 176.
1954. gbpat177.seq - Patent sequence entries, part 177.
1955. gbpat178.seq - Patent sequence entries, part 178.
1956. gbpat179.seq - Patent sequence entries, part 179.
1957. gbpat18.seq - Patent sequence entries, part 18.
1958. gbpat180.seq - Patent sequence entries, part 180.
1959. gbpat181.seq - Patent sequence entries, part 181.
1960. gbpat182.seq - Patent sequence entries, part 182.
1961. gbpat183.seq - Patent sequence entries, part 183.
1962. gbpat184.seq - Patent sequence entries, part 184.
1963. gbpat185.seq - Patent sequence entries, part 185.
1964. gbpat186.seq - Patent sequence entries, part 186.
1965. gbpat187.seq - Patent sequence entries, part 187.
1966. gbpat188.seq - Patent sequence entries, part 188.
1967. gbpat189.seq - Patent sequence entries, part 189.
1968. gbpat19.seq - Patent sequence entries, part 19.
1969. gbpat190.seq - Patent sequence entries, part 190.
1970. gbpat191.seq - Patent sequence entries, part 191.
1971. gbpat192.seq - Patent sequence entries, part 192.
1972. gbpat193.seq - Patent sequence entries, part 193.
1973. gbpat194.seq - Patent sequence entries, part 194.
1974. gbpat195.seq - Patent sequence entries, part 195.
1975. gbpat196.seq - Patent sequence entries, part 196.
1976. gbpat197.seq - Patent sequence entries, part 197.
1977. gbpat198.seq - Patent sequence entries, part 198.
1978. gbpat199.seq - Patent sequence entries, part 199.
1979. gbpat2.seq - Patent sequence entries, part 2.
1980. gbpat20.seq - Patent sequence entries, part 20.
1981. gbpat200.seq - Patent sequence entries, part 200.
1982. gbpat201.seq - Patent sequence entries, part 201.
1983. gbpat202.seq - Patent sequence entries, part 202.
1984. gbpat203.seq - Patent sequence entries, part 203.
1985. gbpat204.seq - Patent sequence entries, part 204.
1986. gbpat205.seq - Patent sequence entries, part 205.
1987. gbpat206.seq - Patent sequence entries, part 206.
1988. gbpat207.seq - Patent sequence entries, part 207.
1989. gbpat208.seq - Patent sequence entries, part 208.
1990. gbpat209.seq - Patent sequence entries, part 209.
1991. gbpat21.seq - Patent sequence entries, part 21.
1992. gbpat210.seq - Patent sequence entries, part 210.
1993. gbpat211.seq - Patent sequence entries, part 211.
1994. gbpat212.seq - Patent sequence entries, part 212.
1995. gbpat213.seq - Patent sequence entries, part 213.
1996. gbpat214.seq - Patent sequence entries, part 214.
1997. gbpat215.seq - Patent sequence entries, part 215.
1998. gbpat216.seq - Patent sequence entries, part 216.
1999. gbpat217.seq - Patent sequence entries, part 217.
2000. gbpat218.seq - Patent sequence entries, part 218.
2001. gbpat219.seq - Patent sequence entries, part 219.
2002. gbpat22.seq - Patent sequence entries, part 22.
2003. gbpat220.seq - Patent sequence entries, part 220.
2004. gbpat221.seq - Patent sequence entries, part 221.
2005. gbpat222.seq - Patent sequence entries, part 222.
2006. gbpat223.seq - Patent sequence entries, part 223.
2007. gbpat224.seq - Patent sequence entries, part 224.
2008. gbpat225.seq - Patent sequence entries, part 225.
2009. gbpat226.seq - Patent sequence entries, part 226.
2010. gbpat227.seq - Patent sequence entries, part 227.
2011. gbpat228.seq - Patent sequence entries, part 228.
2012. gbpat229.seq - Patent sequence entries, part 229.
2013. gbpat23.seq - Patent sequence entries, part 23.
2014. gbpat230.seq - Patent sequence entries, part 230.
2015. gbpat231.seq - Patent sequence entries, part 231.
2016. gbpat232.seq - Patent sequence entries, part 232.
2017. gbpat233.seq - Patent sequence entries, part 233.
2018. gbpat234.seq - Patent sequence entries, part 234.
2019. gbpat235.seq - Patent sequence entries, part 235.
2020. gbpat236.seq - Patent sequence entries, part 236.
2021. gbpat237.seq - Patent sequence entries, part 237.
2022. gbpat238.seq - Patent sequence entries, part 238.
2023. gbpat239.seq - Patent sequence entries, part 239.
2024. gbpat24.seq - Patent sequence entries, part 24.
2025. gbpat240.seq - Patent sequence entries, part 240.
2026. gbpat241.seq - Patent sequence entries, part 241.
2027. gbpat242.seq - Patent sequence entries, part 242.
2028. gbpat243.seq - Patent sequence entries, part 243.
2029. gbpat244.seq - Patent sequence entries, part 244.
2030. gbpat245.seq - Patent sequence entries, part 245.
2031. gbpat246.seq - Patent sequence entries, part 246.
2032. gbpat247.seq - Patent sequence entries, part 247.
2033. gbpat248.seq - Patent sequence entries, part 248.
2034. gbpat249.seq - Patent sequence entries, part 249.
2035. gbpat25.seq - Patent sequence entries, part 25.
2036. gbpat250.seq - Patent sequence entries, part 250.
2037. gbpat251.seq - Patent sequence entries, part 251.
2038. gbpat252.seq - Patent sequence entries, part 252.
2039. gbpat253.seq - Patent sequence entries, part 253.
2040. gbpat254.seq - Patent sequence entries, part 254.
2041. gbpat255.seq - Patent sequence entries, part 255.
2042. gbpat256.seq - Patent sequence entries, part 256.
2043. gbpat257.seq - Patent sequence entries, part 257.
2044. gbpat258.seq - Patent sequence entries, part 258.
2045. gbpat259.seq - Patent sequence entries, part 259.
2046. gbpat26.seq - Patent sequence entries, part 26.
2047. gbpat260.seq - Patent sequence entries, part 260.
2048. gbpat261.seq - Patent sequence entries, part 261.
2049. gbpat262.seq - Patent sequence entries, part 262.
2050. gbpat263.seq - Patent sequence entries, part 263.
2051. gbpat264.seq - Patent sequence entries, part 264.
2052. gbpat265.seq - Patent sequence entries, part 265.
2053. gbpat266.seq - Patent sequence entries, part 266.
2054. gbpat267.seq - Patent sequence entries, part 267.
2055. gbpat268.seq - Patent sequence entries, part 268.
2056. gbpat27.seq - Patent sequence entries, part 27.
2057. gbpat28.seq - Patent sequence entries, part 28.
2058. gbpat29.seq - Patent sequence entries, part 29.
2059. gbpat3.seq - Patent sequence entries, part 3.
2060. gbpat30.seq - Patent sequence entries, part 30.
2061. gbpat31.seq - Patent sequence entries, part 31.
2062. gbpat32.seq - Patent sequence entries, part 32.
2063. gbpat33.seq - Patent sequence entries, part 33.
2064. gbpat34.seq - Patent sequence entries, part 34.
2065. gbpat35.seq - Patent sequence entries, part 35.
2066. gbpat36.seq - Patent sequence entries, part 36.
2067. gbpat37.seq - Patent sequence entries, part 37.
2068. gbpat38.seq - Patent sequence entries, part 38.
2069. gbpat39.seq - Patent sequence entries, part 39.
2070. gbpat4.seq - Patent sequence entries, part 4.
2071. gbpat40.seq - Patent sequence entries, part 40.
2072. gbpat41.seq - Patent sequence entries, part 41.
2073. gbpat42.seq - Patent sequence entries, part 42.
2074. gbpat43.seq - Patent sequence entries, part 43.
2075. gbpat44.seq - Patent sequence entries, part 44.
2076. gbpat45.seq - Patent sequence entries, part 45.
2077. gbpat46.seq - Patent sequence entries, part 46.
2078. gbpat47.seq - Patent sequence entries, part 47.
2079. gbpat48.seq - Patent sequence entries, part 48.
2080. gbpat49.seq - Patent sequence entries, part 49.
2081. gbpat5.seq - Patent sequence entries, part 5.
2082. gbpat50.seq - Patent sequence entries, part 50.
2083. gbpat51.seq - Patent sequence entries, part 51.
2084. gbpat52.seq - Patent sequence entries, part 52.
2085. gbpat53.seq - Patent sequence entries, part 53.
2086. gbpat54.seq - Patent sequence entries, part 54.
2087. gbpat55.seq - Patent sequence entries, part 55.
2088. gbpat56.seq - Patent sequence entries, part 56.
2089. gbpat57.seq - Patent sequence entries, part 57.
2090. gbpat58.seq - Patent sequence entries, part 58.
2091. gbpat59.seq - Patent sequence entries, part 59.
2092. gbpat6.seq - Patent sequence entries, part 6.
2093. gbpat60.seq - Patent sequence entries, part 60.
2094. gbpat61.seq - Patent sequence entries, part 61.
2095. gbpat62.seq - Patent sequence entries, part 62.
2096. gbpat63.seq - Patent sequence entries, part 63.
2097. gbpat64.seq - Patent sequence entries, part 64.
2098. gbpat65.seq - Patent sequence entries, part 65.
2099. gbpat66.seq - Patent sequence entries, part 66.
2100. gbpat67.seq - Patent sequence entries, part 67.
2101. gbpat68.seq - Patent sequence entries, part 68.
2102. gbpat69.seq - Patent sequence entries, part 69.
2103. gbpat7.seq - Patent sequence entries, part 7.
2104. gbpat70.seq - Patent sequence entries, part 70.
2105. gbpat71.seq - Patent sequence entries, part 71.
2106. gbpat72.seq - Patent sequence entries, part 72.
2107. gbpat73.seq - Patent sequence entries, part 73.
2108. gbpat74.seq - Patent sequence entries, part 74.
2109. gbpat75.seq - Patent sequence entries, part 75.
2110. gbpat76.seq - Patent sequence entries, part 76.
2111. gbpat77.seq - Patent sequence entries, part 77.
2112. gbpat78.seq - Patent sequence entries, part 78.
2113. gbpat79.seq - Patent sequence entries, part 79.
2114. gbpat8.seq - Patent sequence entries, part 8.
2115. gbpat80.seq - Patent sequence entries, part 80.
2116. gbpat81.seq - Patent sequence entries, part 81.
2117. gbpat82.seq - Patent sequence entries, part 82.
2118. gbpat83.seq - Patent sequence entries, part 83.
2119. gbpat84.seq - Patent sequence entries, part 84.
2120. gbpat85.seq - Patent sequence entries, part 85.
2121. gbpat86.seq - Patent sequence entries, part 86.
2122. gbpat87.seq - Patent sequence entries, part 87.
2123. gbpat88.seq - Patent sequence entries, part 88.
2124. gbpat89.seq - Patent sequence entries, part 89.
2125. gbpat9.seq - Patent sequence entries, part 9.
2126. gbpat90.seq - Patent sequence entries, part 90.
2127. gbpat91.seq - Patent sequence entries, part 91.
2128. gbpat92.seq - Patent sequence entries, part 92.
2129. gbpat93.seq - Patent sequence entries, part 93.
2130. gbpat94.seq - Patent sequence entries, part 94.
2131. gbpat95.seq - Patent sequence entries, part 95.
2132. gbpat96.seq - Patent sequence entries, part 96.
2133. gbpat97.seq - Patent sequence entries, part 97.
2134. gbpat98.seq - Patent sequence entries, part 98.
2135. gbpat99.seq - Patent sequence entries, part 99.
2136. gbphg1.seq - Phage sequence entries, part 1.
2137. gbphg2.seq - Phage sequence entries, part 2.
2138. gbphg3.seq - Phage sequence entries, part 3.
2139. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2140. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2141. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2142. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2143. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2144. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2145. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2146. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2147. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2148. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2149. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2150. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2151. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2152. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2153. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2154. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2155. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2156. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2157. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2158. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2159. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2160. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2161. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2162. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2163. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2164. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2165. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2166. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2167. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2168. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2169. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2170. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2171. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2172. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2173. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2174. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2175. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2176. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2177. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2178. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2179. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2180. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2181. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2182. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2183. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2184. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2185. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2186. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2187. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2188. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2189. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2190. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2191. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2192. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2193. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2194. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2195. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2196. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2197. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2198. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2199. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2200. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2201. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2202. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2203. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2204. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2205. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2206. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2207. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2208. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2209. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2210. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2211. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2212. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2213. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2214. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2215. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2216. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2217. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2218. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2219. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2220. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2221. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2222. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2223. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2224. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2225. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2226. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2227. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2228. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2229. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2230. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2231. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2232. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2233. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2234. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2235. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2236. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2237. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2238. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2239. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2240. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2241. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2242. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2243. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2244. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2245. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2246. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2247. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2248. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2249. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2250. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2251. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2252. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2253. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2254. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2255. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2256. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2257. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2258. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2259. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2260. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2261. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2262. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2263. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2264. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2265. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2266. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2267. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2268. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2269. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2270. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2271. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2272. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2273. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2274. gbpri1.seq - Primate sequence entries, part 1.
2275. gbpri10.seq - Primate sequence entries, part 10.
2276. gbpri11.seq - Primate sequence entries, part 11.
2277. gbpri12.seq - Primate sequence entries, part 12.
2278. gbpri13.seq - Primate sequence entries, part 13.
2279. gbpri14.seq - Primate sequence entries, part 14.
2280. gbpri15.seq - Primate sequence entries, part 15.
2281. gbpri16.seq - Primate sequence entries, part 16.
2282. gbpri17.seq - Primate sequence entries, part 17.
2283. gbpri18.seq - Primate sequence entries, part 18.
2284. gbpri19.seq - Primate sequence entries, part 19.
2285. gbpri2.seq - Primate sequence entries, part 2.
2286. gbpri20.seq - Primate sequence entries, part 20.
2287. gbpri21.seq - Primate sequence entries, part 21.
2288. gbpri22.seq - Primate sequence entries, part 22.
2289. gbpri23.seq - Primate sequence entries, part 23.
2290. gbpri24.seq - Primate sequence entries, part 24.
2291. gbpri25.seq - Primate sequence entries, part 25.
2292. gbpri26.seq - Primate sequence entries, part 26.
2293. gbpri27.seq - Primate sequence entries, part 27.
2294. gbpri28.seq - Primate sequence entries, part 28.
2295. gbpri29.seq - Primate sequence entries, part 29.
2296. gbpri3.seq - Primate sequence entries, part 3.
2297. gbpri30.seq - Primate sequence entries, part 30.
2298. gbpri31.seq - Primate sequence entries, part 31.
2299. gbpri32.seq - Primate sequence entries, part 32.
2300. gbpri33.seq - Primate sequence entries, part 33.
2301. gbpri34.seq - Primate sequence entries, part 34.
2302. gbpri35.seq - Primate sequence entries, part 35.
2303. gbpri36.seq - Primate sequence entries, part 36.
2304. gbpri37.seq - Primate sequence entries, part 37.
2305. gbpri38.seq - Primate sequence entries, part 38.
2306. gbpri39.seq - Primate sequence entries, part 39.
2307. gbpri4.seq - Primate sequence entries, part 4.
2308. gbpri40.seq - Primate sequence entries, part 40.
2309. gbpri41.seq - Primate sequence entries, part 41.
2310. gbpri42.seq - Primate sequence entries, part 42.
2311. gbpri43.seq - Primate sequence entries, part 43.
2312. gbpri44.seq - Primate sequence entries, part 44.
2313. gbpri45.seq - Primate sequence entries, part 45.
2314. gbpri46.seq - Primate sequence entries, part 46.
2315. gbpri47.seq - Primate sequence entries, part 47.
2316. gbpri48.seq - Primate sequence entries, part 48.
2317. gbpri49.seq - Primate sequence entries, part 49.
2318. gbpri5.seq - Primate sequence entries, part 5.
2319. gbpri50.seq - Primate sequence entries, part 50.
2320. gbpri51.seq - Primate sequence entries, part 51.
2321. gbpri52.seq - Primate sequence entries, part 52.
2322. gbpri53.seq - Primate sequence entries, part 53.
2323. gbpri54.seq - Primate sequence entries, part 54.
2324. gbpri55.seq - Primate sequence entries, part 55.
2325. gbpri6.seq - Primate sequence entries, part 6.
2326. gbpri7.seq - Primate sequence entries, part 7.
2327. gbpri8.seq - Primate sequence entries, part 8.
2328. gbpri9.seq - Primate sequence entries, part 9.
2329. gbrel.txt - Release notes (this document).
2330. gbrod1.seq - Rodent sequence entries, part 1.
2331. gbrod10.seq - Rodent sequence entries, part 10.
2332. gbrod11.seq - Rodent sequence entries, part 11.
2333. gbrod12.seq - Rodent sequence entries, part 12.
2334. gbrod13.seq - Rodent sequence entries, part 13.
2335. gbrod14.seq - Rodent sequence entries, part 14.
2336. gbrod15.seq - Rodent sequence entries, part 15.
2337. gbrod16.seq - Rodent sequence entries, part 16.
2338. gbrod17.seq - Rodent sequence entries, part 17.
2339. gbrod18.seq - Rodent sequence entries, part 18.
2340. gbrod19.seq - Rodent sequence entries, part 19.
2341. gbrod2.seq - Rodent sequence entries, part 2.
2342. gbrod20.seq - Rodent sequence entries, part 20.
2343. gbrod21.seq - Rodent sequence entries, part 21.
2344. gbrod22.seq - Rodent sequence entries, part 22.
2345. gbrod23.seq - Rodent sequence entries, part 23.
2346. gbrod24.seq - Rodent sequence entries, part 24.
2347. gbrod25.seq - Rodent sequence entries, part 25.
2348. gbrod26.seq - Rodent sequence entries, part 26.
2349. gbrod27.seq - Rodent sequence entries, part 27.
2350. gbrod28.seq - Rodent sequence entries, part 28.
2351. gbrod29.seq - Rodent sequence entries, part 29.
2352. gbrod3.seq - Rodent sequence entries, part 3.
2353. gbrod30.seq - Rodent sequence entries, part 30.
2354. gbrod4.seq - Rodent sequence entries, part 4.
2355. gbrod5.seq - Rodent sequence entries, part 5.
2356. gbrod6.seq - Rodent sequence entries, part 6.
2357. gbrod7.seq - Rodent sequence entries, part 7.
2358. gbrod8.seq - Rodent sequence entries, part 8.
2359. gbrod9.seq - Rodent sequence entries, part 9.
2360. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2361. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2362. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2363. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2364. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2365. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2366. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2367. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2368. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2369. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2370. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2371. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2372. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2373. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2374. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2375. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2376. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2377. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2378. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2379. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2380. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2381. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2382. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2383. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2384. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2385. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2386. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2387. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2388. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2389. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2390. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2391. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2392. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2393. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2394. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2395. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2396. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2397. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2398. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2399. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2400. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2401. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2402. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2403. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2404. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2405. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2406. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2407. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2408. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2409. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2410. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2411. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2412. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2413. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2414. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2415. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2416. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2417. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2418. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2419. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2420. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2421. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2422. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2423. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2424. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2425. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2426. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2427. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2428. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2429. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2430. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2431. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2432. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2433. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2434. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2435. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2436. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2437. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2438. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2439. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2440. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2441. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2442. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2443. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2444. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2445. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2446. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2447. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2448. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2449. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2450. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2451. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2452. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2453. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2454. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2455. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2456. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2457. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2458. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2459. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2460. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2461. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2462. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2463. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2464. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2465. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2466. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2467. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2468. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2469. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2470. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2471. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2472. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2473. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2474. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2475. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2476. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2477. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2478. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2479. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2480. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2481. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2482. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2483. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2484. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2485. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2486. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2487. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2488. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2489. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2490. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2491. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2492. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2493. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2494. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2495. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2496. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
2497. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
2498. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
2499. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
2500. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2501. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2502. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
2503. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
2504. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
2505. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
2506. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
2507. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
2508. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
2509. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
2510. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
2511. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
2512. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2513. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
2514. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
2515. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
2516. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
2517. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
2518. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
2519. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
2520. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
2521. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
2522. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
2523. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2524. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
2525. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
2526. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
2527. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
2528. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
2529. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
2530. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
2531. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
2532. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
2533. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
2534. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2535. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2536. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2537. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2538. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2539. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2540. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2541. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2542. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2543. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2544. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2545. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2546. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2547. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2548. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2549. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2550. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2551. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2552. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2553. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2554. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2555. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2556. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2557. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2558. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2559. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2560. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2561. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2562. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2563. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2564. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2565. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2566. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2567. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2568. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2569. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2570. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2571. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2572. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2573. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2574. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2575. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2576. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2577. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2578. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2579. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2580. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2581. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2582. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2583. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2584. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2585. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2586. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2587. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2588. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2589. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2590. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2591. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2592. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2593. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2594. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2595. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2596. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2597. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2598. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2599. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2600. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2601. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2602. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2603. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2604. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2605. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2606. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2607. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2608. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2609. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2610. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2611. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2612. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2613. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2614. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2615. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2616. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2617. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2618. gbuna1.seq - Unannotated sequence entries, part 1.
2619. gbvrl1.seq - Viral sequence entries, part 1.
2620. gbvrl10.seq - Viral sequence entries, part 10.
2621. gbvrl11.seq - Viral sequence entries, part 11.
2622. gbvrl12.seq - Viral sequence entries, part 12.
2623. gbvrl13.seq - Viral sequence entries, part 13.
2624. gbvrl14.seq - Viral sequence entries, part 14.
2625. gbvrl15.seq - Viral sequence entries, part 15.
2626. gbvrl16.seq - Viral sequence entries, part 16.
2627. gbvrl17.seq - Viral sequence entries, part 17.
2628. gbvrl18.seq - Viral sequence entries, part 18.
2629. gbvrl19.seq - Viral sequence entries, part 19.
2630. gbvrl2.seq - Viral sequence entries, part 2.
2631. gbvrl20.seq - Viral sequence entries, part 20.
2632. gbvrl21.seq - Viral sequence entries, part 21.
2633. gbvrl22.seq - Viral sequence entries, part 22.
2634. gbvrl23.seq - Viral sequence entries, part 23.
2635. gbvrl24.seq - Viral sequence entries, part 24.
2636. gbvrl25.seq - Viral sequence entries, part 25.
2637. gbvrl26.seq - Viral sequence entries, part 26.
2638. gbvrl27.seq - Viral sequence entries, part 27.
2639. gbvrl28.seq - Viral sequence entries, part 28.
2640. gbvrl29.seq - Viral sequence entries, part 29.
2641. gbvrl3.seq - Viral sequence entries, part 3.
2642. gbvrl30.seq - Viral sequence entries, part 30.
2643. gbvrl31.seq - Viral sequence entries, part 31.
2644. gbvrl32.seq - Viral sequence entries, part 32.
2645. gbvrl33.seq - Viral sequence entries, part 33.
2646. gbvrl34.seq - Viral sequence entries, part 34.
2647. gbvrl35.seq - Viral sequence entries, part 35.
2648. gbvrl36.seq - Viral sequence entries, part 36.
2649. gbvrl37.seq - Viral sequence entries, part 37.
2650. gbvrl38.seq - Viral sequence entries, part 38.
2651. gbvrl39.seq - Viral sequence entries, part 39.
2652. gbvrl4.seq - Viral sequence entries, part 4.
2653. gbvrl40.seq - Viral sequence entries, part 40.
2654. gbvrl41.seq - Viral sequence entries, part 41.
2655. gbvrl42.seq - Viral sequence entries, part 42.
2656. gbvrl43.seq - Viral sequence entries, part 43.
2657. gbvrl44.seq - Viral sequence entries, part 44.
2658. gbvrl5.seq - Viral sequence entries, part 5.
2659. gbvrl6.seq - Viral sequence entries, part 6.
2660. gbvrl7.seq - Viral sequence entries, part 7.
2661. gbvrl8.seq - Viral sequence entries, part 8.
2662. gbvrl9.seq - Viral sequence entries, part 9.
2663. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2664. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2665. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2666. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2667. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2668. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2669. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2670. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2671. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2672. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2673. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2674. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2675. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2676. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2677. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2678. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2679. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2680. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2681. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2682. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2683. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2684. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2685. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2686. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2687. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2688. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2689. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2690. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2691. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2692. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2693. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2694. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2695. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2696. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2697. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2698. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2699. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2700. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2701. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2702. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2703. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2704. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2705. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2706. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2707. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2708. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2709. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2710. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2711. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2712. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2713. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2714. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2715. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2716. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2717. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2718. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2719. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2720. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2721. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2722. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2723. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2724. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2725. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 216.0 flatfiles require roughly 797 GB (sequence
files only) or 797 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249999871     gbbct1.seq
 246907901     gbbct10.seq
 246004592     gbbct100.seq
 244362574     gbbct101.seq
 242532412     gbbct102.seq
 247851053     gbbct103.seq
 167385390     gbbct104.seq
 249320846     gbbct105.seq
 239666526     gbbct106.seq
 245048938     gbbct107.seq
 247107477     gbbct108.seq
 246696540     gbbct109.seq
 242157199     gbbct11.seq
 246730761     gbbct110.seq
 238756233     gbbct111.seq
 241794810     gbbct112.seq
 249774744     gbbct113.seq
 247057636     gbbct114.seq
 245008600     gbbct115.seq
  36729656     gbbct116.seq
 245338478     gbbct117.seq
 246570714     gbbct118.seq
 247975814     gbbct119.seq
 243160321     gbbct12.seq
 247397230     gbbct120.seq
 248296486     gbbct121.seq
 242831068     gbbct122.seq
 244720214     gbbct123.seq
 237785914     gbbct124.seq
 244106904     gbbct125.seq
 114027263     gbbct126.seq
 247757200     gbbct127.seq
 240369157     gbbct128.seq
 247517890     gbbct129.seq
 247761148     gbbct13.seq
 248102200     gbbct130.seq
 248249955     gbbct131.seq
 235445328     gbbct132.seq
 246393680     gbbct133.seq
 248610580     gbbct134.seq
 246239343     gbbct135.seq
 242271725     gbbct136.seq
 249537764     gbbct137.seq
 242211067     gbbct138.seq
 175045838     gbbct139.seq
 245875373     gbbct14.seq
 245175036     gbbct140.seq
 242084839     gbbct141.seq
 242091182     gbbct142.seq
 240588151     gbbct143.seq
 248311120     gbbct144.seq
 244953514     gbbct145.seq
 246951352     gbbct146.seq
 248768205     gbbct147.seq
 246806598     gbbct148.seq
 246337005     gbbct149.seq
 244928764     gbbct15.seq
 248528430     gbbct150.seq
 245765405     gbbct151.seq
  14014518     gbbct152.seq
 243209161     gbbct153.seq
 243661104     gbbct154.seq
 247088116     gbbct155.seq
 241328930     gbbct156.seq
 241069017     gbbct157.seq
 248274689     gbbct158.seq
 247758830     gbbct159.seq
 247804285     gbbct16.seq
 249318714     gbbct160.seq
 243009198     gbbct161.seq
 240952884     gbbct162.seq
 247486144     gbbct163.seq
 241494551     gbbct164.seq
 237707270     gbbct165.seq
  39667530     gbbct166.seq
 237250668     gbbct167.seq
 249587503     gbbct168.seq
 244401449     gbbct169.seq
 246009586     gbbct17.seq
 242637647     gbbct170.seq
 248237953     gbbct171.seq
 244018785     gbbct172.seq
 244171044     gbbct173.seq
 248857342     gbbct174.seq
 247245428     gbbct175.seq
 229606388     gbbct176.seq
 243980396     gbbct177.seq
 239661134     gbbct178.seq
 247654446     gbbct179.seq
 249566040     gbbct18.seq
 246585210     gbbct180.seq
 248913750     gbbct181.seq
 248521023     gbbct182.seq
 245958008     gbbct183.seq
 242250585     gbbct184.seq
 249297804     gbbct185.seq
 246516246     gbbct186.seq
 190967856     gbbct187.seq
 244861996     gbbct188.seq
 245178707     gbbct189.seq
 242304238     gbbct19.seq
 248437864     gbbct190.seq
 239883255     gbbct191.seq
 242494514     gbbct192.seq
 249333001     gbbct193.seq
 246960474     gbbct194.seq
 244095036     gbbct195.seq
 240306710     gbbct196.seq
 247115246     gbbct197.seq
 245149963     gbbct198.seq
 246783290     gbbct199.seq
 243359680     gbbct2.seq
 249997488     gbbct20.seq
 242486133     gbbct200.seq
 125219167     gbbct201.seq
 249756041     gbbct202.seq
 249312307     gbbct203.seq
 238586011     gbbct204.seq
 246923892     gbbct205.seq
 249663952     gbbct206.seq
 248395925     gbbct207.seq
 244169297     gbbct208.seq
 244323148     gbbct209.seq
  25518240     gbbct21.seq
  89635173     gbbct210.seq
 245175807     gbbct211.seq
 239606011     gbbct212.seq
 246003854     gbbct213.seq
 246950451     gbbct214.seq
 248303307     gbbct215.seq
 246002266     gbbct216.seq
 237178102     gbbct217.seq
 249628381     gbbct218.seq
 241204740     gbbct219.seq
 242073910     gbbct22.seq
  30389820     gbbct220.seq
 238047436     gbbct221.seq
 248536426     gbbct222.seq
 239085364     gbbct223.seq
 243773238     gbbct224.seq
 243804909     gbbct225.seq
 243072882     gbbct226.seq
 244322248     gbbct227.seq
 245324862     gbbct228.seq
 243491264     gbbct229.seq
 249997669     gbbct23.seq
 247053564     gbbct230.seq
 247897925     gbbct231.seq
 241512515     gbbct232.seq
 218374521     gbbct233.seq
 237090062     gbbct234.seq
  73334233     gbbct235.seq
   6911332     gbbct236.seq
  14267364     gbbct237.seq
  23043709     gbbct238.seq
  44925903     gbbct239.seq
 247522222     gbbct24.seq
  87594713     gbbct240.seq
 170537360     gbbct241.seq
 249996865     gbbct242.seq
 249998586     gbbct243.seq
 248720539     gbbct244.seq
 246540952     gbbct245.seq
 240324450     gbbct246.seq
 246347700     gbbct247.seq
 245955206     gbbct248.seq
 246747567     gbbct249.seq
 249361668     gbbct25.seq
 243357677     gbbct250.seq
 249972519     gbbct251.seq
  64375464     gbbct252.seq
 245197618     gbbct253.seq
 244366813     gbbct254.seq
 248180994     gbbct255.seq
 247065748     gbbct256.seq
 245839131     gbbct257.seq
 249999079     gbbct258.seq
 249999235     gbbct259.seq
 248385103     gbbct26.seq
 249665727     gbbct260.seq
 249999782     gbbct261.seq
 249999687     gbbct262.seq
 249999217     gbbct263.seq
  46197873     gbbct264.seq
 249999538     gbbct265.seq
 249998904     gbbct266.seq
  65330816     gbbct267.seq
 249998831     gbbct268.seq
 166942455     gbbct269.seq
 245177671     gbbct27.seq
 249998115     gbbct270.seq
 247523256     gbbct271.seq
 249707512     gbbct272.seq
 246547443     gbbct273.seq
 247412941     gbbct274.seq
 240015908     gbbct275.seq
 247036025     gbbct276.seq
 246220772     gbbct277.seq
 245721423     gbbct278.seq
 245273249     gbbct279.seq
 242877094     gbbct28.seq
 249040596     gbbct280.seq
 141683044     gbbct281.seq
 239673837     gbbct29.seq
 246565809     gbbct3.seq
 217808722     gbbct30.seq
 242805093     gbbct31.seq
 245839037     gbbct32.seq
 248682296     gbbct33.seq
 247882878     gbbct34.seq
 249145741     gbbct35.seq
 244436925     gbbct36.seq
 247334101     gbbct37.seq
 249976288     gbbct38.seq
 249765579     gbbct39.seq
 249517336     gbbct4.seq
 240923064     gbbct40.seq
 244794920     gbbct41.seq
 249643827     gbbct42.seq
 165341800     gbbct43.seq
 247445609     gbbct44.seq
 246944501     gbbct45.seq
 248190837     gbbct46.seq
 246578692     gbbct47.seq
 241956782     gbbct48.seq
 246672053     gbbct49.seq
 249998896     gbbct5.seq
 249203036     gbbct50.seq
 246131774     gbbct51.seq
 239781961     gbbct52.seq
 248871195     gbbct53.seq
 248937342     gbbct54.seq
 245189646     gbbct55.seq
  49416026     gbbct56.seq
 244556687     gbbct57.seq
 245263215     gbbct58.seq
 239712447     gbbct59.seq
  55769385     gbbct6.seq
 247756206     gbbct60.seq
 239867033     gbbct61.seq
 247439975     gbbct62.seq
 249952698     gbbct63.seq
 247308463     gbbct64.seq
 238422884     gbbct65.seq
 244739614     gbbct66.seq
 247474935     gbbct67.seq
 239004060     gbbct68.seq
 246693402     gbbct69.seq
 238848006     gbbct7.seq
 100529052     gbbct70.seq
 248766081     gbbct71.seq
 248625196     gbbct72.seq
 249954382     gbbct73.seq
 246771179     gbbct74.seq
 240224090     gbbct75.seq
 243723193     gbbct76.seq
 249623468     gbbct77.seq
 243775979     gbbct78.seq
 246916033     gbbct79.seq
 161547469     gbbct8.seq
 247966600     gbbct80.seq
 244973004     gbbct81.seq
 241930272     gbbct82.seq
 243096411     gbbct83.seq
  93947272     gbbct84.seq
 249871219     gbbct85.seq
 245927990     gbbct86.seq
 245491428     gbbct87.seq
 247030442     gbbct88.seq
 249497885     gbbct89.seq
 248581205     gbbct9.seq
 246724017     gbbct90.seq
 248462212     gbbct91.seq
 241818041     gbbct92.seq
 246928934     gbbct93.seq
 248325240     gbbct94.seq
  26340214     gbbct95.seq
 249007206     gbbct96.seq
 239564228     gbbct97.seq
 249502506     gbbct98.seq
 245702805     gbbct99.seq
   5020589     gbchg.txt
 249688951     gbcon1.seq
 249996041     gbcon10.seq
  73407612     gbcon100.seq
 249998421     gbcon101.seq
 249998946     gbcon102.seq
 249996185     gbcon103.seq
 249995145     gbcon104.seq
 249998953     gbcon105.seq
  32427016     gbcon106.seq
 249994975     gbcon107.seq
 249999581     gbcon108.seq
 249997722     gbcon109.seq
 249495675     gbcon11.seq
 249997541     gbcon110.seq
 208220377     gbcon111.seq
 249992153     gbcon112.seq
 249998787     gbcon113.seq
 249995953     gbcon114.seq
 249999393     gbcon115.seq
 250000027     gbcon116.seq
 143584215     gbcon117.seq
 249995301     gbcon118.seq
 249999496     gbcon119.seq
 249896120     gbcon12.seq
 249998124     gbcon120.seq
 249999708     gbcon121.seq
 249996885     gbcon122.seq
 166460579     gbcon123.seq
 249995504     gbcon124.seq
 249997107     gbcon125.seq
 249999227     gbcon126.seq
 242947298     gbcon127.seq
 174526309     gbcon128.seq
 249996492     gbcon129.seq
 248213407     gbcon13.seq
 249997985     gbcon130.seq
  52243108     gbcon131.seq
 249998574     gbcon132.seq
 249985967     gbcon133.seq
 208854824     gbcon134.seq
 203092466     gbcon135.seq
 249999479     gbcon136.seq
 249124664     gbcon137.seq
 249563579     gbcon138.seq
 249995318     gbcon139.seq
 249551241     gbcon14.seq
 249998104     gbcon140.seq
 154473958     gbcon141.seq
 249997581     gbcon142.seq
 249492030     gbcon143.seq
 246625249     gbcon144.seq
 244014257     gbcon145.seq
 249999386     gbcon146.seq
 249915891     gbcon147.seq
 249994308     gbcon148.seq
  93611697     gbcon149.seq
 245562259     gbcon15.seq
 249999281     gbcon150.seq
 249963912     gbcon151.seq
 249042821     gbcon152.seq
 250000253     gbcon153.seq
 249996807     gbcon154.seq
 249959666     gbcon155.seq
 249298127     gbcon156.seq
 249998527     gbcon157.seq
 119075055     gbcon158.seq
 249998013     gbcon159.seq
 236986508     gbcon16.seq
 250000088     gbcon160.seq
 249559238     gbcon161.seq
 249999530     gbcon162.seq
 146743115     gbcon163.seq
 249999179     gbcon164.seq
 249999178     gbcon165.seq
 249999417     gbcon166.seq
 249999097     gbcon167.seq
 249998127     gbcon168.seq
 249443894     gbcon169.seq
 249835215     gbcon17.seq
 250000212     gbcon170.seq
 249976193     gbcon171.seq
  94321464     gbcon172.seq
 249999124     gbcon173.seq
 249995319     gbcon174.seq
 249999222     gbcon175.seq
 249998010     gbcon176.seq
 201769902     gbcon177.seq
 249997387     gbcon178.seq
 249870948     gbcon179.seq
 248106448     gbcon18.seq
 249995110     gbcon180.seq
 249111477     gbcon181.seq
 249930227     gbcon182.seq
 249997540     gbcon183.seq
 249936271     gbcon184.seq
 249910089     gbcon185.seq
 249999407     gbcon186.seq
 227916706     gbcon187.seq
 249999971     gbcon188.seq
 249992304     gbcon189.seq
 249700828     gbcon19.seq
 250000074     gbcon190.seq
 249998185     gbcon191.seq
 249963806     gbcon192.seq
 249999600     gbcon193.seq
  29946349     gbcon194.seq
 249999935     gbcon195.seq
 249998399     gbcon196.seq
 249694550     gbcon197.seq
 249849234     gbcon198.seq
 242270029     gbcon199.seq
 249756523     gbcon2.seq
 248148218     gbcon20.seq
 249999877     gbcon200.seq
 249999556     gbcon201.seq
 249999583     gbcon202.seq
 250000178     gbcon203.seq
 249998055     gbcon204.seq
 250000061     gbcon205.seq
 249910363     gbcon206.seq
 249999170     gbcon207.seq
 117912973     gbcon208.seq
 249999259     gbcon209.seq
 249997925     gbcon21.seq
 249999298     gbcon210.seq
 249996283     gbcon211.seq
 249998745     gbcon212.seq
 205607173     gbcon213.seq
 249996001     gbcon214.seq
 249998524     gbcon215.seq
 249999955     gbcon216.seq
 249998250     gbcon217.seq
 163866121     gbcon218.seq
 249992913     gbcon219.seq
  69997620     gbcon22.seq
 249997454     gbcon220.seq
 249997207     gbcon221.seq
 249418400     gbcon222.seq
 249998600     gbcon223.seq
 246517634     gbcon224.seq
 249999302     gbcon225.seq
 249998319     gbcon226.seq
 249995191     gbcon227.seq
 249998465     gbcon228.seq
 249983899     gbcon229.seq
 249993022     gbcon23.seq
 249997840     gbcon230.seq
 187807735     gbcon231.seq
 249998617     gbcon232.seq
 249995784     gbcon233.seq
 249998545     gbcon234.seq
 249998249     gbcon235.seq
 221900223     gbcon236.seq
 249998954     gbcon237.seq
 250000156     gbcon238.seq
 249998577     gbcon239.seq
 249999110     gbcon24.seq
 249999135     gbcon240.seq
 166924914     gbcon241.seq
 249998779     gbcon242.seq
 249999460     gbcon243.seq
 249860782     gbcon244.seq
 249998208     gbcon245.seq
 249999957     gbcon246.seq
 220213151     gbcon247.seq
 249997044     gbcon248.seq
 249233073     gbcon249.seq
 249998996     gbcon25.seq
 249893492     gbcon250.seq
 249999956     gbcon251.seq
 249993189     gbcon252.seq
 249999706     gbcon253.seq
 249972273     gbcon254.seq
 249999645     gbcon255.seq
  21668481     gbcon256.seq
 249997798     gbcon257.seq
 249999152     gbcon258.seq
 249949308     gbcon259.seq
 249997358     gbcon26.seq
 249998934     gbcon260.seq
 249995592     gbcon261.seq
 126794597     gbcon262.seq
 249998566     gbcon263.seq
 249964693     gbcon264.seq
 249940775     gbcon265.seq
 249998121     gbcon266.seq
 249977472     gbcon267.seq
 249998372     gbcon268.seq
 183103550     gbcon269.seq
 250000240     gbcon27.seq
 249999962     gbcon270.seq
 249996982     gbcon271.seq
 249987851     gbcon272.seq
 249998390     gbcon273.seq
 249998892     gbcon274.seq
 249999650     gbcon275.seq
 249999917     gbcon276.seq
  25046915     gbcon277.seq
 249994058     gbcon278.seq
 249975679     gbcon279.seq
 249999627     gbcon28.seq
 250000185     gbcon280.seq
 249992305     gbcon281.seq
 249998813     gbcon282.seq
 118248972     gbcon283.seq
 249999438     gbcon284.seq
 249997913     gbcon285.seq
 249998728     gbcon286.seq
 249832247     gbcon287.seq
 249995271     gbcon288.seq
 130300787     gbcon289.seq
  91646555     gbcon29.seq
 249998557     gbcon290.seq
 249953364     gbcon291.seq
 249999377     gbcon292.seq
 250000228     gbcon293.seq
 249876840     gbcon294.seq
 117414877     gbcon295.seq
 249994716     gbcon296.seq
 249994930     gbcon297.seq
 249988364     gbcon298.seq
 249958465     gbcon299.seq
 249659590     gbcon3.seq
 249998086     gbcon30.seq
 249994831     gbcon300.seq
 249999608     gbcon301.seq
 138731058     gbcon302.seq
 249407746     gbcon303.seq
 249984475     gbcon304.seq
 249853249     gbcon305.seq
 249998633     gbcon306.seq
 249999034     gbcon307.seq
 249991685     gbcon308.seq
 249999122     gbcon309.seq
 249999757     gbcon31.seq
 250000081     gbcon310.seq
 109973494     gbcon311.seq
 249673753     gbcon312.seq
 249998688     gbcon313.seq
 249992482     gbcon314.seq
 249936439     gbcon315.seq
 249939653     gbcon316.seq
 249999149     gbcon317.seq
  86605058     gbcon318.seq
 249996332     gbcon319.seq
 249999591     gbcon32.seq
 249998103     gbcon320.seq
 249999600     gbcon321.seq
 249999583     gbcon322.seq
 249998680     gbcon323.seq
 249919945     gbcon324.seq
 249998730     gbcon325.seq
 249998178     gbcon326.seq
  77091952     gbcon327.seq
 249999793     gbcon328.seq
 249998403     gbcon329.seq
 249998463     gbcon33.seq
 249990213     gbcon330.seq
 249995542     gbcon331.seq
 249993515     gbcon332.seq
 249898195     gbcon333.seq
 249999052     gbcon334.seq
 249998285     gbcon335.seq
 249998905     gbcon336.seq
 249999989     gbcon337.seq
  26875042     gbcon338.seq
 250000009     gbcon339.seq
 244699093     gbcon34.seq
 249999657     gbcon340.seq
 249999310     gbcon341.seq
 249998557     gbcon342.seq
  42833441     gbcon343.seq
 249998287     gbcon344.seq
 249999132     gbcon345.seq
 249987580     gbcon346.seq
 249996440     gbcon347.seq
 250000108     gbcon348.seq
 249997035     gbcon349.seq
 249999415     gbcon35.seq
 249999570     gbcon350.seq
  45867198     gbcon351.seq
    206008     gbcon352.seq
 249999248     gbcon36.seq
  18695951     gbcon37.seq
 249997702     gbcon38.seq
 248806791     gbcon39.seq
 249666161     gbcon4.seq
 133502566     gbcon40.seq
 129847485     gbcon41.seq
 249996964     gbcon42.seq
 248492228     gbcon43.seq
 249997137     gbcon44.seq
 249998711     gbcon45.seq
 125645945     gbcon46.seq
 249998408     gbcon47.seq
 249999994     gbcon48.seq
 249998690     gbcon49.seq
 249998590     gbcon5.seq
 249999465     gbcon50.seq
 249969570     gbcon51.seq
 215826295     gbcon52.seq
 249995573     gbcon53.seq
 249996408     gbcon54.seq
 249994120     gbcon55.seq
 249994952     gbcon56.seq
 249998384     gbcon57.seq
 249996413     gbcon58.seq
  73437195     gbcon59.seq
 249881762     gbcon6.seq
 249998712     gbcon60.seq
 249998158     gbcon61.seq
 249996631     gbcon62.seq
 249998184     gbcon63.seq
 249997010     gbcon64.seq
  53203903     gbcon65.seq
 249995129     gbcon66.seq
 249997080     gbcon67.seq
 249999244     gbcon68.seq
 249997768     gbcon69.seq
 199375157     gbcon7.seq
 249999302     gbcon70.seq
  46505761     gbcon71.seq
 249997479     gbcon72.seq
 250000123     gbcon73.seq
 249999337     gbcon74.seq
 249997135     gbcon75.seq
 249996958     gbcon76.seq
 163671197     gbcon77.seq
 249996154     gbcon78.seq
 250000031     gbcon79.seq
 249993350     gbcon8.seq
 249995010     gbcon80.seq
 249997630     gbcon81.seq
 194598585     gbcon82.seq
 249997650     gbcon83.seq
 249997746     gbcon84.seq
 249995972     gbcon85.seq
 249996499     gbcon86.seq
 249998163     gbcon87.seq
   7197220     gbcon88.seq
 249996246     gbcon89.seq
 246642676     gbcon9.seq
 249997498     gbcon90.seq
 249996448     gbcon91.seq
 249998072     gbcon92.seq
 249997897     gbcon93.seq
 108419384     gbcon94.seq
 249999177     gbcon95.seq
 250000223     gbcon96.seq
 249994923     gbcon97.seq
 249998335     gbcon98.seq
 249999420     gbcon99.seq
    352620     gbdel.txt
 249998729     gbenv1.seq
 249998899     gbenv10.seq
 249998310     gbenv11.seq
 249998284     gbenv12.seq
  61068646     gbenv13.seq
 249999441     gbenv14.seq
 249999142     gbenv15.seq
 249999746     gbenv16.seq
 249999712     gbenv17.seq
 249998407     gbenv18.seq
 249999852     gbenv19.seq
 249999055     gbenv2.seq
 249997739     gbenv20.seq
 249998328     gbenv21.seq
   8273337     gbenv22.seq
 249998010     gbenv23.seq
 249999931     gbenv24.seq
 249998383     gbenv25.seq
 249999091     gbenv26.seq
 182408259     gbenv27.seq
 249998298     gbenv28.seq
 249955247     gbenv29.seq
 249999687     gbenv3.seq
 250000255     gbenv30.seq
 249999346     gbenv31.seq
 249999677     gbenv32.seq
 249998675     gbenv33.seq
  73601529     gbenv34.seq
 249999624     gbenv35.seq
 249998313     gbenv36.seq
 249998828     gbenv37.seq
 249996811     gbenv38.seq
 187893812     gbenv39.seq
 249998479     gbenv4.seq
 249999740     gbenv40.seq
 249997995     gbenv41.seq
 249997930     gbenv42.seq
 249997695     gbenv43.seq
 249999661     gbenv44.seq
 249997289     gbenv45.seq
  54559275     gbenv46.seq
 250000160     gbenv47.seq
 249999360     gbenv48.seq
 249998431     gbenv49.seq
 246351028     gbenv5.seq
 249999573     gbenv50.seq
 199436389     gbenv51.seq
 249999750     gbenv52.seq
 249999381     gbenv53.seq
 249999079     gbenv54.seq
 249998163     gbenv55.seq
 249999778     gbenv56.seq
  89478222     gbenv57.seq
 249999071     gbenv58.seq
 250000139     gbenv59.seq
 249999065     gbenv6.seq
 249998249     gbenv60.seq
 249998044     gbenv61.seq
 249998514     gbenv62.seq
 221814251     gbenv63.seq
 249998540     gbenv64.seq
 249997747     gbenv65.seq
 249998329     gbenv66.seq
 249998854     gbenv67.seq
 250000098     gbenv68.seq
  93189154     gbenv69.seq
 249997711     gbenv7.seq
 250000195     gbenv70.seq
 249999498     gbenv71.seq
 250000191     gbenv72.seq
 249999275     gbenv73.seq
 249999095     gbenv74.seq
 153011816     gbenv75.seq
 249999221     gbenv76.seq
 249998812     gbenv77.seq
 249997689     gbenv78.seq
 249999157     gbenv79.seq
 151653072     gbenv8.seq
 249998163     gbenv80.seq
  98101551     gbenv81.seq
 249999038     gbenv82.seq
 249998320     gbenv83.seq
 249998245     gbenv84.seq
 250000177     gbenv85.seq
 188493693     gbenv86.seq
 249999302     gbenv87.seq
 249999657     gbenv88.seq
 249998809     gbenv89.seq
 249999942     gbenv9.seq
 249999878     gbenv90.seq
 249998406     gbenv91.seq
 250000172     gbenv92.seq
 138864929     gbenv93.seq
 524289610     gbest1.seq
 524288846     gbest10.seq
 524289081     gbest100.seq
 524291315     gbest101.seq
 524289364     gbest102.seq
 524290598     gbest103.seq
 351987771     gbest104.seq
 524291441     gbest105.seq
 524290817     gbest106.seq
 524289728     gbest107.seq
 382655422     gbest108.seq
 386099419     gbest109.seq
 524290671     gbest11.seq
 379997094     gbest110.seq
 380732844     gbest111.seq
 377637454     gbest112.seq
 381814445     gbest113.seq
 386019645     gbest114.seq
 385194800     gbest115.seq
 384028559     gbest116.seq
 380337472     gbest117.seq
 403509258     gbest118.seq
 482056114     gbest119.seq
 524290855     gbest12.seq
 524290513     gbest120.seq
 524291433     gbest121.seq
 524289815     gbest122.seq
 524290471     gbest123.seq
 474154755     gbest124.seq
 524290456     gbest125.seq
 524288736     gbest126.seq
 524289292     gbest127.seq
 524290161     gbest128.seq
 524290445     gbest129.seq
 146304222     gbest13.seq
 524290591     gbest130.seq
 524290236     gbest131.seq
 524289504     gbest132.seq
 524291380     gbest133.seq
 524289511     gbest134.seq
 524291856     gbest135.seq
 524290550     gbest136.seq
 290106320     gbest137.seq
 524290195     gbest138.seq
 524292163     gbest139.seq
 524290616     gbest14.seq
 524288963     gbest140.seq
 524291936     gbest141.seq
 524293150     gbest142.seq
 524291130     gbest143.seq
 524289888     gbest144.seq
 524289405     gbest145.seq
 524290321     gbest146.seq
 524289255     gbest147.seq
 524291799     gbest148.seq
 524291737     gbest149.seq
 524290798     gbest15.seq
 524289208     gbest150.seq
 469744612     gbest151.seq
 524289152     gbest152.seq
 524289615     gbest153.seq
 524292070     gbest154.seq
 524290439     gbest155.seq
 524289709     gbest156.seq
 524290083     gbest157.seq
 524290094     gbest158.seq
 524289142     gbest159.seq
 524289533     gbest16.seq
 524290957     gbest160.seq
 524292554     gbest161.seq
 524288938     gbest162.seq
 524289262     gbest163.seq
 239259394     gbest164.seq
 524290748     gbest165.seq
 524290497     gbest166.seq
 524290433     gbest167.seq
 524290726     gbest168.seq
 524289580     gbest169.seq
 524290909     gbest17.seq
 524291626     gbest170.seq
 524290736     gbest171.seq
 524292239     gbest172.seq
 524289024     gbest173.seq
 524288848     gbest174.seq
 524290530     gbest175.seq
 524289086     gbest176.seq
 524290694     gbest177.seq
  92290779     gbest178.seq
 524288887     gbest179.seq
 524289517     gbest18.seq
 524290228     gbest180.seq
 524290198     gbest181.seq
 524290734     gbest182.seq
 524289961     gbest183.seq
 524288889     gbest184.seq
 524290389     gbest185.seq
 524289707     gbest186.seq
 524290732     gbest187.seq
 524289653     gbest188.seq
 524290052     gbest189.seq
 524290337     gbest19.seq
 524289435     gbest190.seq
 458870547     gbest191.seq
 524292666     gbest192.seq
 524289282     gbest193.seq
 524292147     gbest194.seq
 524290087     gbest195.seq
 524289700     gbest196.seq
 524288922     gbest197.seq
 524289132     gbest198.seq
 524289249     gbest199.seq
 524289133     gbest2.seq
 524289835     gbest20.seq
 524289450     gbest200.seq
 524291745     gbest201.seq
 524291407     gbest202.seq
 524291629     gbest203.seq
 524288816     gbest204.seq
  40866745     gbest205.seq
 524289967     gbest206.seq
 524290340     gbest207.seq
 524289842     gbest208.seq
 524290955     gbest209.seq
 524290684     gbest21.seq
 524288769     gbest210.seq
 524290151     gbest211.seq
 524292221     gbest212.seq
 524293122     gbest213.seq
 524289780     gbest214.seq
 524290227     gbest215.seq
 472767011     gbest216.seq
 524289582     gbest217.seq
 524290596     gbest218.seq
 524290945     gbest219.seq
 492351874     gbest22.seq
 524290968     gbest220.seq
 524289041     gbest221.seq
 524289139     gbest222.seq
 524290470     gbest223.seq
 524292015     gbest224.seq
 524291287     gbest225.seq
 524291290     gbest226.seq
 524289383     gbest227.seq
 524289913     gbest228.seq
 462561185     gbest229.seq
 491397661     gbest23.seq
 524290004     gbest230.seq
 524292405     gbest231.seq
 524291830     gbest232.seq
 524291608     gbest233.seq
 524291471     gbest234.seq
 524291072     gbest235.seq
 524292019     gbest236.seq
 524290975     gbest237.seq
 524290938     gbest238.seq
 524291592     gbest239.seq
 502307584     gbest24.seq
 524289188     gbest240.seq
 524290188     gbest241.seq
 524291878     gbest242.seq
 524291440     gbest243.seq
 248079118     gbest244.seq
 524289950     gbest245.seq
 524291251     gbest246.seq
 524290042     gbest247.seq
 524289119     gbest248.seq
 524288758     gbest249.seq
 326341786     gbest25.seq
 524290302     gbest250.seq
 524289237     gbest251.seq
 520302695     gbest252.seq
 524290730     gbest253.seq
 524289879     gbest254.seq
 524290272     gbest255.seq
 332774875     gbest256.seq
 524289188     gbest257.seq
 524290518     gbest258.seq
 524291328     gbest259.seq
 524290540     gbest26.seq
 524289638     gbest260.seq
 524290027     gbest261.seq
 524289684     gbest262.seq
 524290072     gbest263.seq
 524288732     gbest264.seq
 524289152     gbest265.seq
 524288787     gbest266.seq
 218447297     gbest267.seq
 524290889     gbest268.seq
 524291638     gbest269.seq
 524289076     gbest27.seq
 524291251     gbest270.seq
 524292351     gbest271.seq
 524290358     gbest272.seq
 524289265     gbest273.seq
 524290514     gbest274.seq
 524289871     gbest275.seq
 524291877     gbest276.seq
 524290048     gbest277.seq
 524289583     gbest278.seq
 371256572     gbest279.seq
 524290035     gbest28.seq
 524289925     gbest280.seq
 524289831     gbest281.seq
 524290299     gbest282.seq
 524289499     gbest283.seq
 524290479     gbest284.seq
 524289637     gbest285.seq
 524288736     gbest286.seq
 524291752     gbest287.seq
 524289161     gbest288.seq
 524291038     gbest289.seq
 524294034     gbest29.seq
 524291303     gbest290.seq
 289494362     gbest291.seq
 524290045     gbest292.seq
 524290958     gbest293.seq
 524290484     gbest294.seq
 524290633     gbest295.seq
 524290232     gbest296.seq
 524289363     gbest297.seq
 524288993     gbest298.seq
 524288782     gbest299.seq
 488091336     gbest3.seq
 524290592     gbest30.seq
 524289537     gbest300.seq
 524290833     gbest301.seq
 469659979     gbest302.seq
 324105416     gbest303.seq
 475497685     gbest304.seq
 472632901     gbest305.seq
 524290063     gbest306.seq
 524290378     gbest307.seq
 524290766     gbest308.seq
 524288848     gbest309.seq
 524289010     gbest31.seq
 524292893     gbest310.seq
 524289347     gbest311.seq
 524289411     gbest312.seq
 524290627     gbest313.seq
 524291023     gbest314.seq
 524291627     gbest315.seq
 379294837     gbest316.seq
 524291691     gbest317.seq
 524289933     gbest318.seq
 524289070     gbest319.seq
 524289199     gbest32.seq
 524289585     gbest320.seq
 524289265     gbest321.seq
 524290884     gbest322.seq
 524290944     gbest323.seq
 524289450     gbest324.seq
 524291435     gbest325.seq
 524289813     gbest326.seq
 524290708     gbest327.seq
 514168970     gbest328.seq
 517235960     gbest329.seq
 524290617     gbest33.seq
 231009678     gbest330.seq
 524290618     gbest331.seq
 524289660     gbest332.seq
 524290205     gbest333.seq
 524291228     gbest334.seq
 524290361     gbest335.seq
 524290976     gbest336.seq
 494738673     gbest337.seq
 524292207     gbest338.seq
 524289592     gbest339.seq
 509451094     gbest34.seq
 524288795     gbest340.seq
 524290614     gbest341.seq
 524289368     gbest342.seq
 524289344     gbest343.seq
 334345801     gbest344.seq
 524291314     gbest345.seq
 524290188     gbest346.seq
 524289186     gbest347.seq
 524291804     gbest348.seq
 524289701     gbest349.seq
 486412494     gbest35.seq
 524292082     gbest350.seq
 510772983     gbest351.seq
 524288873     gbest352.seq
 524289649     gbest353.seq
 524295350     gbest354.seq
 524289283     gbest355.seq
 524288797     gbest356.seq
 524290053     gbest357.seq
 524291986     gbest358.seq
 142908036     gbest359.seq
 488144371     gbest36.seq
 524288921     gbest360.seq
 524289070     gbest361.seq
 524291020     gbest362.seq
 524289333     gbest363.seq
 524289788     gbest364.seq
 524289238     gbest365.seq
 524291715     gbest366.seq
 524291107     gbest367.seq
 524289536     gbest368.seq
 524289531     gbest369.seq
 486961608     gbest37.seq
 524289891     gbest370.seq
  66108217     gbest371.seq
 524290157     gbest372.seq
 524291019     gbest373.seq
 524291159     gbest374.seq
 524290823     gbest375.seq
 524289557     gbest376.seq
 524290346     gbest377.seq
 492693989     gbest378.seq
 524289318     gbest379.seq
 481688002     gbest38.seq
 524288756     gbest380.seq
 524292104     gbest381.seq
 524291866     gbest382.seq
 265922078     gbest383.seq
 524290766     gbest384.seq
 524290948     gbest385.seq
 524289967     gbest386.seq
 524289636     gbest387.seq
 524288987     gbest388.seq
 524289078     gbest389.seq
 485612724     gbest39.seq
 524290393     gbest390.seq
 524291055     gbest391.seq
 524290362     gbest392.seq
 524292593     gbest393.seq
 206590699     gbest394.seq
 524289417     gbest395.seq
 524290058     gbest396.seq
 524289917     gbest397.seq
 524289370     gbest398.seq
 524289623     gbest399.seq
 524290360     gbest4.seq
 134655447     gbest40.seq
 524288841     gbest400.seq
 524289684     gbest401.seq
 524289736     gbest402.seq
 524291704     gbest403.seq
 524290440     gbest404.seq
 524290015     gbest405.seq
 524291269     gbest406.seq
 417165692     gbest407.seq
 524289968     gbest408.seq
 524289502     gbest409.seq
 524288883     gbest41.seq
 524290803     gbest410.seq
 524291778     gbest411.seq
 524291054     gbest412.seq
 524289176     gbest413.seq
 524291244     gbest414.seq
 524288987     gbest415.seq
 524290483     gbest416.seq
 524290065     gbest417.seq
 524289859     gbest418.seq
 524290340     gbest419.seq
 524162079     gbest42.seq
 524290074     gbest420.seq
   1816408     gbest421.seq
 524290671     gbest422.seq
 524288966     gbest423.seq
 524289302     gbest424.seq
 524289380     gbest425.seq
 524289783     gbest426.seq
 524293585     gbest427.seq
 524291740     gbest428.seq
 524293746     gbest429.seq
 524289370     gbest43.seq
 524289068     gbest430.seq
 524289094     gbest431.seq
 524292105     gbest432.seq
 524290389     gbest433.seq
 524291994     gbest434.seq
 524289089     gbest435.seq
 130457135     gbest436.seq
 524289709     gbest437.seq
 524290299     gbest438.seq
 524291511     gbest439.seq
 524289536     gbest44.seq
 524289297     gbest440.seq
 524290393     gbest441.seq
 524291147     gbest442.seq
 524290928     gbest443.seq
 524290371     gbest444.seq
 524292286     gbest445.seq
 524289110     gbest446.seq
 524291706     gbest447.seq
 524290157     gbest448.seq
 163008027     gbest449.seq
 524290345     gbest45.seq
 524289591     gbest450.seq
 524290621     gbest451.seq
 524290266     gbest452.seq
 524288766     gbest453.seq
 524290734     gbest454.seq
 524289900     gbest455.seq
 524290162     gbest456.seq
 524291108     gbest457.seq
 524290692     gbest458.seq
 524290695     gbest459.seq
 524289018     gbest46.seq
 482943530     gbest460.seq
 524290919     gbest461.seq
 524290941     gbest462.seq
 524289645     gbest463.seq
 524289471     gbest464.seq
 524288852     gbest465.seq
 524290739     gbest466.seq
 524293915     gbest467.seq
 524289815     gbest468.seq
 524291445     gbest469.seq
 524290845     gbest47.seq
 524290055     gbest470.seq
 524288802     gbest471.seq
 369182962     gbest472.seq
 524291474     gbest473.seq
 524289976     gbest474.seq
 524289403     gbest475.seq
 524289386     gbest476.seq
 524289670     gbest477.seq
 524290280     gbest478.seq
 524289017     gbest479.seq
 524290793     gbest48.seq
 524292239     gbest480.seq
 311460546     gbest481.seq
 524289593     gbest49.seq
 524291216     gbest5.seq
 524292467     gbest50.seq
 524290052     gbest51.seq
 524289680     gbest52.seq
 524290974     gbest53.seq
 236907884     gbest54.seq
 524290177     gbest55.seq
 524290969     gbest56.seq
 524289335     gbest57.seq
 524290477     gbest58.seq
 524289676     gbest59.seq
 524289922     gbest6.seq
 524289145     gbest60.seq
 524291725     gbest61.seq
 524291459     gbest62.seq
 524289162     gbest63.seq
 524289409     gbest64.seq
 524290081     gbest65.seq
 524290333     gbest66.seq
 446779180     gbest67.seq
 524288966     gbest68.seq
 524290244     gbest69.seq
 524291651     gbest7.seq
 524290980     gbest70.seq
 524289127     gbest71.seq
 524290075     gbest72.seq
 524288757     gbest73.seq
 524289441     gbest74.seq
 524290576     gbest75.seq
 524297822     gbest76.seq
 524289829     gbest77.seq
 524292236     gbest78.seq
 524288779     gbest79.seq
 524291395     gbest8.seq
 166192305     gbest80.seq
 524289521     gbest81.seq
 524290668     gbest82.seq
 524288876     gbest83.seq
 524290208     gbest84.seq
 524290966     gbest85.seq
 524292005     gbest86.seq
 524289858     gbest87.seq
 524292217     gbest88.seq
 524288994     gbest89.seq
 524290048     gbest9.seq
 524291284     gbest90.seq
 524289593     gbest91.seq
 447798214     gbest92.seq
 524291742     gbest93.seq
 524290738     gbest94.seq
 524290251     gbest95.seq
 524289700     gbest96.seq
 524290553     gbest97.seq
 524289944     gbest98.seq
 524290982     gbest99.seq
 524289602     gbgss1.seq
 524290500     gbgss10.seq
 524289254     gbgss100.seq
 524291942     gbgss101.seq
 524292263     gbgss102.seq
 524289515     gbgss103.seq
 416309963     gbgss104.seq
 524291750     gbgss105.seq
 524290573     gbgss106.seq
 524290089     gbgss107.seq
 524288810     gbgss108.seq
 524291185     gbgss109.seq
 524289284     gbgss11.seq
 524288961     gbgss110.seq
 524290007     gbgss111.seq
 524289239     gbgss112.seq
 524290752     gbgss113.seq
 524288726     gbgss114.seq
 524289139     gbgss115.seq
  51468520     gbgss116.seq
 524289221     gbgss117.seq
 524289457     gbgss118.seq
 524289853     gbgss119.seq
 524292298     gbgss12.seq
 524288824     gbgss120.seq
 524290967     gbgss121.seq
 524290649     gbgss122.seq
 524289095     gbgss123.seq
 524290448     gbgss124.seq
 524289588     gbgss125.seq
 524291829     gbgss126.seq
 524292539     gbgss127.seq
 524288774     gbgss128.seq
 198255718     gbgss129.seq
 524292285     gbgss13.seq
 524289462     gbgss130.seq
 524289011     gbgss131.seq
 524290462     gbgss132.seq
 524290721     gbgss133.seq
 524289833     gbgss134.seq
 524289865     gbgss135.seq
 524289563     gbgss136.seq
 524289136     gbgss137.seq
 524289328     gbgss138.seq
 506004286     gbgss139.seq
 524288857     gbgss14.seq
 498420394     gbgss140.seq
 179574002     gbgss141.seq
 524289563     gbgss142.seq
 524290105     gbgss143.seq
 524288725     gbgss144.seq
 524289456     gbgss145.seq
 524289055     gbgss146.seq
 524289089     gbgss147.seq
 524290996     gbgss148.seq
 524289844     gbgss149.seq
 524291189     gbgss15.seq
 524289981     gbgss150.seq
 524291116     gbgss151.seq
 327428451     gbgss152.seq
 524289503     gbgss153.seq
 524291231     gbgss154.seq
 524292658     gbgss155.seq
 524288988     gbgss156.seq
 524290530     gbgss157.seq
 524291062     gbgss158.seq
 524291090     gbgss159.seq
 524291184     gbgss16.seq
 524289253     gbgss160.seq
 524290853     gbgss161.seq
 524290380     gbgss162.seq
 524290657     gbgss163.seq
 524291645     gbgss164.seq
 129497132     gbgss165.seq
 524290110     gbgss166.seq
 524290613     gbgss167.seq
 524290430     gbgss168.seq
 524288955     gbgss169.seq
 524289316     gbgss17.seq
 524290896     gbgss170.seq
 524290022     gbgss171.seq
 524289097     gbgss172.seq
  26472610     gbgss173.seq
 249998446     gbgss174.seq
 249997727     gbgss175.seq
 249998129     gbgss176.seq
 249997964     gbgss177.seq
  31810345     gbgss178.seq
 249997137     gbgss179.seq
 524290079     gbgss18.seq
 250000033     gbgss180.seq
 249998542     gbgss181.seq
 249998333     gbgss182.seq
 224919493     gbgss183.seq
 249998415     gbgss184.seq
 249999205     gbgss185.seq
 249999508     gbgss186.seq
 250000175     gbgss187.seq
 193957356     gbgss188.seq
 249997950     gbgss189.seq
 302710482     gbgss19.seq
 249998694     gbgss190.seq
 249998786     gbgss191.seq
 249999485     gbgss192.seq
 249997276     gbgss193.seq
  71085900     gbgss194.seq
 249999828     gbgss195.seq
   2112081     gbgss196.seq
  80349448     gbgss197.seq
 249999264     gbgss198.seq
 249998529     gbgss199.seq
 524290458     gbgss2.seq
 524289867     gbgss20.seq
  87602941     gbgss200.seq
 249999685     gbgss201.seq
 249998355     gbgss202.seq
 250000242     gbgss203.seq
 202974017     gbgss204.seq
 249999232     gbgss205.seq
 249999415     gbgss206.seq
 249999535     gbgss207.seq
 246297144     gbgss208.seq
 249997836     gbgss209.seq
 524290010     gbgss21.seq
 249999647     gbgss210.seq
 249998223     gbgss211.seq
 244710946     gbgss212.seq
 249999336     gbgss213.seq
 249996623     gbgss214.seq
 249999794     gbgss215.seq
 249996718     gbgss216.seq
 126591595     gbgss217.seq
 249997387     gbgss218.seq
 249997998     gbgss219.seq
 524289712     gbgss22.seq
 249999931     gbgss220.seq
 249998615     gbgss221.seq
  92409107     gbgss222.seq
 249999742     gbgss223.seq
 249999443     gbgss224.seq
 249998584     gbgss225.seq
 249998226     gbgss226.seq
 249999180     gbgss227.seq
 143902147     gbgss228.seq
 249997846     gbgss229.seq
 524291691     gbgss23.seq
 249999124     gbgss230.seq
 249997821     gbgss231.seq
 249997789     gbgss232.seq
  84917634     gbgss233.seq
 249999461     gbgss234.seq
 249999350     gbgss235.seq
 249998406     gbgss236.seq
 249998619     gbgss237.seq
 249999398     gbgss238.seq
 249998013     gbgss239.seq
 524290555     gbgss24.seq
 108071868     gbgss240.seq
 249999266     gbgss241.seq
 249999352     gbgss242.seq
 249999943     gbgss243.seq
  56997815     gbgss244.seq
  53334267     gbgss245.seq
 249999101     gbgss246.seq
 249999225     gbgss247.seq
 249999246     gbgss248.seq
 250000245     gbgss249.seq
 524289673     gbgss25.seq
 249999181     gbgss250.seq
 249997776     gbgss251.seq
 212341896     gbgss252.seq
 249999617     gbgss253.seq
 250000113     gbgss254.seq
 249997380     gbgss255.seq
 249999823     gbgss256.seq
  27507329     gbgss257.seq
 249997661     gbgss258.seq
 249999221     gbgss259.seq
 524290090     gbgss26.seq
 249996423     gbgss260.seq
 249997687     gbgss261.seq
 249999776     gbgss262.seq
 249999649     gbgss263.seq
 191301715     gbgss264.seq
 249998299     gbgss265.seq
 249999964     gbgss266.seq
 249999490     gbgss267.seq
 227730674     gbgss268.seq
 249998576     gbgss269.seq
 524291868     gbgss27.seq
 249998098     gbgss270.seq
 249998682     gbgss271.seq
 249996687     gbgss272.seq
 249999743     gbgss273.seq
 247286766     gbgss274.seq
 250000057     gbgss275.seq
 249997972     gbgss276.seq
 249999582     gbgss277.seq
 249999204     gbgss278.seq
 115685860     gbgss279.seq
 524290601     gbgss28.seq
 249997259     gbgss280.seq
 249999095     gbgss281.seq
 249998043     gbgss282.seq
 249997345     gbgss283.seq
 204505883     gbgss284.seq
 249999562     gbgss285.seq
 249998752     gbgss286.seq
 249999600     gbgss287.seq
 249999029     gbgss288.seq
 221982324     gbgss289.seq
 524289057     gbgss29.seq
 249999829     gbgss290.seq
 250000049     gbgss291.seq
 249999422     gbgss292.seq
 249998101     gbgss293.seq
  91611181     gbgss294.seq
 249998405     gbgss295.seq
 250000147     gbgss296.seq
 249999022     gbgss297.seq
 249998978     gbgss298.seq
 249999550     gbgss299.seq
 524288872     gbgss3.seq
 524289261     gbgss30.seq
 249998835     gbgss300.seq
 108978147     gbgss301.seq
  60088870     gbgss31.seq
 524290519     gbgss32.seq
 524289255     gbgss33.seq
 524288764     gbgss34.seq
 524290929     gbgss35.seq
 524290668     gbgss36.seq
 524289417     gbgss37.seq
 524290284     gbgss38.seq
 498944842     gbgss39.seq
 524291733     gbgss4.seq
 524289552     gbgss40.seq
 524289435     gbgss41.seq
 524289313     gbgss42.seq
  38917168     gbgss43.seq
 524289606     gbgss44.seq
 524289441     gbgss45.seq
 524289594     gbgss46.seq
 524289715     gbgss47.seq
 226129352     gbgss48.seq
 524289088     gbgss49.seq
 160046964     gbgss5.seq
 524291855     gbgss50.seq
 524289535     gbgss51.seq
 524290785     gbgss52.seq
 524290960     gbgss53.seq
 524290649     gbgss54.seq
 524292081     gbgss55.seq
 524291175     gbgss56.seq
 524290575     gbgss57.seq
 524290520     gbgss58.seq
 524289425     gbgss59.seq
 524290099     gbgss6.seq
  46334690     gbgss60.seq
 524291227     gbgss61.seq
 524290061     gbgss62.seq
 524290658     gbgss63.seq
 455615509     gbgss64.seq
 524289704     gbgss65.seq
 524289680     gbgss66.seq
 524289341     gbgss67.seq
 524290292     gbgss68.seq
 524291888     gbgss69.seq
 524290304     gbgss7.seq
 524291250     gbgss70.seq
 524291845     gbgss71.seq
 524288746     gbgss72.seq
 524291703     gbgss73.seq
 524289230     gbgss74.seq
 524289809     gbgss75.seq
 524290639     gbgss76.seq
  39967170     gbgss77.seq
 524291041     gbgss78.seq
 524291927     gbgss79.seq
 524289887     gbgss8.seq
 524289538     gbgss80.seq
 524290623     gbgss81.seq
 524291425     gbgss82.seq
 524288795     gbgss83.seq
 524290547     gbgss84.seq
 524288917     gbgss85.seq
 524290252     gbgss86.seq
 524289433     gbgss87.seq
 524292398     gbgss88.seq
 385930798     gbgss89.seq
 524290677     gbgss9.seq
 524292344     gbgss90.seq
 524292444     gbgss91.seq
 524289266     gbgss92.seq
 524292472     gbgss93.seq
 524290689     gbgss94.seq
 524292079     gbgss95.seq
 524289433     gbgss96.seq
 524290383     gbgss97.seq
 524292130     gbgss98.seq
 524291272     gbgss99.seq
 249989230     gbhtc1.seq
 249997052     gbhtc10.seq
 249998967     gbhtc11.seq
 114132969     gbhtc12.seq
 250000092     gbhtc13.seq
 249999911     gbhtc14.seq
 142959095     gbhtc15.seq
 249995319     gbhtc2.seq
 249993906     gbhtc3.seq
 249998396     gbhtc4.seq
 249989366     gbhtc5.seq
 249989186     gbhtc6.seq
 249996567     gbhtc7.seq
  85908087     gbhtc8.seq
 249998301     gbhtc9.seq
 249935508     gbhtg1.seq
 249953451     gbhtg10.seq
 249912439     gbhtg100.seq
 249866482     gbhtg101.seq
 249548804     gbhtg102.seq
 249905568     gbhtg103.seq
   3688468     gbhtg104.seq
 249815335     gbhtg105.seq
 249888148     gbhtg106.seq
 249851229     gbhtg107.seq
 249907584     gbhtg108.seq
 249989197     gbhtg109.seq
    799345     gbhtg11.seq
 249789219     gbhtg110.seq
 167859406     gbhtg111.seq
 249871484     gbhtg112.seq
 249961061     gbhtg113.seq
 249891820     gbhtg114.seq
 249930745     gbhtg115.seq
 249804783     gbhtg116.seq
 249885242     gbhtg117.seq
 249996057     gbhtg118.seq
 219373320     gbhtg119.seq
 249887872     gbhtg12.seq
 249852224     gbhtg120.seq
 249901917     gbhtg121.seq
 249988304     gbhtg122.seq
 249907211     gbhtg123.seq
 249918797     gbhtg124.seq
 249974119     gbhtg125.seq
 249870359     gbhtg126.seq
 249931510     gbhtg127.seq
 249998163     gbhtg128.seq
 249850987     gbhtg129.seq
 249967619     gbhtg13.seq
 249658310     gbhtg130.seq
 249978968     gbhtg131.seq
 249777703     gbhtg132.seq
 246328157     gbhtg133.seq
 249729843     gbhtg134.seq
 249950497     gbhtg135.seq
 141393711     gbhtg136.seq
 249860825     gbhtg137.seq
 249838305     gbhtg138.seq
 249821150     gbhtg139.seq
 249584228     gbhtg14.seq
 249911256     gbhtg140.seq
 249828373     gbhtg141.seq
 134515756     gbhtg142.seq
 249956969     gbhtg143.seq
 249784790     gbhtg144.seq
 249834009     gbhtg145.seq
 249921101     gbhtg146.seq
 249904341     gbhtg147.seq
 249953953     gbhtg148.seq
 249843412     gbhtg149.seq
 249771919     gbhtg15.seq
 249934650     gbhtg150.seq
 249927429     gbhtg151.seq
 249848160     gbhtg152.seq
 225848111     gbhtg153.seq
 249738514     gbhtg16.seq
 249165958     gbhtg17.seq
 249980023     gbhtg18.seq
 249676824     gbhtg19.seq
 249996522     gbhtg2.seq
 249986149     gbhtg20.seq
 237141818     gbhtg21.seq
 249756771     gbhtg22.seq
 249864682     gbhtg23.seq
 249983387     gbhtg24.seq
 249917977     gbhtg25.seq
 249757014     gbhtg26.seq
 249887744     gbhtg27.seq
 249957955     gbhtg28.seq
 249838343     gbhtg29.seq
 249996216     gbhtg3.seq
 249989516     gbhtg30.seq
 225321862     gbhtg31.seq
 249823624     gbhtg32.seq
 249917494     gbhtg33.seq
 249925313     gbhtg34.seq
 249914652     gbhtg35.seq
 249854042     gbhtg36.seq
 249811834     gbhtg37.seq
 249764454     gbhtg38.seq
 249623490     gbhtg39.seq
 249972436     gbhtg4.seq
 249836303     gbhtg40.seq
 224358179     gbhtg41.seq
 249873953     gbhtg42.seq
 249782842     gbhtg43.seq
 249972744     gbhtg44.seq
 249775813     gbhtg45.seq
 249969730     gbhtg46.seq
 249708936     gbhtg47.seq
 249863648     gbhtg48.seq
 249890163     gbhtg49.seq
 249908832     gbhtg5.seq
 249900107     gbhtg50.seq
 234820301     gbhtg51.seq
 249734715     gbhtg52.seq
 249972831     gbhtg53.seq
 249785177     gbhtg54.seq
 249720551     gbhtg55.seq
 249959801     gbhtg56.seq
  18795879     gbhtg57.seq
 249860951     gbhtg58.seq
 249828685     gbhtg59.seq
 249992589     gbhtg6.seq
 249998409     gbhtg60.seq
 249924871     gbhtg61.seq
 225131281     gbhtg62.seq
 249885325     gbhtg63.seq
 249908283     gbhtg64.seq
 249801379     gbhtg65.seq
 249764001     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249985806     gbhtg69.seq
 249808286     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249769227     gbhtg72.seq
 223428522     gbhtg73.seq
 249948289     gbhtg74.seq
 249890381     gbhtg75.seq
 249852564     gbhtg76.seq
 249954375     gbhtg77.seq
 235178036     gbhtg78.seq
 249882417     gbhtg79.seq
 249827100     gbhtg8.seq
 249980280     gbhtg80.seq
 249869955     gbhtg81.seq
 249894840     gbhtg82.seq
 202300570     gbhtg83.seq
 249873888     gbhtg84.seq
 249951243     gbhtg85.seq
 249869625     gbhtg86.seq
 249889142     gbhtg87.seq
 206020594     gbhtg88.seq
 249893096     gbhtg89.seq
 249952756     gbhtg9.seq
 249878126     gbhtg90.seq
 249782466     gbhtg91.seq
 249893923     gbhtg92.seq
 194413602     gbhtg93.seq
 249975890     gbhtg94.seq
 249987330     gbhtg95.seq
 249876035     gbhtg96.seq
 249800612     gbhtg97.seq
 161659006     gbhtg98.seq
 249873981     gbhtg99.seq
 249999387     gbinv1.seq
 249013648     gbinv10.seq
 249997555     gbinv100.seq
 249997832     gbinv101.seq
  80271449     gbinv102.seq
 249955085     gbinv103.seq
 249996849     gbinv104.seq
 249991952     gbinv105.seq
 249976130     gbinv106.seq
 249999980     gbinv107.seq
 249983498     gbinv108.seq
 249996598     gbinv109.seq
 248749950     gbinv11.seq
  89129686     gbinv110.seq
 249973375     gbinv111.seq
 249899693     gbinv112.seq
 249979396     gbinv113.seq
 249998795     gbinv114.seq
 249994232     gbinv115.seq
 249966582     gbinv116.seq
 249983747     gbinv117.seq
 249995961     gbinv118.seq
 249994417     gbinv119.seq
 249997485     gbinv12.seq
 151414969     gbinv120.seq
 249999545     gbinv121.seq
 249995664     gbinv122.seq
 249998338     gbinv123.seq
 249793471     gbinv124.seq
 249981535     gbinv125.seq
 249997903     gbinv126.seq
 243824572     gbinv127.seq
  52925611     gbinv128.seq
 249973860     gbinv129.seq
 249999132     gbinv13.seq
 249946261     gbinv130.seq
 249988320     gbinv131.seq
 249993992     gbinv132.seq
  28355116     gbinv133.seq
 250000131     gbinv134.seq
 249997724     gbinv135.seq
  59918656     gbinv136.seq
 249998579     gbinv137.seq
 249973278     gbinv138.seq
 249995075     gbinv139.seq
 101964527     gbinv14.seq
 249994925     gbinv140.seq
 148119999     gbinv141.seq
 249995603     gbinv142.seq
 249999045     gbinv143.seq
 249999297     gbinv144.seq
 249999642     gbinv145.seq
 249998443     gbinv146.seq
 249999508     gbinv147.seq
 248976796     gbinv148.seq
 247834112     gbinv149.seq
 249997911     gbinv15.seq
 249332832     gbinv150.seq
 149276428     gbinv151.seq
 250000027     gbinv16.seq
 249999561     gbinv17.seq
 165897800     gbinv18.seq
 249517379     gbinv19.seq
 249966200     gbinv2.seq
 247715986     gbinv20.seq
 249997181     gbinv21.seq
 249998719     gbinv22.seq
 249996648     gbinv23.seq
   1982402     gbinv24.seq
 230346749     gbinv25.seq
 175506967     gbinv26.seq
 249994105     gbinv27.seq
 249997525     gbinv28.seq
 227708036     gbinv29.seq
 249825266     gbinv3.seq
 249999562     gbinv30.seq
 249997712     gbinv31.seq
 249994623     gbinv32.seq
 249997507     gbinv33.seq
 182889654     gbinv34.seq
 249996838     gbinv35.seq
 249998490     gbinv36.seq
 249999731     gbinv37.seq
 249999008     gbinv38.seq
 184452198     gbinv39.seq
 204756643     gbinv4.seq
 250000153     gbinv40.seq
 249998866     gbinv41.seq
 249998925     gbinv42.seq
 249997713     gbinv43.seq
 117624325     gbinv44.seq
 249997726     gbinv45.seq
 249998537     gbinv46.seq
 249999674     gbinv47.seq
 249998685     gbinv48.seq
  90472762     gbinv49.seq
 249997679     gbinv5.seq
 249999830     gbinv50.seq
 249997381     gbinv51.seq
 249998054     gbinv52.seq
 249998968     gbinv53.seq
  95689199     gbinv54.seq
 249999374     gbinv55.seq
 249999633     gbinv56.seq
 249996954     gbinv57.seq
 249998511     gbinv58.seq
 249999016     gbinv59.seq
 249998388     gbinv6.seq
 249997421     gbinv60.seq
 139066819     gbinv61.seq
 250000132     gbinv62.seq
 250000082     gbinv63.seq
 249998206     gbinv64.seq
 249746358     gbinv65.seq
 249996955     gbinv66.seq
  22232296     gbinv67.seq
 249999790     gbinv68.seq
 250000189     gbinv69.seq
 249999951     gbinv7.seq
 250000091     gbinv70.seq
 201580572     gbinv71.seq
 249926462     gbinv72.seq
 249971937     gbinv73.seq
 247889588     gbinv74.seq
 249920717     gbinv75.seq
 249921421     gbinv76.seq
 249871878     gbinv77.seq
 249897317     gbinv78.seq
 221036085     gbinv79.seq
 231892567     gbinv8.seq
 249997947     gbinv80.seq
 249993437     gbinv81.seq
 249995495     gbinv82.seq
 249997709     gbinv83.seq
  51747128     gbinv84.seq
 249996142     gbinv85.seq
 249961763     gbinv86.seq
 249996526     gbinv87.seq
 249990785     gbinv88.seq
 249983105     gbinv89.seq
 249997301     gbinv9.seq
 249977710     gbinv90.seq
 249994985     gbinv91.seq
 249998590     gbinv92.seq
 249999068     gbinv93.seq
 224842193     gbinv94.seq
 249976996     gbinv95.seq
 249991734     gbinv96.seq
 249996378     gbinv97.seq
 249999578     gbinv98.seq
 249996455     gbinv99.seq
 249693765     gbmam1.seq
 338653945     gbmam10.seq
 315434421     gbmam11.seq
 162425861     gbmam12.seq
 150157348     gbmam13.seq
 159032552     gbmam14.seq
 136269244     gbmam15.seq
 122412969     gbmam16.seq
 248159424     gbmam17.seq
 202955099     gbmam18.seq
 208310894     gbmam19.seq
 249999746     gbmam2.seq
 209752374     gbmam20.seq
 197940571     gbmam21.seq
 230561883     gbmam22.seq
 220222486     gbmam23.seq
 123191148     gbmam24.seq
 191446547     gbmam25.seq
   9946563     gbmam26.seq
  43996573     gbmam27.seq
  91328397     gbmam28.seq
  88836150     gbmam29.seq
  85267882     gbmam3.seq
   6429575     gbmam30.seq
  21177386     gbmam31.seq
 249997444     gbmam32.seq
 202988763     gbmam33.seq
 249998836     gbmam34.seq
 249996315     gbmam35.seq
 249998359     gbmam36.seq
 208706230     gbmam37.seq
  83809358     gbmam4.seq
  71963163     gbmam5.seq
  22758099     gbmam6.seq
   1269552     gbmam7.seq
   2480909     gbmam8.seq
 375834671     gbmam9.seq
  20447414     gbnew.txt
 249999114     gbpat1.seq
 249999982     gbpat10.seq
 249999052     gbpat100.seq
 249998996     gbpat101.seq
 249999065     gbpat102.seq
 249999793     gbpat103.seq
 149112469     gbpat104.seq
 249999880     gbpat105.seq
 249998929     gbpat106.seq
 249928220     gbpat107.seq
 249824879     gbpat108.seq
 249998856     gbpat109.seq
 179862777     gbpat11.seq
 192956335     gbpat110.seq
 250000217     gbpat111.seq
 249999701     gbpat112.seq
 249997853     gbpat113.seq
  80219535     gbpat114.seq
 249999673     gbpat115.seq
 250000063     gbpat116.seq
 249773767     gbpat117.seq
 250000129     gbpat118.seq
 249999583     gbpat119.seq
 249999382     gbpat12.seq
  67188949     gbpat120.seq
 249998923     gbpat121.seq
 250000184     gbpat122.seq
 249999601     gbpat123.seq
 249999810     gbpat124.seq
 160252740     gbpat125.seq
 249999692     gbpat126.seq
 250000171     gbpat127.seq
 234780519     gbpat128.seq
 249991536     gbpat129.seq
 249998789     gbpat13.seq
 249970935     gbpat130.seq
 249999745     gbpat131.seq
 249999400     gbpat132.seq
 249994345     gbpat133.seq
  66832984     gbpat134.seq
 249992315     gbpat135.seq
 249999844     gbpat136.seq
 250000121     gbpat137.seq
 250000131     gbpat138.seq
 249999522     gbpat139.seq
 249998731     gbpat14.seq
  18435141     gbpat140.seq
 249999655     gbpat141.seq
 249998828     gbpat142.seq
 249999803     gbpat143.seq
 249999630     gbpat144.seq
  46945926     gbpat145.seq
 250000154     gbpat146.seq
 249998813     gbpat147.seq
 249998963     gbpat148.seq
 234578566     gbpat149.seq
 249997891     gbpat15.seq
 249999721     gbpat150.seq
 249999913     gbpat151.seq
 249999512     gbpat152.seq
  86841554     gbpat153.seq
 249999922     gbpat154.seq
 249998620     gbpat155.seq
 249999750     gbpat156.seq
  63850095     gbpat157.seq
 249996493     gbpat158.seq
 249999547     gbpat159.seq
 250000228     gbpat16.seq
 249999923     gbpat160.seq
 249998650     gbpat161.seq
 249999910     gbpat162.seq
 249999752     gbpat163.seq
 224208910     gbpat164.seq
 250000249     gbpat165.seq
 249999893     gbpat166.seq
 249999893     gbpat167.seq
 220539897     gbpat168.seq
 249999753     gbpat169.seq
  75621720     gbpat17.seq
 249998425     gbpat170.seq
 250000062     gbpat171.seq
  12454839     gbpat172.seq
 249950867     gbpat173.seq
 249998441     gbpat174.seq
 249999750     gbpat175.seq
 249998491     gbpat176.seq
  91698903     gbpat177.seq
 249999432     gbpat178.seq
 249999105     gbpat179.seq
 250000027     gbpat18.seq
 249998633     gbpat180.seq
 250000180     gbpat181.seq
   9115252     gbpat182.seq
 249999856     gbpat183.seq
 249999183     gbpat184.seq
 249999616     gbpat185.seq
 174952464     gbpat186.seq
 250000222     gbpat187.seq
 249995822     gbpat188.seq
 250000136     gbpat189.seq
 249999209     gbpat19.seq
 250000015     gbpat190.seq
  76767668     gbpat191.seq
 250000158     gbpat192.seq
 249987422     gbpat193.seq
 249999879     gbpat194.seq
 249996128     gbpat195.seq
 249996962     gbpat196.seq
  12433541     gbpat197.seq
 249998585     gbpat198.seq
 249999060     gbpat199.seq
 249994776     gbpat2.seq
 249999254     gbpat20.seq
 250000147     gbpat200.seq
 249997726     gbpat201.seq
 214704084     gbpat202.seq
 249999606     gbpat203.seq
 249209592     gbpat204.seq
 249997840     gbpat205.seq
 249999477     gbpat206.seq
 181213280     gbpat207.seq
 249548891     gbpat208.seq
 248511405     gbpat209.seq
 249999830     gbpat21.seq
 249999312     gbpat210.seq
 249999227     gbpat211.seq
 249931834     gbpat212.seq
 249999826     gbpat213.seq
  18031394     gbpat214.seq
 249999739     gbpat215.seq
 249997905     gbpat216.seq
 249999113     gbpat217.seq
 120256614     gbpat218.seq
 249998644     gbpat219.seq
 186231766     gbpat22.seq
 249997519     gbpat220.seq
 249999804     gbpat221.seq
 249999636     gbpat222.seq
 250000243     gbpat223.seq
 250000141     gbpat224.seq
 250000142     gbpat225.seq
 250000178     gbpat226.seq
  71832079     gbpat227.seq
 249999586     gbpat228.seq
 249999857     gbpat229.seq
 249998794     gbpat23.seq
 250000254     gbpat230.seq
 249999873     gbpat231.seq
 226268143     gbpat232.seq
 250000083     gbpat233.seq
 249999848     gbpat234.seq
 249998304     gbpat235.seq
 249998522     gbpat236.seq
  66986386     gbpat237.seq
 249998337     gbpat238.seq
 249998157     gbpat239.seq
 249828404     gbpat24.seq
 249995065     gbpat240.seq
 249996474     gbpat241.seq
 249997032     gbpat242.seq
 244578878     gbpat243.seq
 250000239     gbpat244.seq
 249997356     gbpat245.seq
 249999886     gbpat246.seq
 249999301     gbpat247.seq
  35681971     gbpat248.seq
 249999368     gbpat249.seq
 250000084     gbpat25.seq
 249994817     gbpat250.seq
 249999646     gbpat251.seq
 144872604     gbpat252.seq
 249706994     gbpat253.seq
 249999719     gbpat254.seq
 250000099     gbpat255.seq
  74014219     gbpat256.seq
 250000099     gbpat257.seq
 249999916     gbpat258.seq
 249999238     gbpat259.seq
 249999744     gbpat26.seq
 249998215     gbpat260.seq
 249999615     gbpat261.seq
 197298526     gbpat262.seq
 249999776     gbpat263.seq
 250000192     gbpat264.seq
 242184441     gbpat265.seq
 249999569     gbpat266.seq
 249999867     gbpat267.seq
  73518419     gbpat268.seq
  71842513     gbpat27.seq
 249998712     gbpat28.seq
 249999069     gbpat29.seq
 249999364     gbpat3.seq
 249999923     gbpat30.seq
 249999240     gbpat31.seq
 249999780     gbpat32.seq
 180419813     gbpat33.seq
 250000082     gbpat34.seq
 249998310     gbpat35.seq
 249999084     gbpat36.seq
 249999380     gbpat37.seq
 249999943     gbpat38.seq
 249998809     gbpat39.seq
 249998815     gbpat4.seq
 249848310     gbpat40.seq
 103949826     gbpat41.seq
 249999644     gbpat42.seq
 249979467     gbpat43.seq
 249999864     gbpat44.seq
 249999858     gbpat45.seq
 249997069     gbpat46.seq
 249948451     gbpat47.seq
 249999788     gbpat48.seq
 249998475     gbpat49.seq
  71663145     gbpat5.seq
 172109853     gbpat50.seq
 249997931     gbpat51.seq
 249999740     gbpat52.seq
 250000064     gbpat53.seq
 250000038     gbpat54.seq
 222935237     gbpat55.seq
 249999057     gbpat56.seq
 249999847     gbpat57.seq
 249999517     gbpat58.seq
 164755614     gbpat59.seq
 249998966     gbpat6.seq
 249912241     gbpat60.seq
 249999209     gbpat61.seq
 249999235     gbpat62.seq
 249998732     gbpat63.seq
 135951995     gbpat64.seq
 250000044     gbpat65.seq
 249998123     gbpat66.seq
 249996994     gbpat67.seq
 249998077     gbpat68.seq
 250000144     gbpat69.seq
 250000096     gbpat7.seq
 250000180     gbpat70.seq
 144901242     gbpat71.seq
 249999880     gbpat72.seq
 249999899     gbpat73.seq
 249998837     gbpat74.seq
 244402254     gbpat75.seq
 248968861     gbpat76.seq
 244458666     gbpat77.seq
 247877996     gbpat78.seq
 249999280     gbpat79.seq
 249982813     gbpat8.seq
 160632775     gbpat80.seq
 250000121     gbpat81.seq
 249999657     gbpat82.seq
 249999470     gbpat83.seq
 249999644     gbpat84.seq
 249994877     gbpat85.seq
 249999350     gbpat86.seq
  99352539     gbpat87.seq
 249157810     gbpat88.seq
 249999238     gbpat89.seq
 249999358     gbpat9.seq
 250000200     gbpat90.seq
 249999386     gbpat91.seq
 249999088     gbpat92.seq
 249999429     gbpat93.seq
 145309507     gbpat94.seq
 249999760     gbpat95.seq
 249998956     gbpat96.seq
 249999939     gbpat97.seq
 250000257     gbpat98.seq
 196973298     gbpat99.seq
 249789679     gbphg1.seq
 249952599     gbphg2.seq
 158824335     gbphg3.seq
 249999182     gbpln1.seq
 157118015     gbpln10.seq
 249898364     gbpln100.seq
 249998960     gbpln101.seq
  26511214     gbpln102.seq
 249999641     gbpln103.seq
 249997072     gbpln104.seq
 249998302     gbpln105.seq
 249997636     gbpln106.seq
  91670240     gbpln107.seq
 249998699     gbpln108.seq
 249999537     gbpln109.seq
 249999784     gbpln11.seq
 249994542     gbpln110.seq
 210067841     gbpln111.seq
 249998576     gbpln112.seq
 249997992     gbpln113.seq
 249997800     gbpln114.seq
 156060173     gbpln115.seq
 249778257     gbpln116.seq
 249995521     gbpln117.seq
 249997534     gbpln118.seq
 109077190     gbpln119.seq
 249995655     gbpln12.seq
 249984135     gbpln120.seq
 249997411     gbpln121.seq
 249783609     gbpln122.seq
  91524321     gbpln123.seq
 249997353     gbpln124.seq
 249994040     gbpln125.seq
 248039856     gbpln126.seq
 244450400     gbpln127.seq
 246539448     gbpln128.seq
 249998340     gbpln129.seq
 249998158     gbpln13.seq
 213828472     gbpln130.seq
 224206397     gbpln131.seq
 229997344     gbpln132.seq
 222622527     gbpln133.seq
 249998501     gbpln134.seq
 122919002     gbpln135.seq
 249948657     gbpln14.seq
 230979043     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
  20516461     gbpln19.seq
 249997610     gbpln2.seq
 242160961     gbpln20.seq
 249958794     gbpln21.seq
 248513124     gbpln22.seq
 249474081     gbpln23.seq
 235958399     gbpln24.seq
 232335792     gbpln25.seq
 233137901     gbpln26.seq
 235733976     gbpln27.seq
 199441006     gbpln28.seq
 195822086     gbpln29.seq
 249923465     gbpln3.seq
 249997053     gbpln30.seq
  98618405     gbpln31.seq
 249997460     gbpln32.seq
 136494775     gbpln33.seq
 206763839     gbpln34.seq
  85568252     gbpln35.seq
 193636722     gbpln36.seq
 225480575     gbpln37.seq
 242182210     gbpln38.seq
 249184685     gbpln39.seq
 247865415     gbpln4.seq
 249954292     gbpln40.seq
 249616496     gbpln41.seq
 249137161     gbpln42.seq
 151545383     gbpln43.seq
 249475241     gbpln44.seq
 248050603     gbpln45.seq
 248943500     gbpln46.seq
 246393933     gbpln47.seq
 248941505     gbpln48.seq
 249872257     gbpln49.seq
 249986085     gbpln5.seq
 249772980     gbpln50.seq
 248758168     gbpln51.seq
 249606493     gbpln52.seq
 236612573     gbpln53.seq
 232196221     gbpln54.seq
 249168940     gbpln55.seq
 160041003     gbpln56.seq
  40095425     gbpln57.seq
  75057058     gbpln58.seq
 249997594     gbpln59.seq
 249892928     gbpln6.seq
 249999896     gbpln60.seq
 249999399     gbpln61.seq
 113811340     gbpln62.seq
 249998550     gbpln63.seq
 249997344     gbpln64.seq
 249997839     gbpln65.seq
 249999771     gbpln66.seq
 150005262     gbpln67.seq
 249999712     gbpln68.seq
 249997143     gbpln69.seq
 249918178     gbpln7.seq
 249996762     gbpln70.seq
 249629809     gbpln71.seq
 246484180     gbpln72.seq
 249971618     gbpln73.seq
 249999128     gbpln74.seq
  49748625     gbpln75.seq
 249998978     gbpln76.seq
  50223111     gbpln77.seq
 212684642     gbpln78.seq
 249158012     gbpln79.seq
 249941394     gbpln8.seq
 187059858     gbpln80.seq
 997560866     gbpln81.seq
  56478455     gbpln82.seq
 215691346     gbpln83.seq
 171793674     gbpln84.seq
 197391160     gbpln85.seq
 177950644     gbpln86.seq
 196456279     gbpln87.seq
 189037066     gbpln88.seq
 220764647     gbpln89.seq
 249992675     gbpln9.seq
 227204520     gbpln90.seq
 224027197     gbpln91.seq
 248372246     gbpln92.seq
 189076057     gbpln93.seq
 249998073     gbpln94.seq
 249999318     gbpln95.seq
  62912482     gbpln96.seq
 249998627     gbpln97.seq
 249969613     gbpln98.seq
 250000259     gbpln99.seq
 149042483     gbpri1.seq
 249985770     gbpri10.seq
 144402707     gbpri11.seq
 249963263     gbpri12.seq
 249890704     gbpri13.seq
 249896089     gbpri14.seq
 249946723     gbpri15.seq
 249866001     gbpri16.seq
 249867628     gbpri17.seq
 249757996     gbpri18.seq
 249922745     gbpri19.seq
 249998280     gbpri2.seq
 249959015     gbpri20.seq
 249969459     gbpri21.seq
 249684154     gbpri22.seq
 249998572     gbpri23.seq
  50850360     gbpri24.seq
 163834077     gbpri25.seq
 249994558     gbpri26.seq
 247489911     gbpri27.seq
 249970709     gbpri28.seq
 249937746     gbpri29.seq
 249962646     gbpri3.seq
 249764453     gbpri30.seq
 249875065     gbpri31.seq
 249885937     gbpri32.seq
 249972248     gbpri33.seq
 249965632     gbpri34.seq
 249922192     gbpri35.seq
  23041389     gbpri36.seq
 249995315     gbpri37.seq
 250000024     gbpri38.seq
 249504909     gbpri39.seq
 249909552     gbpri4.seq
 249998054     gbpri40.seq
 249998791     gbpri41.seq
 201729991     gbpri42.seq
 249997540     gbpri43.seq
 249969416     gbpri44.seq
 249985161     gbpri45.seq
 249999337     gbpri46.seq
 133104448     gbpri47.seq
 249939471     gbpri48.seq
 249980654     gbpri49.seq
 249825324     gbpri5.seq
 150220975     gbpri50.seq
 314294187     gbpri51.seq
 258775309     gbpri52.seq
 268666448     gbpri53.seq
 249953671     gbpri54.seq
 174804354     gbpri55.seq
 249958401     gbpri6.seq
 249922934     gbpri7.seq
 249907622     gbpri8.seq
 249996773     gbpri9.seq
    447258     gbrel.txt
 249901222     gbrod1.seq
 249812474     gbrod10.seq
  81902664     gbrod11.seq
 249871281     gbrod12.seq
 249783723     gbrod13.seq
 249992850     gbrod14.seq
 249651610     gbrod15.seq
 249953745     gbrod16.seq
 249885180     gbrod17.seq
 249943440     gbrod18.seq
 249925330     gbrod19.seq
 249963601     gbrod2.seq
 249816736     gbrod20.seq
 249843909     gbrod21.seq
 204885340     gbrod22.seq
 249997671     gbrod23.seq
 249992566     gbrod24.seq
 249915214     gbrod25.seq
 249983854     gbrod26.seq
 249999126     gbrod27.seq
 249999474     gbrod28.seq
 249999208     gbrod29.seq
 249857625     gbrod3.seq
 180562035     gbrod30.seq
 249891866     gbrod4.seq
 249834506     gbrod5.seq
 249995103     gbrod6.seq
 249884829     gbrod7.seq
 249789365     gbrod8.seq
 249978464     gbrod9.seq
 249999139     gbsts1.seq
 249997905     gbsts10.seq
 210966786     gbsts11.seq
 249996524     gbsts12.seq
 250000181     gbsts13.seq
 249998420     gbsts14.seq
 249999696     gbsts15.seq
  26045416     gbsts16.seq
 250000234     gbsts17.seq
 249999378     gbsts18.seq
 250000044     gbsts19.seq
 249999407     gbsts2.seq
 187846972     gbsts20.seq
 249995761     gbsts3.seq
 249998644     gbsts4.seq
  42339090     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249997315     gbsts9.seq
 249990314     gbsyn1.seq
 249995168     gbsyn2.seq
 249996971     gbsyn3.seq
 249953996     gbsyn4.seq
 249963044     gbsyn5.seq
 249973467     gbsyn6.seq
 249995194     gbsyn7.seq
 249997494     gbsyn8.seq
  82976628     gbsyn9.seq
 249998789     gbtsa1.seq
  56875503     gbtsa10.seq
 249999189     gbtsa100.seq
 249999433     gbtsa101.seq
 249996526     gbtsa102.seq
 249998542     gbtsa103.seq
 107894053     gbtsa104.seq
 249999743     gbtsa105.seq
 249999340     gbtsa106.seq
 250000193     gbtsa107.seq
 249997708     gbtsa108.seq
 249999597     gbtsa109.seq
 249996711     gbtsa11.seq
 249998574     gbtsa110.seq
 228581442     gbtsa111.seq
 249998448     gbtsa112.seq
 249998116     gbtsa113.seq
 249999828     gbtsa114.seq
 249999325     gbtsa115.seq
 249994026     gbtsa116.seq
  16579382     gbtsa117.seq
 249998403     gbtsa118.seq
 249999879     gbtsa119.seq
 249996983     gbtsa12.seq
 249998407     gbtsa120.seq
 220818721     gbtsa121.seq
 249996276     gbtsa122.seq
 249998492     gbtsa123.seq
 249994958     gbtsa124.seq
 249998709     gbtsa125.seq
 249999528     gbtsa126.seq
 249998038     gbtsa127.seq
 173017184     gbtsa128.seq
 249999326     gbtsa129.seq
 249992959     gbtsa13.seq
 249997095     gbtsa130.seq
 249998452     gbtsa131.seq
 249997998     gbtsa132.seq
 249999141     gbtsa133.seq
 249999792     gbtsa134.seq
   8254827     gbtsa135.seq
 249999027     gbtsa136.seq
 249999626     gbtsa137.seq
 249999337     gbtsa138.seq
 249997377     gbtsa139.seq
 249998857     gbtsa14.seq
 136260650     gbtsa140.seq
 249998131     gbtsa141.seq
 249999514     gbtsa142.seq
 249997541     gbtsa143.seq
 249997718     gbtsa144.seq
  35878567     gbtsa145.seq
 249999033     gbtsa146.seq
 249996430     gbtsa147.seq
 249999407     gbtsa148.seq
 249999070     gbtsa149.seq
 212107370     gbtsa15.seq
 249998280     gbtsa150.seq
 249998961     gbtsa151.seq
 249997929     gbtsa152.seq
 249999837     gbtsa153.seq
  56029904     gbtsa154.seq
 249997859     gbtsa155.seq
 249998020     gbtsa156.seq
 249999234     gbtsa157.seq
 249997993     gbtsa158.seq
 249998073     gbtsa159.seq
 249997341     gbtsa16.seq
 249999025     gbtsa160.seq
  88482532     gbtsa161.seq
 249999569     gbtsa162.seq
 249998179     gbtsa163.seq
 249997593     gbtsa164.seq
 133634227     gbtsa165.seq
 250000051     gbtsa166.seq
 249997064     gbtsa167.seq
 249996807     gbtsa168.seq
 249995565     gbtsa169.seq
 249997375     gbtsa17.seq
 249999016     gbtsa170.seq
 249999347     gbtsa171.seq
 212464283     gbtsa172.seq
 249999604     gbtsa173.seq
 250000062     gbtsa174.seq
 249998057     gbtsa175.seq
 249999289     gbtsa176.seq
 249999094     gbtsa177.seq
 249995474     gbtsa178.seq
 235671082     gbtsa179.seq
 249996303     gbtsa18.seq
 249996624     gbtsa180.seq
 249997321     gbtsa181.seq
 249995617     gbtsa182.seq
 249994262     gbtsa183.seq
 249997299     gbtsa184.seq
 249994810     gbtsa185.seq
 249996107     gbtsa186.seq
 158803373     gbtsa187.seq
 249998144     gbtsa188.seq
 249999142     gbtsa189.seq
 249998663     gbtsa19.seq
 249995468     gbtsa190.seq
 249995022     gbtsa191.seq
 249996263     gbtsa192.seq
 249997899     gbtsa193.seq
 249998569     gbtsa194.seq
 249996478     gbtsa195.seq
 137489684     gbtsa196.seq
 249996764     gbtsa197.seq
 249998199     gbtsa198.seq
 249998750     gbtsa199.seq
 249998838     gbtsa2.seq
 184603711     gbtsa20.seq
 249997310     gbtsa200.seq
  17504918     gbtsa201.seq
 249994885     gbtsa202.seq
 249999243     gbtsa203.seq
 249989561     gbtsa204.seq
 249997860     gbtsa205.seq
 249998286     gbtsa206.seq
 174688788     gbtsa207.seq
 249999300     gbtsa208.seq
 249997856     gbtsa209.seq
 249998729     gbtsa21.seq
 249996155     gbtsa210.seq
 249996918     gbtsa211.seq
 249994050     gbtsa212.seq
 249997510     gbtsa213.seq
 249998407     gbtsa214.seq
 186774487     gbtsa215.seq
 249996159     gbtsa216.seq
 249996376     gbtsa217.seq
 249998017     gbtsa218.seq
 250000184     gbtsa219.seq
 249995960     gbtsa22.seq
 250000235     gbtsa220.seq
 249998424     gbtsa221.seq
 209204781     gbtsa222.seq
 249999871     gbtsa223.seq
 249998426     gbtsa224.seq
 249995429     gbtsa225.seq
 249999230     gbtsa226.seq
 249998719     gbtsa227.seq
 249999680     gbtsa228.seq
 147516971     gbtsa229.seq
 249998716     gbtsa23.seq
 250000018     gbtsa24.seq
 141416466     gbtsa25.seq
 249998989     gbtsa26.seq
 249996697     gbtsa27.seq
 249999341     gbtsa28.seq
 249994104     gbtsa29.seq
 249998033     gbtsa3.seq
 249995742     gbtsa30.seq
  14687257     gbtsa31.seq
 249999462     gbtsa32.seq
 249997921     gbtsa33.seq
 250000061     gbtsa34.seq
 249999369     gbtsa35.seq
 249998710     gbtsa36.seq
 250000200     gbtsa37.seq
  77824344     gbtsa38.seq
 249998838     gbtsa39.seq
 249998666     gbtsa4.seq
 249998049     gbtsa40.seq
 249998580     gbtsa41.seq
 249998509     gbtsa42.seq
 249998813     gbtsa43.seq
 249998265     gbtsa44.seq
 249999019     gbtsa45.seq
  35343531     gbtsa46.seq
 249996819     gbtsa47.seq
 249998958     gbtsa48.seq
 249998918     gbtsa49.seq
 154448941     gbtsa5.seq
 249999945     gbtsa50.seq
  77219842     gbtsa51.seq
 249997706     gbtsa52.seq
 249999391     gbtsa53.seq
 249999984     gbtsa54.seq
 249991141     gbtsa55.seq
 159839217     gbtsa56.seq
 250000009     gbtsa57.seq
 249998760     gbtsa58.seq
 249999183     gbtsa59.seq
 249997875     gbtsa6.seq
 249998062     gbtsa60.seq
 249997264     gbtsa61.seq
 249999006     gbtsa62.seq
 249999666     gbtsa63.seq
 246318645     gbtsa64.seq
 249999875     gbtsa65.seq
 249998311     gbtsa66.seq
 249997772     gbtsa67.seq
 249998444     gbtsa68.seq
 249999791     gbtsa69.seq
 249998005     gbtsa7.seq
 249998667     gbtsa70.seq
 232817222     gbtsa71.seq
 249998934     gbtsa72.seq
 249999138     gbtsa73.seq
 249998810     gbtsa74.seq
 249999063     gbtsa75.seq
 249998126     gbtsa76.seq
 249999447     gbtsa77.seq
 186523122     gbtsa78.seq
 249999580     gbtsa79.seq
 249999806     gbtsa8.seq
 249999459     gbtsa80.seq
 250000060     gbtsa81.seq
 249998829     gbtsa82.seq
 249995363     gbtsa83.seq
 111806279     gbtsa84.seq
 249997659     gbtsa85.seq
 249998620     gbtsa86.seq
 249998734     gbtsa87.seq
 249992900     gbtsa88.seq
 249999666     gbtsa89.seq
 249999617     gbtsa9.seq
  45985876     gbtsa90.seq
 249999089     gbtsa91.seq
 249999676     gbtsa92.seq
 249999794     gbtsa93.seq
 249999476     gbtsa94.seq
 249997211     gbtsa95.seq
 150721457     gbtsa96.seq
 250000251     gbtsa97.seq
 250000245     gbtsa98.seq
 249999623     gbtsa99.seq
    792470     gbuna1.seq
 249995946     gbvrl1.seq
 249996009     gbvrl10.seq
 249981223     gbvrl11.seq
 249997859     gbvrl12.seq
 249999891     gbvrl13.seq
 216819350     gbvrl14.seq
 249997208     gbvrl15.seq
 249999842     gbvrl16.seq
 250000178     gbvrl17.seq
 249995762     gbvrl18.seq
 229094211     gbvrl19.seq
 249997906     gbvrl2.seq
 250000181     gbvrl20.seq
 249997283     gbvrl21.seq
 249998804     gbvrl22.seq
 249998655     gbvrl23.seq
 142681217     gbvrl24.seq
 249997849     gbvrl25.seq
 249996831     gbvrl26.seq
 249999885     gbvrl27.seq
 249996932     gbvrl28.seq
 250000003     gbvrl29.seq
 249999708     gbvrl3.seq
  73750566     gbvrl30.seq
 250000223     gbvrl31.seq
 250000020     gbvrl32.seq
 249994726     gbvrl33.seq
 249999743     gbvrl34.seq
 249995741     gbvrl35.seq
  22207187     gbvrl36.seq
 249995479     gbvrl37.seq
 249965560     gbvrl38.seq
 249998209     gbvrl39.seq
 249976766     gbvrl4.seq
 249999168     gbvrl40.seq
 250000159     gbvrl41.seq
 249993617     gbvrl42.seq
 249999917     gbvrl43.seq
  56283168     gbvrl44.seq
 249999941     gbvrl5.seq
  87212824     gbvrl6.seq
 249999527     gbvrl7.seq
 249999587     gbvrl8.seq
 249996065     gbvrl9.seq
 249999839     gbvrt1.seq
 249817491     gbvrt10.seq
 249916550     gbvrt11.seq
 136966761     gbvrt12.seq
 249949016     gbvrt13.seq
 249930188     gbvrt14.seq
 249923853     gbvrt15.seq
 249998559     gbvrt16.seq
 249999189     gbvrt17.seq
 249998163     gbvrt18.seq
  62983975     gbvrt19.seq
 249862589     gbvrt2.seq
 249969324     gbvrt20.seq
 249997320     gbvrt21.seq
 249998580     gbvrt22.seq
 249997915     gbvrt23.seq
 249999766     gbvrt24.seq
 109396851     gbvrt25.seq
 249998489     gbvrt26.seq
 249998788     gbvrt27.seq
 249998695     gbvrt28.seq
 199375356     gbvrt29.seq
 249997831     gbvrt3.seq
 249997712     gbvrt30.seq
 249996540     gbvrt31.seq
  29556602     gbvrt32.seq
 249996623     gbvrt33.seq
 190951643     gbvrt34.seq
 249997503     gbvrt35.seq
 249997486     gbvrt36.seq
 249999711     gbvrt37.seq
  94303359     gbvrt38.seq
 249999633     gbvrt39.seq
 249871596     gbvrt4.seq
 249998061     gbvrt40.seq
  73056268     gbvrt41.seq
 249985553     gbvrt42.seq
 240159325     gbvrt43.seq
 249550823     gbvrt44.seq
 247573804     gbvrt45.seq
 243842846     gbvrt46.seq
 249849991     gbvrt47.seq
 249370876     gbvrt48.seq
 249965747     gbvrt49.seq
 223478013     gbvrt5.seq
 249999118     gbvrt50.seq
  45407125     gbvrt51.seq
 249999335     gbvrt52.seq
 180507423     gbvrt53.seq
 246330940     gbvrt54.seq
 227143105     gbvrt55.seq
 249608691     gbvrt56.seq
 234447524     gbvrt57.seq
 249647333     gbvrt58.seq
 249740040     gbvrt59.seq
 249995340     gbvrt6.seq
 249797253     gbvrt60.seq
 249954226     gbvrt61.seq
 248825435     gbvrt62.seq
 134301494     gbvrt63.seq
 249996027     gbvrt7.seq
 249930715     gbvrt8.seq
 249867361     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63582      86583423
BCT10        14157      87882687
BCT100       44         107663284
BCT101       42         105130602
BCT102       62         107795837
BCT103       45         109538241
BCT104       24         74562824
BCT105       29         106059433
BCT106       23         100309671
BCT107       22         102815068
BCT108       22         103205495
BCT109       22         103088812
BCT11        2360       103149792
BCT110       22         103089220
BCT111       21         99801199
BCT112       21         101640086
BCT113       23         106816508
BCT114       46         109374721
BCT115       38         105562991
BCT116       6          15890032
BCT117       50         111764861
BCT118       60         109369965
BCT119       59         112726237
BCT12        70         115123597
BCT120       65         111921547
BCT121       51         113750383
BCT122       43         114171100
BCT123       58         110131579
BCT124       19         103982447
BCT125       35         108938373
BCT126       21         53081841
BCT127       44         114144416
BCT128       48         114538095
BCT129       59         112456580
BCT13        111        116076156
BCT130       41         109996351
BCT131       54         117427897
BCT132       32         106713806
BCT133       37         114373689
BCT134       60         111676584
BCT135       42         108493296
BCT136       30         111357445
BCT137       38         122972246
BCT138       54         111404870
BCT139       40         78198029
BCT14        70         113372788
BCT140       76         112890888
BCT141       41         109494759
BCT142       54         110790202
BCT143       63         108519341
BCT144       68         113891052
BCT145       61         114861213
BCT146       29         106951004
BCT147       44         110601885
BCT148       70         109952491
BCT149       39         107990370
BCT15        53         115328609
BCT150       64         105006077
BCT151       59         109908714
BCT152       3          5977905
BCT153       49         108194911
BCT154       56         106920572
BCT155       45         108898739
BCT156       43         106160881
BCT157       48         106248773
BCT158       42         112528530
BCT159       47         109226433
BCT16        74         122556134
BCT160       38         110628969
BCT161       37         106654251
BCT162       46         106950654
BCT163       46         110125015
BCT164       41         107237184
BCT165       38         107628480
BCT166       5          17429228
BCT167       93         99698834
BCT168       39         110882155
BCT169       52         110335992
BCT17        43         118817536
BCT170       46         106404159
BCT171       47         111747951
BCT172       36         107982312
BCT173       37         108017807
BCT174       50         108478863
BCT175       58         108429110
BCT176       51         105445356
BCT177       73         107543965
BCT178       38         103874633
BCT179       57         108465369
BCT18        79         119736695
BCT180       46         109354404
BCT181       29         107153003
BCT182       64         111379650
BCT183       69         111052112
BCT184       58         107862811
BCT185       40         109462758
BCT186       49         112713706
BCT187       39         85478334
BCT188       64         106752459
BCT189       41         108109351
BCT19        54         114253761
BCT190       45         109803712
BCT191       61         104291475
BCT192       79         100639945
BCT193       70         107127861
BCT194       41         108243607
BCT195       52         106365955
BCT196       44         105685997
BCT197       46         105813856
BCT198       37         106025707
BCT199       65         106657016
BCT2         30448      98233634
BCT20        9286       120225611
BCT200       42         108811647
BCT201       19         54025632
BCT202       61         111248814
BCT203       63         110387414
BCT204       54         105278038
BCT205       48         104625258
BCT206       78         110633649
BCT207       90         109029139
BCT208       32         102663106
BCT209       43         109465177
BCT21        6760       8484136
BCT210       17         38490431
BCT211       70         108135317
BCT212       48         104630745
BCT213       72         107464094
BCT214       46         108521575
BCT215       52         108461593
BCT216       44         112009957
BCT217       49         108864330
BCT218       42         108777277
BCT219       51         106168024
BCT22        53815      84836558
BCT220       6          13363974
BCT221       59         104025213
BCT222       49         108913741
BCT223       42         103846772
BCT224       65         108035003
BCT225       63         104891377
BCT226       57         105582299
BCT227       48         106402054
BCT228       40         111256002
BCT229       58         106211045
BCT23        79         109838518
BCT230       60         109431937
BCT231       34         108084619
BCT232       37         105098881
BCT233       79         89120643
BCT234       203        89845400
BCT235       325        25743984
BCT236       1589       2511957
BCT237       3172       5268524
BCT238       6338       7796671
BCT239       12613      14999358
BCT24        143        95924047
BCT240       25523      27673820
BCT241       50570      54083196
BCT242       75862      77886404
BCT243       71313      76792109
BCT244       10485      92368805
BCT245       5305       94797455
BCT246       3323       102716216
BCT247       126        98294245
BCT248       40         104398375
BCT249       213        102908149
BCT25        58         112822895
BCT250       6604       95467851
BCT251       24097      93265044
BCT252       18675      18524922
BCT253       71365      73591604
BCT254       3689       102660265
BCT255       3947       100740033
BCT256       6493       97476157
BCT257       3883       98429990
BCT258       16134      102233801
BCT259       75114      78988490
BCT26        53         111392505
BCT260       72620      78801410
BCT261       75576      78504640
BCT262       72023      77223180
BCT263       72724      74027423
BCT264       12785      14738997
BCT265       71294      74842700
BCT266       72066      73923036
BCT267       19950      18862260
BCT268       66675      81123026
BCT269       44610      55856356
BCT27        46         112848420
BCT270       61241      83579874
BCT271       19013      104856951
BCT272       2783       167485241
BCT273       1519       163438008
BCT274       4028       101697573
BCT275       1865       106795322
BCT276       3751       114731563
BCT277       766        108391923
BCT278       2135       118309372
BCT279       1195       120135622
BCT28        57         112994744
BCT280       6458       117514981
BCT281       23224      50879958
BCT29        66         108817610
BCT3         45         110044504
BCT30        36         96325907
BCT31        40         106881287
BCT32        59         107430269
BCT33        74         111675186
BCT34        55         110045255
BCT35        63         106845594
BCT36        55         109391464
BCT37        53         108650404
BCT38        46         110495229
BCT39        95         109522868
BCT4         59         112453489
BCT40        58         106383657
BCT41        67         109486091
BCT42        125        110095720
BCT43        37         71643089
BCT44        200        111474100
BCT45        54         111189650
BCT46        35         108859141
BCT47        59         107860764
BCT48        56         105257914
BCT49        45         109560296
BCT5         24112      103637784
BCT50        74         109517239
BCT51        63         108815938
BCT52        45         105399191
BCT53        59         110379618
BCT54        70         108888422
BCT55        77         109259381
BCT56        22         22714378
BCT57        67         109336234
BCT58        60         104664634
BCT59        53         102829098
BCT6         13427      19703592
BCT60        56         108908758
BCT61        58         105643854
BCT62        54         109754097
BCT63        72         109941269
BCT64        61         106056484
BCT65        62         107001009
BCT66        40         113733092
BCT67        79         111042894
BCT68        50         106161732
BCT69        54         111968009
BCT7         39658      80452600
BCT70        37         44997032
BCT71        43         109822487
BCT72        50         116699480
BCT73        66         111693041
BCT74        50         111467075
BCT75        53         109197672
BCT76        97         112945696
BCT77        73         112059377
BCT78        80         105609227
BCT79        61         114956262
BCT8         1992       59265649
BCT80        64         115718442
BCT81        53         114897025
BCT82        62         113769294
BCT83        47         110741363
BCT84        21         43870898
BCT85        48         118002347
BCT86        63         115290616
BCT87        248        115434499
BCT88        70         109982609
BCT89        297        115164977
BCT9         7656       93380719
BCT90        63         110836541
BCT91        68         108767418
BCT92        45         109031298
BCT93        61         108655373
BCT94        61         109296173
BCT95        4          12180716
BCT96        57         116195274
BCT97        61         106396448
BCT98        39         113384349
BCT99        59         111542017
ENV1         92452      71792116
ENV10        86241      70367547
ENV11        93066      72832562
ENV12        82353      86579983
ENV13        21850      18735295
ENV14        84744      80841836
ENV15        118344     43031442
ENV16        89133      77082595
ENV17        96416      67763148
ENV18        96032      63236163
ENV19        109651     66849640
ENV2         95889      68795968
ENV20        121936     64265108
ENV21        59519      80371264
ENV22        1974       2650926
ENV23        64035      80462525
ENV24        90222      75818557
ENV25        125171     39265270
ENV26        122785     28945690
ENV27        90670      20905565
ENV28        123096     49752374
ENV29        97826      67152881
ENV3         93734      67947093
ENV30        114992     56529461
ENV31        135867     52806914
ENV32        109154     60796642
ENV33        94686      64627313
ENV34        23304      22718959
ENV35        62536      84995133
ENV36        88738      73283462
ENV37        102894     44271705
ENV38        96861      56288268
ENV39        70665      54642683
ENV4         79732      78382264
ENV40        111235     47248815
ENV41        100827     61078813
ENV42        107055     61681613
ENV43        63686      90612355
ENV44        72549      78882313
ENV45        62024      84274716
ENV46        13534      18408695
ENV47        70513      78327836
ENV48        107794     49575233
ENV49        112480     56191431
ENV5         35434      99818846
ENV50        104690     61476951
ENV51        80590      42555691
ENV52        100603     44032874
ENV53        42860      53350430
ENV54        41971      54594945
ENV55        57501      57080603
ENV56        96516      61612734
ENV57        35088      19501136
ENV58        92149      66866589
ENV59        80779      71286811
ENV6         81245      83694796
ENV60        78507      67763539
ENV61        85960      69915128
ENV62        95747      60372574
ENV63        83276      53432833
ENV64        109664     46034771
ENV65        90168      60779339
ENV66        101123     51562864
ENV67        93855      57101803
ENV68        80580      73544172
ENV69        31794      24659759
ENV7         92016      81411643
ENV70        74048      82697295
ENV71        82793      51574289
ENV72        86167      59247690
ENV73        56736      76493767
ENV74        105272     32064585
ENV75        66277      16741867
ENV76        78509      74286533
ENV77        92064      57781919
ENV78        101498     59842715
ENV79        108227     39892499
ENV8         65405      35004346
ENV80        108223     37690441
ENV81        34206      24445863
ENV82        98818      54318418
ENV83        116351     29438789
ENV84        107422     41556609
ENV85        103806     49868115
ENV86        87167      32884655
ENV87        101672     49940911
ENV88        116143     49453986
ENV89        109415     53280611
ENV9         131407     31020478
ENV90        92535      56027336
ENV91        96560      58580337
ENV92        94558      65071989
ENV93        60231      26686846
EST1         159498     61801009
EST10        168026     72456066
EST100       233458     141786807
EST101       238402     125275700
EST102       190883     104629538
EST103       184966     102305345
EST104       101131     70451144
EST105       160792     120297681
EST106       174163     106396062
EST107       134720     84650800
EST108       63886      23757773
EST109       63358      22277286
EST11        169650     73888436
EST110       63850      23104651
EST111       63871      26893070
EST112       64361      22975223
EST113       64589      24557766
EST114       63579      27051032
EST115       63773      26189708
EST116       64047      27301897
EST117       63896      25162614
EST118       61257      33655518
EST119       122820     62533151
EST12        167839     70447410
EST120       160360     85610332
EST121       187637     92582051
EST122       148680     95604680
EST123       158549     93402429
EST124       131786     85745085
EST125       188279     90228463
EST126       157039     83532971
EST127       157239     84345401
EST128       156710     84843134
EST129       152200     85255969
EST13        68756      33337966
EST130       173772     93242544
EST131       183516     117048852
EST132       202866     102648121
EST133       159685     87282346
EST134       163003     83010400
EST135       142487     83651472
EST136       144808     89835370
EST137       98270      52062550
EST138       172653     97584761
EST139       244036     112746826
EST14        217470     108983190
EST140       155861     84004322
EST141       167358     92277414
EST142       151128     88613211
EST143       133458     81256492
EST144       154970     97374787
EST145       156616     85955609
EST146       124212     63279402
EST147       121182     65033069
EST148       127633     57946979
EST149       127054     51236152
EST15        169667     106001496
EST150       128438     51177857
EST151       115395     43032996
EST152       164021     82736970
EST153       176887     74089486
EST154       162720     110595936
EST155       199582     122326131
EST156       213395     121238984
EST157       175157     97093632
EST158       154459     108164137
EST159       142640     95240899
EST16        181578     113584331
EST160       155111     96480521
EST161       157935     82770262
EST162       139654     78575122
EST163       168591     93709518
EST164       69781      43385480
EST165       150728     92270715
EST166       192365     110546549
EST167       146102     84103376
EST168       142830     72420225
EST169       150308     87669007
EST17        196115     115752993
EST170       191240     104886778
EST171       156733     96078551
EST172       168074     82953671
EST173       126944     86627023
EST174       171171     100382409
EST175       173588     100466838
EST176       121324     67883029
EST177       158119     91085297
EST178       30417      17665653
EST179       170877     103282132
EST18        194432     120873119
EST180       181396     119581108
EST181       143703     116741571
EST182       194433     99359772
EST183       153314     103348882
EST184       154994     101639025
EST185       141187     81726760
EST186       176774     71786007
EST187       150843     84460134
EST188       157414     99900255
EST189       156882     96485853
EST19        157763     113163175
EST190       140870     84007030
EST191       159211     96167069
EST192       146889     94035515
EST193       131478     91560094
EST194       142716     87526263
EST195       137337     89554351
EST196       132644     93992974
EST197       163934     87295786
EST198       174728     96024227
EST199       174085     96902378
EST2         162335     61672666
EST20        189881     100191521
EST200       171959     96533746
EST201       169420     94935193
EST202       172386     95810908
EST203       174112     95379656
EST204       174590     96203151
EST205       13715      7287790
EST206       189437     105533524
EST207       205997     105137228
EST208       172529     102456415
EST209       180702     102076345
EST21        218525     107506181
EST210       202166     123332305
EST211       195697     112856439
EST212       195805     124208041
EST213       138660     93481659
EST214       215657     137366130
EST215       234912     121576607
EST216       161275     105596321
EST217       182463     100789792
EST218       202165     98900693
EST219       132730     95258673
EST22        190254     62066415
EST220       147700     87572434
EST221       210706     116133468
EST222       161782     105322337
EST223       103235     107484856
EST224       153220     103948672
EST225       159109     95526196
EST226       142936     103190829
EST227       224843     104406657
EST228       137205     101008301
EST229       121906     86614410
EST23        138909     39563051
EST230       137909     97920190
EST231       122791     87937821
EST232       143792     89702067
EST233       129918     88651060
EST234       140443     105177151
EST235       132055     93236295
EST236       124278     84114494
EST237       142738     88092881
EST238       156841     120922400
EST239       127062     119213028
EST24        102635     27788906
EST240       139414     103462309
EST241       174789     105995747
EST242       166971     103509508
EST243       154500     99308747
EST244       86489      49569324
EST245       166841     125575766
EST246       143649     106129807
EST247       155620     100204573
EST248       212179     97675955
EST249       187839     112259091
EST25        122480     51005167
EST250       153463     86105732
EST251       217803     27266302
EST252       220374     89765143
EST253       163467     120530764
EST254       175198     102659192
EST255       162382     107949006
EST256       113799     70900469
EST257       155404     113558903
EST258       185037     112317027
EST259       188990     97737274
EST26        214445     97482243
EST260       176329     110270073
EST261       162357     111846165
EST262       230847     108306590
EST263       276080     121285911
EST264       193042     115016188
EST265       187886     36311132
EST266       258546     125926292
EST267       65453      39716158
EST268       153139     97643866
EST269       166007     102205977
EST27        219438     110315416
EST270       166175     114254221
EST271       198038     102918695
EST272       156555     106612250
EST273       196090     115063627
EST274       196800     48852431
EST275       206600     42212011
EST276       181584     103272455
EST277       171074     115306866
EST278       186395     116518356
EST279       126154     72519357
EST28        190581     88625819
EST280       175324     114177098
EST281       170845     74583073
EST282       133352     83117294
EST283       130608     85385608
EST284       155189     102553247
EST285       260789     27544844
EST286       264780     24329995
EST287       148937     104657137
EST288       169548     109665236
EST289       160106     102645589
EST29        158259     69009540
EST290       155895     92349265
EST291       153070     14151751
EST292       209893     74150341
EST293       165145     107757995
EST294       177127     106903885
EST295       154170     98843454
EST296       200215     108103323
EST297       154743     111115231
EST298       166410     101013964
EST299       188050     115294943
EST3         151286     53608977
EST30        171781     69703727
EST300       178999     103058265
EST301       185882     99086919
EST302       184133     64488809
EST303       126546     44862267
EST304       183962     71376275
EST305       184618     69634960
EST306       185628     96241350
EST307       182554     131147955
EST308       145728     84809804
EST309       152950     92437131
EST31        149992     63652937
EST310       131466     100587926
EST311       161055     97313854
EST312       171225     97959492
EST313       150748     96925742
EST314       168239     95574320
EST315       160465     107372360
EST316       100933     70877558
EST317       164574     107967038
EST318       157371     108929746
EST319       178602     151136465
EST32        168732     76282893
EST320       170888     112059985
EST321       141704     75845451
EST322       144016     98183743
EST323       147115     101049725
EST324       134859     90904566
EST325       149245     99478265
EST326       149867     101255520
EST327       177661     110777563
EST328       149026     82699372
EST329       149122     85531700
EST33        175392     67754969
EST330       65950      40599823
EST331       150516     108378496
EST332       161807     97128954
EST333       143888     91549795
EST334       141824     89356019
EST335       204029     111126932
EST336       138510     75570988
EST337       91341      54443153
EST338       130431     85822709
EST339       137163     87080889
EST34        119098     41179372
EST340       125753     80418406
EST341       159294     85332837
EST342       217185     85082101
EST343       171189     87519749
EST344       106323     63469291
EST345       165373     103535447
EST346       146959     89845833
EST347       133010     88559731
EST348       136155     88631617
EST349       185830     121788971
EST35        96367      29586224
EST350       161422     97662583
EST351       153709     78011034
EST352       187987     127477418
EST353       118432     82250426
EST354       73371      44185060
EST355       136736     75238211
EST356       130579     78256920
EST357       147555     58550195
EST358       158748     32261774
EST359       43241      8858368
EST36        96775      30245838
EST360       155609     42677654
EST361       190872     120937158
EST362       238337     113678952
EST363       247502     113100236
EST364       187914     102855353
EST365       141234     91576315
EST366       136585     86831790
EST367       152970     90139577
EST368       190341     117666386
EST369       227721     63625001
EST37        95688      29021543
EST370       177650     111607475
EST371       32357      14192896
EST372       214207     117614240
EST373       204819     121606862
EST374       203755     116464098
EST375       143638     69180492
EST376       198352     122114039
EST377       159035     100689444
EST378       166388     127617617
EST379       183507     145463311
EST38        97555      29505236
EST380       157156     92927674
EST381       164166     105231416
EST382       185699     106493608
EST383       95479      56335488
EST384       205017     111663433
EST385       195517     108717459
EST386       192545     118848383
EST387       191035     124057890
EST388       200868     132546245
EST389       218965     133278091
EST39        97680      30983414
EST390       212654     135001179
EST391       200418     162464250
EST392       214587     143982879
EST393       181018     110599368
EST394       65948      39407900
EST395       192020     104233385
EST396       169654     14902935
EST397       159582     13504389
EST398       157424     26495082
EST399       158848     32002038
EST4         171412     67335226
EST40        28217      7231139
EST400       158764     32196328
EST401       150314     77321357
EST402       175105     102313645
EST403       170331     116484615
EST404       167686     96938938
EST405       155553     108426972
EST406       140565     98067893
EST407       115925     81579488
EST408       154633     97575996
EST409       166772     121257078
EST41        101354     52983819
EST410       163342     98906032
EST411       169154     62458817
EST412       168422     29348148
EST413       160442     107203687
EST414       151594     101295737
EST415       180333     117824018
EST416       139790     76271488
EST417       194658     109945040
EST418       157112     116907390
EST419       133818     91428170
EST42        119679     50944607
EST420       139355     92082139
EST421       487        318877
EST422       147797     92166960
EST423       176419     96787049
EST424       179713     98252106
EST425       146894     90952100
EST426       180423     109791483
EST427       163540     96565349
EST428       109598     75548886
EST429       85702      65401914
EST43        166339     91994018
EST430       100070     67531623
EST431       134649     79153724
EST432       137003     80786702
EST433       134026     82171490
EST434       136019     90179341
EST435       142316     86050477
EST436       51619      27037172
EST437       160085     86802605
EST438       195590     116791659
EST439       126181     81351974
EST44        170623     72307608
EST440       192618     106660650
EST441       178749     84062457
EST442       162510     92724977
EST443       155231     85052291
EST444       208565     121727585
EST445       191938     114661799
EST446       167738     101823467
EST447       147123     109581170
EST448       136320     84966280
EST449       42157      29158507
EST45        167818     85152350
EST450       162939     71839681
EST451       188972     92505582
EST452       209755     83067448
EST453       205260     87373096
EST454       188458     93245489
EST455       181120     107118900
EST456       187732     112602367
EST457       188437     113850920
EST458       204918     138348507
EST459       190136     89874241
EST46        168457     86859060
EST460       171977     78432651
EST461       194521     135605724
EST462       216626     124798446
EST463       173181     107651348
EST464       183284     111215473
EST465       195667     115141196
EST466       137634     98038973
EST467       167473     104960427
EST468       169668     85655375
EST469       159031     89363976
EST47        163577     87987149
EST470       157076     84976050
EST471       158908     83032868
EST472       138616     76930044
EST473       167659     107534876
EST474       184354     109396675
EST475       176822     116554287
EST476       185115     121989470
EST477       180329     113412040
EST478       183250     105595615
EST479       171396     67347867
EST48        162694     83205787
EST480       169508     60215924
EST481       96862      38553686
EST49        160313     91338751
EST5         169493     66369689
EST50        162293     88449837
EST51        157695     99247444
EST52        159760     69998215
EST53        147269     82480464
EST54        72129      47670988
EST55        167521     70086597
EST56        165247     74991905
EST57        164952     91076377
EST58        159202     97091170
EST59        156790     102100352
EST6         172134     67168198
EST60        165072     99236771
EST61        160292     108342569
EST62        171997     80646070
EST63        173905     93372270
EST64        155450     84247975
EST65        148878     81668768
EST66        159084     98571420
EST67        131609     75060737
EST68        150067     91962686
EST69        195872     108737839
EST7         170565     73071733
EST70        181354     95121407
EST71        222270     121811794
EST72        187090     111908612
EST73        203923     120921264
EST74        164641     90824914
EST75        132422     60411972
EST76        137985     67964870
EST77        157783     97834828
EST78        157453     97732068
EST79        142839     78808756
EST8         180019     73158487
EST80        46286      21524324
EST81        164066     100492784
EST82        212712     115143723
EST83        224802     124305320
EST84        200943     94560402
EST85        212094     93365020
EST86        161372     93012446
EST87        144165     87402876
EST88        164649     81022721
EST89        158776     79937283
EST9         168970     69426188
EST90        153583     102343958
EST91        151706     88940754
EST92        131077     84839744
EST93        156093     112957041
EST94        141253     103425213
EST95        142079     101604771
EST96        141253     97651112
EST97        147722     81887569
EST98        178942     111005620
EST99        223818     135594745
GSS1         200936     87992234
GSS10        132676     60724263
GSS100       145434     114442767
GSS101       141763     116184076
GSS102       143261     116672134
GSS103       166570     128263370
GSS104       149025     82048493
GSS105       191436     120801377
GSS106       168728     112791123
GSS107       198746     116490361
GSS108       205237     134898580
GSS109       209604     138169536
GSS11        137126     73876072
GSS110       207354     140810088
GSS111       206097     142300473
GSS112       205162     143530015
GSS113       204925     143949353
GSS114       202025     146602176
GSS115       182173     139435749
GSS116       16997      10161585
GSS117       133164     84216220
GSS118       170165     80218632
GSS119       183871     79354137
GSS12        148408     75889690
GSS120       170036     148147503
GSS121       177747     120674510
GSS122       179422     145661236
GSS123       187615     120669917
GSS124       186870     139167746
GSS125       192430     127209576
GSS126       192032     93283266
GSS127       167559     156558237
GSS128       163626     113989509
GSS129       60894      36833138
GSS13        145642     69077970
GSS130       170924     155391265
GSS131       172236     154355390
GSS132       172285     155047185
GSS133       173669     154061261
GSS134       171880     154918497
GSS135       180286     138244448
GSS136       177778     146362755
GSS137       166232     119407177
GSS138       192388     95146131
GSS139       258614     44192301
GSS14        171166     85470449
GSS140       258272     39801873
GSS141       93069      14316936
GSS142       254550     58910013
GSS143       266302     53698538
GSS144       190431     88897932
GSS145       196772     64265586
GSS146       185069     146363674
GSS147       181726     149596530
GSS148       167299     154580222
GSS149       170987     157779305
GSS15        161590     98195938
GSS150       232935     77220077
GSS151       231030     76723540
GSS152       131132     60288793
GSS153       213637     54260267
GSS154       157555     97574152
GSS155       182942     113535224
GSS156       135785     87096792
GSS157       165173     130020704
GSS158       183702     161464628
GSS159       193931     159491073
GSS16        173175     87177879
GSS160       190374     125589387
GSS161       217120     138274983
GSS162       221520     132815022
GSS163       160693     98931260
GSS164       150123     86026098
GSS165       37410      28664475
GSS166       211853     158059324
GSS167       193130     102603272
GSS168       172161     68129161
GSS169       206239     159865505
GSS17        184004     114253534
GSS170       207855     162100676
GSS171       207176     163853706
GSS172       205397     135061335
GSS173       9478       2491452
GSS174       87032      63853715
GSS175       83577      62785783
GSS176       103113     48365477
GSS177       68934      58595891
GSS178       8571       7692351
GSS179       68591      57924394
GSS18        191866     113864968
GSS180       69224      56650935
GSS181       69460      56187403
GSS182       71202      55998401
GSS183       68561      51865315
GSS184       75915      58209304
GSS185       86540      74277212
GSS186       81317      44384966
GSS187       92266      45108910
GSS188       65131      48539953
GSS189       77811      61666620
GSS19        109268     49025698
GSS190       70214      59194054
GSS191       68204      63291319
GSS192       62731      52925680
GSS193       94994      42346893
GSS194       19509      4537258
GSS195       112930     70870954
GSS196       830        565879
GSS197       23226      28867035
GSS198       109084     70678875
GSS199       84403      34582519
GSS2         182739     92537598
GSS20        181328     101431612
GSS200       35904      22282147
GSS201       103304     62490220
GSS202       102329     63761256
GSS203       104240     67638632
GSS204       82127      41294650
GSS205       83102      54651503
GSS206       95565      61249467
GSS207       107362     78589335
GSS208       106444     76728833
GSS209       106101     79982459
GSS21        166554     114432569
GSS210       104001     80014803
GSS211       75801      50678132
GSS212       105097     63619915
GSS213       109868     66415305
GSS214       105969     59182678
GSS215       68062      37223883
GSS216       69097      38525198
GSS217       38174      18339130
GSS218       85817      46213833
GSS219       97756      56282806
GSS22        169386     97553408
GSS220       94838      49467300
GSS221       96276      55952494
GSS222       41313      23149851
GSS223       114055     43442995
GSS224       116422     39251295
GSS225       108546     52732132
GSS226       108722     67128647
GSS227       101583     78242094
GSS228       57005      34059998
GSS229       96897      36918766
GSS23        186604     125906880
GSS230       96399      37676586
GSS231       97739      35452830
GSS232       95145      39751140
GSS233       33820      15967145
GSS234       103939     66277823
GSS235       94551      61190929
GSS236       95128      60357048
GSS237       94773      60868501
GSS238       75675      70017159
GSS239       80658      68522367
GSS24        192677     129465133
GSS240       36895      34939652
GSS241       82369      27761898
GSS242       82844      26872946
GSS243       83400      25690460
GSS244       19119      5586005
GSS245       16547      7508221
GSS246       94100      60580478
GSS247       97403      65501702
GSS248       96166      65715907
GSS249       106376     69841317
GSS25        177883     105804709
GSS250       91708      45507881
GSS251       91214      49568095
GSS252       75915      41427331
GSS253       90839      57016024
GSS254       89674      61866093
GSS255       88534      63668650
GSS256       89290      62493340
GSS257       9699       6996370
GSS258       87995      63795538
GSS259       90590      62742076
GSS26        184528     106671835
GSS260       94937      59925372
GSS261       74696      63777273
GSS262       84391      78676825
GSS263       82881      80793634
GSS264       69452      51663438
GSS265       114900     62956729
GSS266       108980     55519998
GSS267       107208     51972208
GSS268       99627      44671760
GSS269       109459     48915853
GSS27        170212     149596734
GSS270       98451      44895226
GSS271       79289      63646396
GSS272       72741      72762720
GSS273       77852      64983585
GSS274       79314      60672461
GSS275       80043      61576920
GSS276       81526      75586593
GSS277       84185      86446373
GSS278       81606      89765284
GSS279       39963      32190104
GSS28        188949     147840069
GSS280       86431      66577691
GSS281       78775      63319328
GSS282       82839      62399082
GSS283       87811      61123845
GSS284       76276      48854685
GSS285       94787      57200301
GSS286       93517      59081345
GSS287       93900      58510429
GSS288       94714      57307691
GSS289       83843      51265303
GSS29        150148     104230567
GSS290       103666     69242174
GSS291       104299     74321241
GSS292       109373     68331863
GSS293       106994     71135784
GSS294       38781      26571815
GSS295       111314     66044649
GSS296       97520      60954006
GSS297       106950     56669730
GSS298       93049      72593306
GSS299       87513      93708850
GSS3         175733     88087457
GSS30        191200     131481024
GSS300       84141      99330299
GSS301       42621      19975961
GSS31        21056      14055970
GSS32        195376     126942054
GSS33        217734     116816499
GSS34        219656     114195328
GSS35        220809     112621805
GSS36        214075     122632108
GSS37        196391     154722125
GSS38        192939     145200773
GSS39        193488     73146340
GSS4         167433     85324699
GSS40        186632     96351338
GSS41        187080     123983540
GSS42        173606     161518099
GSS43        12195      7843058
GSS44        183230     99934228
GSS45        172375     121118869
GSS46        183257     123433564
GSS47        188866     120899771
GSS48        75976      66230525
GSS49        170045     100948017
GSS5         51061      30412071
GSS50        166240     102102664
GSS51        166431     101323646
GSS52        181635     120322749
GSS53        183662     115768060
GSS54        181041     122897506
GSS55        187709     112755097
GSS56        187356     135087793
GSS57        177426     103598232
GSS58        194385     118883565
GSS59        180328     129969871
GSS6         161937     84623154
GSS60        15048      13640288
GSS61        172962     139025327
GSS62        162250     111941733
GSS63        162289     111953917
GSS64        157215     106548910
GSS65        156859     129152268
GSS66        170509     142783226
GSS67        178981     116482851
GSS68        202205     126781213
GSS69        193671     110477624
GSS7         165841     79603400
GSS70        244806     126461281
GSS71        160565     106789438
GSS72        158776     118928772
GSS73        162713     124580808
GSS74        162678     124640084
GSS75        174519     108725783
GSS76        190697     140145186
GSS77        15363      9464484
GSS78        196630     124922865
GSS79        169523     110606699
GSS8         165838     89012145
GSS80        199150     130499989
GSS81        210456     89385642
GSS82        190581     96214656
GSS83        132963     92983749
GSS84        145994     117263315
GSS85        139785     117029586
GSS86        142880     113985741
GSS87        144230     119961590
GSS88        141768     115690810
GSS89        109440     91261189
GSS9         138237     67304162
GSS90        149553     122345328
GSS91        147790     117796701
GSS92        144115     113153024
GSS93        142979     115532063
GSS94        144337     119766805
GSS95        148217     121722672
GSS96        147793     117900972
GSS97        146200     121152590
GSS98        146262     121035840
GSS99        146701     120156218
HTC1         25047      27029900
HTC10        70844      69673892
HTC11        72404      69673228
HTC12        28229      33338286
HTC13        67517      60542416
HTC14        69008      69663180
HTC15        50211      37125113
HTC2         16071      36202003
HTC3         16014      36607191
HTC4         16234      35514380
HTC5         15960      40329026
HTC6         16042      37386456
HTC7         53542      31186695
HTC8         31530      19965253
HTC9         60703      77599470
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189997386
HTG117       1548       182671507
HTG118       1576       179541061
HTG119       1382       157855740
HTG12        1452       184004673
HTG120       1590       179393068
HTG121       1587       179603616
HTG122       1580       179595063
HTG123       1598       179568613
HTG124       1603       179517182
HTG125       1582       180855862
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1476       185779053
HTG129       1135       190214669
HTG13        875        191786413
HTG130       1103       184336594
HTG131       1557       186483382
HTG132       1855       177768696
HTG133       986        186174720
HTG134       1072       192049994
HTG135       1089       193222951
HTG136       602        109520336
HTG137       1031       189469892
HTG138       1055       192678789
HTG139       1163       191852916
HTG14        753        191921309
HTG140       1080       192395749
HTG141       1083       192975115
HTG142       589        103841272
HTG143       1122       192664765
HTG144       1078       192368458
HTG145       1078       192343720
HTG146       1167       191963024
HTG147       2136       191552847
HTG148       1096       192470044
HTG149       1077       192046178
HTG15        745        191963148
HTG150       1089       192468471
HTG151       1038       190311839
HTG152       1423       182976832
HTG153       1697       172225872
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93633      48168539
INV10        48900      92499510
INV100       37923      155535140
INV101       47450      148279075
INV102       31582      35878775
INV103       41258      162193552
INV104       8649       189035299
INV105       14549      181577331
INV106       5295       188760704
INV107       18509      176900436
INV108       34351      158679406
INV109       14344      172158272
INV11        35         174810098
INV110       23577      45955779
INV111       16795      180349455
INV112       21027      172501512
INV113       4891       191046501
INV114       26084      174037919
INV115       14547      181030545
INV116       44397      155376448
INV117       27112      171621394
INV118       19370      174154051
INV119       49371      138775955
INV12        43024      118980361
INV120       29055      84543185
INV121       96245      108547326
INV122       35892      166944993
INV123       23159      177277868
INV124       22654      170374262
INV125       4699       190767649
INV126       29376      152389625
INV127       55624      119361124
INV128       566        40635863
INV129       7358       190633905
INV13        75298      63164858
INV130       51895      153104512
INV131       5607       188059543
INV132       35090      162253206
INV133       3365       19020735
INV134       39813      159668855
INV135       62444      141571579
INV136       19462      30223725
INV137       104664     106635585
INV138       74577      120116541
INV139       12112      167732182
INV14        34830      26410945
INV140       18278      163726949
INV141       13818      94808827
INV142       29262      155753563
INV143       38610      149060814
INV144       51684      139700572
INV145       70877      126444377
INV146       97323      108082698
INV147       125942     86452766
INV148       35267      136215179
INV149       2886       150422275
INV15        84553      65984111
INV150       126        151012944
INV151       23388      74690617
INV16        80699      66734672
INV17        78499      66827115
INV18        49976      46941715
INV19        36850      122230889
INV2         59774      89922606
INV20        283        149271649
INV21        49885      102949968
INV22        77055      55600639
INV23        72040      61777941
INV24        493        319958
INV25        23152      127349837
INV26        6          133712559
INV27        56678      101650430
INV28        74060      50265848
INV29        70450      51165602
INV3         1369       188222232
INV30        76795      54975708
INV31        75529      57248967
INV32        76820      57121320
INV33        73292      54045794
INV34        55230      36563032
INV35        78770      56814058
INV36        74399      55126009
INV37        74219      60668587
INV38        77317      58511824
INV39        55053      36722729
INV4         878        127339729
INV40        77566      56130720
INV41        73851      51751320
INV42        74614      56336596
INV43        76884      57380757
INV44        36884      31794161
INV45        75616      48195046
INV46        73061      44538939
INV47        75225      45537111
INV48        75736      54037640
INV49        26245      18283944
INV5         26437      110195870
INV50        76161      53655102
INV51        74051      44054937
INV52        73341      42928454
INV53        73836      42555625
INV54        26520      16107114
INV55        69254      41118660
INV56        68883      41219362
INV57        68546      41151794
INV58        68774      40981022
INV59        69782      44618937
INV6         77730      71379933
INV60        70417      42304854
INV61        38300      23186973
INV62        64679      47902886
INV63        68543      51156033
INV64        70874      53458362
INV65        60941      74416445
INV66        42229      147910151
INV67        6083       12238891
INV68        81479      126211856
INV69        100429     109691945
INV7         53250      95689646
INV70        116036     96137263
INV71        101319     70777781
INV72        35239      166647152
INV73        30755      171594048
INV74        27724      170864744
INV75        2640       190498229
INV76        6183       191107737
INV77        17837      180141483
INV78        15378      184713635
INV79        6839       167378491
INV8         43590      89547090
INV80        8875       189509571
INV81        15662      184182101
INV82        30722      171526293
INV83        65600      142208408
INV84        21638      22670137
INV85        50224      153584896
INV86        4095       191102716
INV87        11177      184659675
INV88        29153      168751324
INV89        3317       189349389
INV9         80242      71424686
INV90        6330       186171285
INV91        12367      180474553
INV92        39596      157268982
INV93        60755      142074593
INV94        67983      110944176
INV95        93063      112788673
INV96        14244      174036919
INV97        29357      160122987
INV98        66634      130026281
INV99        38635      162651925
MAM1         21033      154703929
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         13956      164823972
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        9          136550477
MAM26        54         7614329
MAM27        215        34073042
MAM28        431        71272130
MAM29        861        68509101
MAM3         20417      31485813
MAM30        1706       2411269
MAM31        6836       6159631
MAM32        79408      74432423
MAM33        31118      118970732
MAM34        75934      62138473
MAM35        68729      72278564
MAM36        64284      77756472
MAM37        49050      73525040
MAM4         26809      24997481
MAM5         13731      20581346
MAM6         3445       7368893
MAM7         107        700282
MAM8         19         1775631
MAM9         1          275920749
PAT1         222547     70103365
PAT10        124323     102482758
PAT100       178683     3394977
PAT101       178342     3388498
PAT102       178198     3385762
PAT103       178185     3385515
PAT104       132610     2848492
PAT105       342935     8573375
PAT106       188806     88519660
PAT107       111348     132068608
PAT108       3850       194703659
PAT109       131292     110979300
PAT11        98861      64213814
PAT110       158599     54826034
PAT111       224682     34110443
PAT112       250080     15844315
PAT113       180713     63623716
PAT114       51663      26102651
PAT115       114134     110460955
PAT116       137535     83208192
PAT117       164376     99023032
PAT118       158392     103578951
PAT119       137596     115028387
PAT12        141822     62674725
PAT120       42621      28098514
PAT121       193712     81686401
PAT122       150218     108404223
PAT123       356051     11379519
PAT124       257211     57607676
PAT125       138160     48226316
PAT126       322021     22795469
PAT127       155642     102753966
PAT128       132724     110696205
PAT129       128341     121313309
PAT13        103918     59414486
PAT130       21664      184390005
PAT131       144889     112900617
PAT132       171997     96405634
PAT133       44617      171215968
PAT134       9167       47581637
PAT135       33645      178334734
PAT136       153558     109675196
PAT137       178705     90913377
PAT138       136050     115324192
PAT139       120392     123343236
PAT14        102671     49405447
PAT140       8526       8991488
PAT141       155429     101473147
PAT142       184764     88815933
PAT143       182409     85292093
PAT144       174403     93928365
PAT145       28829      20461016
PAT146       147930     108545990
PAT147       160944     101973644
PAT148       185311     90980420
PAT149       231649     49265020
PAT15        120396     52402755
PAT150       203020     47532890
PAT151       277497     9807983
PAT152       220369     46464135
PAT153       107732     2906467
PAT154       270386     21672571
PAT155       186658     61145888
PAT156       109660     106103715
PAT157       47750      9597453
PAT158       87160      87875041
PAT159       78137      95530529
PAT16        108534     62749510
PAT160       144044     78088083
PAT161       168234     70789100
PAT162       121014     93305948
PAT163       103745     84894722
PAT164       166138     46774575
PAT165       270022     5130418
PAT166       269978     5129582
PAT167       269978     5129582
PAT168       237888     4519872
PAT169       269396     5118524
PAT17        47677      17039689
PAT170       235449     25551617
PAT171       203694     47175501
PAT172       12104      424974
PAT173       165310     74498391
PAT174       91504      126583865
PAT175       171359     72072028
PAT176       214402     66356095
PAT177       42873      49259391
PAT178       235138     59544089
PAT179       123750     125093767
PAT18        146771     52594264
PAT180       217504     66591902
PAT181       198097     84199370
PAT182       2346       5855451
PAT183       190271     85554469
PAT184       158609     102172052
PAT185       157481     102983510
PAT186       99253      76900838
PAT187       156209     98316380
PAT188       91682      138752301
PAT189       160779     88041379
PAT19        153714     78039687
PAT190       136985     111168356
PAT191       42350      35878823
PAT192       168931     98953101
PAT193       142774     114661479
PAT194       131583     119360876
PAT195       97976      135115181
PAT196       120866     84788744
PAT197       3033       5363935
PAT198       93110      87244389
PAT199       91788      79966796
PAT2         194517     84670519
PAT20        104716     118087764
PAT200       83782      91661717
PAT201       108692     54197295
PAT202       101026     56660358
PAT203       150189     24631215
PAT204       93817      82459162
PAT205       26010      162900357
PAT206       113938     65759860
PAT207       81619      28134712
PAT208       3631       191518875
PAT209       84408      78157905
PAT21        133760     95339884
PAT210       145069     26290546
PAT211       76922      99953842
PAT212       95339      71448928
PAT213       129838     31394819
PAT214       4941       7291501
PAT215       106322     62280040
PAT216       140008     12598692
PAT217       150515     23979175
PAT218       74138      6340578
PAT219       58028      68766855
PAT22        84658      79569499
PAT220       41081      54488985
PAT221       60875      54847144
PAT222       37721      64051648
PAT223       41404      61065384
PAT224       40778      53269659
PAT225       79940      57624117
PAT226       111537     54516792
PAT227       37063      8158413
PAT228       103405     55692396
PAT229       99422      44580758
PAT23        123517     103390235
PAT230       84104      73950890
PAT231       98253      10042153
PAT232       123244     19683537
PAT233       86785      129976438
PAT234       158937     78754509
PAT235       213344     47012213
PAT236       169347     66529313
PAT237       59816      8717320
PAT238       161863     78377268
PAT239       119782     100490233
PAT24        119460     105504912
PAT240       86768      128899853
PAT241       37958      167204138
PAT242       35970      168659354
PAT243       75398      138092775
PAT244       252324     29172044
PAT245       137107     91853082
PAT246       148261     82349894
PAT247       141924     74969532
PAT248       16885      11382076
PAT249       141695     86763404
PAT25        145016     86742510
PAT250       144995     93151551
PAT251       257285     12186129
PAT252       152526     4584721
PAT253       240738     21500238
PAT254       248574     11702646
PAT255       258799     3881985
PAT256       76619      1149285
PAT257       258799     3881985
PAT258       253598     6415258
PAT259       183006     43408049
PAT26        174984     64376970
PAT260       89605      2867360
PAT261       107123     34027393
PAT262       84337      43816234
PAT263       136399     84788603
PAT264       257637     3864555
PAT265       231204     18136950
PAT266       162705     79319463
PAT267       174411     68021333
PAT268       36967      29808436
PAT27        72023      1800575
PAT28        102082     77369523
PAT29        93953      87559053
PAT3         171992     95904578
PAT30        119906     61673440
PAT31        96693      78977300
PAT32        128053     54918332
PAT33        92448      51197962
PAT34        117827     69179372
PAT35        119659     35930835
PAT36        121817     44323228
PAT37        94325      86760334
PAT38        147250     22244915
PAT39        149442     31041428
PAT4         153752     106058463
PAT40        114667     49977068
PAT41        33897      46161678
PAT42        95722      83166454
PAT43        100230     70746430
PAT44        135982     39560964
PAT45        143799     35449217
PAT46        123839     64315903
PAT47        104451     81156036
PAT48        93089      74613582
PAT49        113258     66580329
PAT5         57129      23913162
PAT50        65584      54917199
PAT51        135191     107998311
PAT52        167082     97033437
PAT53        116397     127556980
PAT54        196343     76723060
PAT55        80303      127991082
PAT56        27631      180872621
PAT57        185409     93066654
PAT58        274258     6856450
PAT59        129447     31627433
PAT6         170645     91912459
PAT60        161320     77719729
PAT61        92640      89109823
PAT62        106092     74956197
PAT63        122369     64032804
PAT64        68014      30415871
PAT65        70748      109764944
PAT66        87946      82759037
PAT67        92971      78935157
PAT68        93164      72444136
PAT69        93383      75087244
PAT7         154882     88271976
PAT70        115770     60532287
PAT71        102747     9942058
PAT72        175927     10547425
PAT73        171510     10872561
PAT74        171496     10866737
PAT75        99865      86225427
PAT76        99         196466297
PAT77        67         192869889
PAT78        103        195600591
PAT79        1132       196318332
PAT8         131115     96964325
PAT80        97604      5772661
PAT81        151009     9636510
PAT82        151022     9621259
PAT83        151024     9622125
PAT84        151021     9620837
PAT85        94628      88047763
PAT86        92255      94526562
PAT87        37563      34676580
PAT88        83459      93185861
PAT89        15567      180450135
PAT9         129259     101026544
PAT90        164890     19209721
PAT91        178944     3399936
PAT92        177434     3371246
PAT93        175305     3330795
PAT94        101402     1926638
PAT95        169165     12412132
PAT96        178699     3395281
PAT97        178691     3395129
PAT98        178677     3394863
PAT99        140786     2674934
PHG1         5858       104050445
PHG2         2992       106207427
PHG3         2572       66942358
PLN1         59766      93435562
PLN10        47560      48043288
PLN100       71914      76778143
PLN101       79933      65140147
PLN102       7881       7653699
PLN103       77964      63295774
PLN104       75119      68203027
PLN105       81552      59230320
PLN106       81427      58454516
PLN107       24135      26980881
PLN108       73476      62799151
PLN109       71880      70746729
PLN11        71554      76908065
PLN110       64037      83442068
PLN111       56657      63917290
PLN112       91698      52378784
PLN113       74528      67867581
PLN114       71145      68241066
PLN115       39870      47553550
PLN116       70411      70792961
PLN117       61219      79149056
PLN118       63836      79163403
PLN119       31426      30106843
PLN12        39813      50748888
PLN120       69406      73359142
PLN121       64843      74858358
PLN122       62023      81089483
PLN123       22638      29369567
PLN124       57411      88070188
PLN125       58537      83126633
PLN126       53952      89451972
PLN127       11053      124283474
PLN128       74         193598163
PLN129       22041      163061998
PLN13        38810      63037057
PLN130       9345       153824225
PLN131       6          176139136
PLN132       16375      144837582
PLN133       5          175204852
PLN134       18254      165563028
PLN135       22970      45779273
PLN14        25593      117905384
PLN15        21197      110640707
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        1473       11877350
PLN2         74475      77610202
PLN20        23259      121287391
PLN21        6071       150261554
PLN22        1195       166515226
PLN23        1459       167290703
PLN24        29         162241774
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        21959      107213509
PLN3         35971      105504932
PLN30        66929      69651794
PLN31        29601      31673017
PLN32        76773      76045451
PLN33        36335      41223261
PLN34        57312      72149903
PLN35        28690      28924739
PLN36        2644       102424140
PLN37        3          73585790
PLN38        30         105815221
PLN39        280        132365998
PLN4         1364       177436076
PLN40        99         128334245
PLN41        276        130077458
PLN42        162        128724595
PLN43        96         78244099
PLN44        155        127581843
PLN45        139        127824019
PLN46        170        128332952
PLN47        169        132973795
PLN48        195        151336000
PLN49        274        194993930
PLN5         1845       186016576
PLN50        274        194924066
PLN51        273        194188128
PLN52        130        196315778
PLN53        34         180508881
PLN54        7          177736082
PLN55        912        162206363
PLN56        1856       91067923
PLN57        7181       18795412
PLN58        14346      29953091
PLN59        18734      133874276
PLN6         1848       194273109
PLN60        77721      74507626
PLN61        96410      58591539
PLN62        34275      32440815
PLN63        80176      71445370
PLN64        77560      75771651
PLN65        80031      70145527
PLN66        81425      74708877
PLN67        60020      34040902
PLN68        98793      55118247
PLN69        82271      68246017
PLN7         1688       194277347
PLN70        44635      98679701
PLN71        5486       152820929
PLN72        11882      165587691
PLN73        29507      120346013
PLN74        53414      102423636
PLN75        17706      12651186
PLN76        80799      72353126
PLN77        17669      12944204
PLN78        49499      72634866
PLN79        25059      110563611
PLN8         1831       193322220
PLN80        13564      89759215
PLN81        1          774434471
PLN82        8227       28428618
PLN83        1858       148969943
PLN84        2          135217911
PLN85        2          155188403
PLN86        2          140023111
PLN87        2          154604167
PLN88        2          148753627
PLN89        3          173772618
PLN9         49137      106386331
PLN90        3          178836778
PLN91        3          176344173
PLN92        3          195539469
PLN93        12431      129466187
PLN94        81788      65449046
PLN95        92324      57809922
PLN96        23030      15588625
PLN97        77269      71117031
PLN98        69887      84176176
PLN99        76203      67720813
PRI1         23034      59762327
PRI10        1254       178826298
PRI11        862        104685991
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22384      144405290
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2080       192530869
PRI23        7689       181560403
PRI24        9223       22895959
PRI25        27937      79142894
PRI26        59722      83844027
PRI27        36281      82259492
PRI28        8758       172032991
PRI29        2265       191511011
PRI3         1439       174432870
PRI30        1665       190764297
PRI31        2074       192160303
PRI32        2195       191150383
PRI33        13091      162158571
PRI34        2067       170809233
PRI35        56436      88264450
PRI36        4477       9299778
PRI37        32154      63605650
PRI38        20538      119329276
PRI39        18692      150583835
PRI4         1278       185732787
PRI40        67706      85012999
PRI41        50233      89169276
PRI42        41718      84042477
PRI43        47255      95768626
PRI44        26884      100976749
PRI45        28651      109110050
PRI46        22892      105447380
PRI47        21149      48001117
PRI48        23090      123852730
PRI49        37853      110138835
PRI5         1335       184393385
PRI50        32711      47211739
PRI51        1          229594237
PRI52        1          190673448
PRI53        1          197221778
PRI54        19046      163764741
PRI55        39631      73567729
PRI6         1180       180110156
PRI7         1229       180258465
PRI8         1219       179099975
PRI9         1374       174952034
ROD1         37465      132627351
ROD10        989        181994394
ROD11        312        58991276
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15172      159115348
ROD2         908        176227506
ROD20        20965      153341670
ROD21        1216       193805576
ROD22        1007       158474097
ROD23        15256      168408209
ROD24        37600      68951071
ROD25        20074      114216098
ROD26        1529       193330721
ROD27        150580     18422475
ROD28        75243      78246859
ROD29        83701      53128311
ROD3         910        173109878
ROD30        48938      55017740
ROD4         900        173795989
ROD5         920        174584743
ROD6         965        177316696
ROD7         974        179597759
ROD8         968        181268865
ROD9         1001       181597689
STS1         85256      36747730
STS10        57907      44420409
STS11        48921      37511590
STS12        57924      43637361
STS13        64061      42739168
STS14        93170      34131915
STS15        104293     26506307
STS16        10768      2915732
STS17        103700     27504029
STS18        97621      33595220
STS19        96610      34549559
STS2         84142      49927708
STS20        71196      25121130
STS3         65860      25925675
STS4         77854      37074622
STS5         9143       5361327
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55705      37758824
SYN1         52640      71007960
SYN2         43733      80665007
SYN3         23830      124618757
SYN4         4593       176418820
SYN5         4587       176330523
SYN6         4592       176401278
SYN7         10332      162847446
SYN8         56963      72584876
SYN9         14530      27054274
TSA1         119079     37787968
TSA10        18501      20932212
TSA100       76680      52659255
TSA101       66774      66687697
TSA102       63892      75957536
TSA103       86991      55453747
TSA104       51740      27880810
TSA105       74245      86358066
TSA106       80229      75622518
TSA107       84801      72305810
TSA108       77881      83686531
TSA109       94375      51986778
TSA11        134170     34616677
TSA110       99157      69089270
TSA111       59230      97228833
TSA112       109175     49378845
TSA113       63354      68310026
TSA114       80812      88891396
TSA115       70536      71912167
TSA116       57870      119426084
TSA117       5003       6824267
TSA118       106689     67779914
TSA119       93410      83369889
TSA12        59768      19488440
TSA120       98615      76609458
TSA121       88033      68056906
TSA122       84942      58892567
TSA123       77606      62175202
TSA124       82433      76719447
TSA125       98411      60355080
TSA126       94492      42586906
TSA127       76549      54458912
TSA128       42472      39761343
TSA129       59626      61176103
TSA13        64542      58862448
TSA130       59047      61657426
TSA131       59168      62167042
TSA132       71956      78379950
TSA133       87818      51643326
TSA134       63336      64766777
TSA135       2563       1147163
TSA136       77745      34626570
TSA137       74689      66831444
TSA138       81079      78598444
TSA139       74692      64675647
TSA14        91996      62507406
TSA140       41882      34789042
TSA141       87600      70235611
TSA142       89003      68194525
TSA143       84656      77065314
TSA144       76791      81310397
TSA145       12038      10028761
TSA146       104187     53670971
TSA147       80878      61177338
TSA148       69693      78323809
TSA149       73196      67845845
TSA15        87656      43266725
TSA150       86992      75471245
TSA151       89428      70000229
TSA152       62311      102880653
TSA153       95611      74148270
TSA154       20799      14551082
TSA155       82974      63616708
TSA156       83472      63790182
TSA157       78941      73480275
TSA158       76936      75992422
TSA159       93256      58483267
TSA16        76033      85960467
TSA160       100927     67777228
TSA161       35508      24274059
TSA162       103445     64539230
TSA163       94920      75734700
TSA164       80355      64233867
TSA165       30552      47121787
TSA166       51839      98295419
TSA167       46917      107683976
TSA168       44952      111436512
TSA169       42000      117073120
TSA17        79281      72807474
TSA170       39479      121890914
TSA171       37678      125330444
TSA172       30670      109097872
TSA173       78905      65671407
TSA174       61760      78088578
TSA175       65825      57454871
TSA176       40183      19203236
TSA177       38342      27295147
TSA178       35785      38621286
TSA179       34467      33162251
TSA18        86987      44516728
TSA180       31670      56857624
TSA181       31446      57845848
TSA182       39266      23134620
TSA183       40382      18182813
TSA184       41061      15174943
TSA185       41459      13408377
TSA186       41699      12346210
TSA187       26552      7560175
TSA188       41889      11506042
TSA189       41935      11303163
TSA19        73716      88529186
TSA190       41981      11096976
TSA191       42054      10770114
TSA192       42099      10570948
TSA193       42146      10365212
TSA194       43309      10362207
TSA195       69616      80129578
TSA196       26923      63171712
TSA197       89415      47258677
TSA198       47220      118089707
TSA199       86115      55982924
TSA2         112857     41270825
TSA20        66306      50594099
TSA200       79788      68179642
TSA201       4209       7000727
TSA202       51803      113422564
TSA203       44468      125297442
TSA204       37716      136219910
TSA205       63686      93740297
TSA206       62741      93126523
TSA207       46334      60938611
TSA208       62968      91356653
TSA209       75264      70251649
TSA21        81010      82050811
TSA210       48708      114790470
TSA211       81060      60457833
TSA212       48578      115504480
TSA213       79665      62922125
TSA214       71228      77140870
TSA215       52435      59143202
TSA216       80932      60001620
TSA217       40964      127412427
TSA218       88534      47058145
TSA219       61937      92459996
TSA22        62981      84302128
TSA220       79675      61576520
TSA221       88145      48373235
TSA222       55802      72353627
TSA223       71004      77849450
TSA224       68819      81280831
TSA225       85636      49751087
TSA226       66528      82429296
TSA227       91281      39406050
TSA228       62631      88834556
TSA229       52061      26280651
TSA23        85953      72671714
TSA24        99501      51797168
TSA25        58933      18373850
TSA26        85797      70106183
TSA27        120080     38852195
TSA28        135074     34047115
TSA29        52642      68387687
TSA3         109733     40830795
TSA30        47693      62712379
TSA31        2568       4358627
TSA32        60987      81840924
TSA33        92736      66826706
TSA34        109036     50277160
TSA35        106046     49573929
TSA36        101812     53917489
TSA37        104284     47753675
TSA38        25389      16338232
TSA39        66195      59263498
TSA4         110492     47447995
TSA40        92195      67722162
TSA41        92732      62207585
TSA42        79993      85992869
TSA43        99500      49867771
TSA44        113591     34204106
TSA45        95201      67568206
TSA46        13667      8496844
TSA47        94376      35380174
TSA48        77496      35938873
TSA49        106331     43405855
TSA5         78313      23627515
TSA50        113836     45499687
TSA51        29689      20438208
TSA52        103710     51345877
TSA53        101107     54207340
TSA54        97794      59163600
TSA55        81457      86088009
TSA56        69654      30947148
TSA57        90365      71288560
TSA58        97520      54422413
TSA59        60100      105474646
TSA6         111583     58975350
TSA60        86932      65069884
TSA61        78619      70637275
TSA62        83058      72217122
TSA63        82797      72052194
TSA64        68995      90904935
TSA65        90775      66751306
TSA66        75897      84474882
TSA67        71863      73185394
TSA68        68804      60806344
TSA69        84870      78036163
TSA7         87421      57901423
TSA70        85128      78006974
TSA71        70319      97838883
TSA72        85540      69665112
TSA73        84998      51586540
TSA74        102004     68493695
TSA75        87257      58729411
TSA76        103898     56923600
TSA77        73135      72950834
TSA78        79414      45054983
TSA79        87334      79220475
TSA8         104450     72517643
TSA80        91719      69206004
TSA81        78362      53147378
TSA82        78400      56954579
TSA83        97317      60069251
TSA84        38937      36173906
TSA85        88948      76782378
TSA86        95034      55397472
TSA87        110915     44811175
TSA88        97305      57964555
TSA89        65129      97030273
TSA9         109298     60842426
TSA90        15369      14817152
TSA91        101297     55494442
TSA92        91074      53960295
TSA93        93807      43529224
TSA94        85784      74014953
TSA95        73184      72093947
TSA96        39931      46731303
TSA97        77159      80203977
TSA98        77312      55431136
TSA99        84109      38689281
UNA1         331        203865
VRL1         64921      70743222
VRL10        43229      72883414
VRL11        60546      70181917
VRL12        61291      72698559
VRL13        66138      68383069
VRL14        47474      63514362
VRL15        62748      70824890
VRL16        57105      72671164
VRL17        63471      63569451
VRL18        57013      73282501
VRL19        52416      66613464
VRL2         66456      66394315
VRL20        54666      72252204
VRL21        58371      71305849
VRL22        56070      73177658
VRL23        55198      73816113
VRL24        28361      46021793
VRL25        52392      75247602
VRL26        37906      81556554
VRL27        47591      74878242
VRL28        47919      74095473
VRL29        49006      76577134
VRL3         70086      63560637
VRL30        13357      24592150
VRL31        49528      77611092
VRL32        42588      86703328
VRL33        41429      83004471
VRL34        48494      79336037
VRL35        36906      87679514
VRL36        2852       8802033
VRL37        39774      87526119
VRL38        43801      83268438
VRL39        46267      76297240
VRL4         68161      65163273
VRL40        44530      83616130
VRL41        43788      80984130
VRL42        40552      81165730
VRL43        53348      82783719
VRL44        15016      15813569
VRL5         68644      68678177
VRL6         19520      24666295
VRL7         47936      77148761
VRL8         46496      71635672
VRL9         43813      71159953
VRT1         67784      78045245
VRT10        1319       193250611
VRT11        8963       180750180
VRT12        3137       102130897
VRT13        13369      172251922
VRT14        5823       185079394
VRT15        3792       188754727
VRT16        49374      115803280
VRT17        79227      69257550
VRT18        77257      66386582
VRT19        20336      15060778
VRT2         1771       193421572
VRT20        71598      76332229
VRT21        44722      123183634
VRT22        77164      63326158
VRT23        79194      62129715
VRT24        81632      58066623
VRT25        35653      24559621
VRT26        102781     66114723
VRT27        81132      56361998
VRT28        85590      58032538
VRT29        62900      47209256
VRT3         48246      120611104
VRT30        90681      54038473
VRT31        76015      57719296
VRT32        8528       7313509
VRT33        74698      58302812
VRT34        55741      44856161
VRT35        80839      56878544
VRT36        75523      58889797
VRT37        79311      59507440
VRT38        46686      16343143
VRT39        109939     52960668
VRT4         24578      148933541
VRT40        77982      64935635
VRT41        31094      14735456
VRT42        94925      49728392
VRT43        30643      135922373
VRT44        46         194863500
VRT45        96         193208213
VRT46        166        189920816
VRT47        300        194496566
VRT48        730        193323130
VRT49        2970       190777490
VRT5         39074      99063377
VRT50        57568      140009526
VRT51        33866      3612693
VRT52        177067     28429798
VRT53        53955      90444098
VRT54        3242       189215331
VRT55        9          178794778
VRT56        10         196480447
VRT57        11         184541365
VRT58        28         196498040
VRT59        389        196385145
VRT6         72862      66465270
VRT60        1315       195608731
VRT61        2566       194640733
VRT62        3378       193090756
VRT63        19261      75277334
VRT7         31810      63619061
VRT8         30156      115739630
VRT9         1265       193440277

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 216.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

23905728 18350295330   Homo sapiens
9763341  10031471527   Mus musculus
2197131   6528387605   Rattus norvegicus
2228018   5428015962   Bos taurus
4186597   5209366395   Zea mays
3298244   4896861402   Sus scrofa
1346788   3235801471   Hordeum vulgare subsp. vulgare
1728923   3187760254   Danio rerio
72        2590574434   Ovis canadensis canadensis
1812397   1942161658   Triticum aestivum
205248    1836270727   Cyprinus carpio
745662    1746217989   Solanum lycopersicum
1377917   1642656631   Oryza sativa Japonica Group
327068    1595510956   Apteryx australis mantelli
258052    1436154458   Strongylocentrotus purpuratus
462589    1335630573   Macaca mulatta
490080    1264194969   Spirometra erinaceieuropaei
1588048   1249992770   Xenopus tropicalis
2583010   1211825649   Arabidopsis thaliana
1780727   1203105372   Nicotiana tabacum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2016

                NCBI-GenBank Flat File Release 216.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ04).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:


   Benson DA, Clark K, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW.
   GenBank. Nucleic Acids Res. 42(Database issue):D32-7 (2014)

   DOI:  10.1093/nar/gkt1030
   PMID: 24217914

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al, Nucleic Acids Res. 42(Database issue), D32-7 (2014)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 216.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Michael Kornbluh, Jim Ostell, Vasuki Palanigobu,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Kamen Todorov, Eugene Yaschenko,
	Sergey Zhdanov, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center