Release Notes For GenBank Release 217

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2016

               NCBI-GenBank Flat File Release 217.0

                    Distribution Release Notes

 198565475 loci, 224973060433 bases, from 198565475 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 217.0
1.2 Cutoff Date
1.3 Important Changes in Release 217.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 217.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 217.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 217.0, incorporates data processed by the INSDC databases
as of Thursday, December 15, 2016 at approximately 1:33am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 217.0

1.3.1 Organizational changes

The total number of sequence data files increased by 49 with this release:

  - the BCT division is now composed of 304 files (+23)
  - the CON division is now composed of 357 files (+5)
  - the ENV division is now composed of  94 files (+1)
  - the GSS division is now composed of 303 files (+2)
  - the HTG division is now composed of 154 files (+1)
  - the MAM division is now composed of  39 files (+2)
  - the PAT division is now composed of 280 files (+12)
  - the PLN division is now composed of 137 files (+2)
  - the VRL division is now composed of  45 files (+1)

1.3.2 New feature introduced : propeptide

  A new feature, propeptide, has been added to the INSDC Feature Table Document
as of this release:

Feature Key           propeptide

Definition            propeptide coding sequence; coding sequence for the
                      domain of a proprotein that is cleaved to form the mature protein product

Optional qualifiers   /allele="text"
                      /citation=[number]
                      /db_xref="<database>:<identifier>"
                      /experiment="[CATEGORY:]text"
                      /function="text"
                      /gene="text"
                      /gene_synonym="text"
                      /inference="[CATEGORY:]TYPE[ (same species)][:EVIDENCE_BASIS]"
                      /locus_tag="text" (single token)
                      /map="text"
                      /note="text"
                      /old_locus_tag="text" (single token)
                      /product="text"
                      /pseudo
                      /pseudogene="TYPE"
                      /standard_name="text"

  Although propeptide has been legal since October 2016, implementation
of the new feature key may require several months.

1.3.3 New qualifier introduced : /recombination_class

  A new qualifier, /recombination_class, has been added to the INSDC Feature
Table Document as of this release, for use with the misc_recomb feature:

Qualifier       /recombination_class

Definition      a structured description of the classification of recombination 
                hotspot region within a sequence

Value format    "TYPE"

Example         /recombination_class="meiotic recombination"
                /recombination_class="breakpoint_junction"

Comment         TYPE is a term taken from the INSDC controlled vocabulary for
                recombination classes. On 15-OCT-2016 the following terms
                were valid:

                meiotic_recombination
                mitotic_recombination
                non_allelic_homologous_recombination
                breakpoint_junction
                other	

  Although /recombination_class has been legal since October 2016,
implementation of the new qualifier may require several months.

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 217.0. Consider gbgss174.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        December 15 2016

                NCBI-GenBank Flat File Release 217.0

                           GSS Sequences (Part 1)

   87032 loci,    63853715 bases, from    87032 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "174" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats
      and FASTA header to be simplified

                        **NOTE**
  The removal of GI identifiers from GenBank (and RefSeq) Release and
  Update products has been postponed until March of 2017. NCBI will initially
  implement this change only in the Entrez system, in order to better gauge
  the impact that it will have on users. We expect that the Entrez change will
  take place in late October or early November of 2016.
                        **NOTE**

  As of March 15 2017, the integer sequence identifiers known as "GIs" will
no longer be included in the GenBank, GenPept, and FASTA formats for GenBank
Release and GenBank Update products. The FASTA header will be further simplified,
to report only the sequence Accession.Version for records that originate within
the International Sequence Database Collaboration (INSDC).

  As first described in the Release Notes for GenBank 199.0 in December 2013,
NCBI is in the process of moving to storage solutions which utilize only
Accession.Version identifiers. See Section 1.4.4 of these release notes for
additional background information about those developments.

  Given this shift to non-GI-based systems, the importance of using
Accession.Version identifiers cannot be overstated. As early as October 2016,
NCBI will cease displaying GI identifiers in the flatfile and FASTA views
generated within the Entrez:Nucleotide and Entrez:Protein resources. So
any web-related processes solely dependent on GIs will need to be adjusted
before that time or they will cease to work.  

  Previously-assigned GI sequence identifiers will continue to exist
'behind the scenes', and NCBI services which accept GIs as inputs will
continue to be supported. NCBI will be adding support for Accession.Version
identifiers to any services that currently do not support them. As NCBI
makes this transition, we encourage any users who have workflows that
depend on GIs to begin planning to use Accession.Version identifiers instead.

  The FASTA format will also be changed for all sequence records originating
within the INSDC, to report only the Accession.Version and the record title.
This will improve compatibility with other file types provided by NCBI and
others, including GFF3, Gene, and dbSNP download files. This FASTA format
change has already been made for the redesigned genomes FTP site based on
user requests to have a single consistent sequence identifier for both GFF3
and FASTA formats.

  At this time, we plan to continue to provide database source information in
the FASTA header/definition line for non-INSDC sources of sequence data,
including UniProt, PDB structures, PIR, and Patent sequences.

Example 1 : An INSDC nucleotide record

  In the sample record below, nucleotide sequence AF123456 was assigned a
GI of 6633795, and the protein translated from its coding region feature
was assigned a GI of 6633796 :

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2  GI:6633795
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /db_xref="GI:6633796"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  After September 15 2016, the Accession.Version will be the sole sequence
version identifier. The GI value on the VERSION line and the GI /db_xref
qualifier for the coding region feature will no longer be visible:

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

Example 2 : A GenPept record for an INSDC sequence

The current GenPept display format includes GI identifiers in the VERSION lines
(note that the coding region feature for GenPept has never included the display
of GI identifiers) :

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1  GI:6633796
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

After September 15 2016, the VERSION line will no longer include the GI value:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

Example 3: FASTA format for an INSDC nucleotide and protein sequence

The current FASTA display, for most products, includes GI and database
source information (eg, 'gb' for GenBank, 'emb' for ENA, 'dbj' for
DDBJ), using the '|' character as a delimiter:

>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE


As of September 15 2016, just the Accession.Version will be provided:

>AF123456.2 Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>AAF19666.1 doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

Please direct any inquiries about these changes to the NCBI Service Desk:

  info@ncbi.nlm.nih.gov

1.4.2 GI sequence identifiers are being phased out at NCBI

  The numeric GI sequence identifier that NCBI used to assign to all
nucleotide and protein sequences was first introduced for GenBank Release
products as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for over 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who
utilize GIs in their own information systems and analysis pipelines, so it is
being implemented gradually. Unannotated WGS projects consisting of millions
of contigs and scaffolds, and unannotated TSA projects, are the first two
classes of records for which GIs are no longer being assigned. But the practice
will ultimately expand to include other classes of records.

  If GIs are central to your operations, NCBI strongly urges that you begin
planning a switch to the use of Accession.Version identifiers instead.

  The contigs and scaffolds of the ALWZ04 WGS project are good examples of
sequences that lack GIs. Below are excerpts from the flatfile representation
of the first ALWZ04 contig, and the 'singleton scaffold' which is constructed
from it. Note the absence of a GI value on the VERSION line of these two
records:

LOCUS       ALWZ040000001           1191 bp    DNA     linear   PLN 13-MAR-2015
DEFINITION  Picea glauca, whole genome shotgun sequence.
ACCESSION   ALWZ040000001 ALWZ040000000
VERSION     ALWZ040000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
ORIGIN      
        1 ctataatacc cctatgccaa acgaacccaa ttgtaaatgt aaatgcaaat gtacttaggc
       61 tggttagttg tttaatatca ttttttgtat gcaccttcca tggtataatg cgcacatgta
      121 tagcgcacta aaattatgaa gtgtgcccat tccaagatat tgcgcgtaaa aaacttaagt
      181 gtgcatgatt ttgagactag ggagactttg tgtatatgtt gtgttttata tgctggagag
      241 acaattatta ttagttagga ggattatgtt ttgtactagg caagagagcc tagatgttaa
      301 aggctagtga gcctattttt gtatatgtct catcattaat ataatacatc attgtgtgta
....
      901 ttgttgggaa ttgatttcct gaatgtgtta aactgcattg atagggatct gagaattcct
      961 ttctggccta ttgctgaagc tttggaaggg aggtggggca accgagggac tgttgagaag
     1021 agaagggtca cacttcctgg ggtgggacaa gcatgtgggg aattagggat tgcaggatgt
     1081 tagtttgaat tggcacctat gacagagtct ttcctattgt ctgagatatg tcagcttggt
     1141 taggaaaccc tttacctggg tagagtttag tcccagctcg ggggtgaccc a
//

LOCUS       ALWZ04S0000001          1191 bp    DNA     linear   CON 13-MAR-2015
DEFINITION  Picea glauca Pg-01r141201s0000001, whole genome shotgun sequence.
ACCESSION   ALWZ04S0000001 ALWZ0400000000
VERSION     ALWZ04S0000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
CONTIG      join(ALWZ040000001.1:1..1191)
//

Sample URLs from which ALWZ04 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.*.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.*.gbff.gz

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2774 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct31.seq - Bacterial sequence entries, part 31.
231. gbbct32.seq - Bacterial sequence entries, part 32.
232. gbbct33.seq - Bacterial sequence entries, part 33.
233. gbbct34.seq - Bacterial sequence entries, part 34.
234. gbbct35.seq - Bacterial sequence entries, part 35.
235. gbbct36.seq - Bacterial sequence entries, part 36.
236. gbbct37.seq - Bacterial sequence entries, part 37.
237. gbbct38.seq - Bacterial sequence entries, part 38.
238. gbbct39.seq - Bacterial sequence entries, part 39.
239. gbbct4.seq - Bacterial sequence entries, part 4.
240. gbbct40.seq - Bacterial sequence entries, part 40.
241. gbbct41.seq - Bacterial sequence entries, part 41.
242. gbbct42.seq - Bacterial sequence entries, part 42.
243. gbbct43.seq - Bacterial sequence entries, part 43.
244. gbbct44.seq - Bacterial sequence entries, part 44.
245. gbbct45.seq - Bacterial sequence entries, part 45.
246. gbbct46.seq - Bacterial sequence entries, part 46.
247. gbbct47.seq - Bacterial sequence entries, part 47.
248. gbbct48.seq - Bacterial sequence entries, part 48.
249. gbbct49.seq - Bacterial sequence entries, part 49.
250. gbbct5.seq - Bacterial sequence entries, part 5.
251. gbbct50.seq - Bacterial sequence entries, part 50.
252. gbbct51.seq - Bacterial sequence entries, part 51.
253. gbbct52.seq - Bacterial sequence entries, part 52.
254. gbbct53.seq - Bacterial sequence entries, part 53.
255. gbbct54.seq - Bacterial sequence entries, part 54.
256. gbbct55.seq - Bacterial sequence entries, part 55.
257. gbbct56.seq - Bacterial sequence entries, part 56.
258. gbbct57.seq - Bacterial sequence entries, part 57.
259. gbbct58.seq - Bacterial sequence entries, part 58.
260. gbbct59.seq - Bacterial sequence entries, part 59.
261. gbbct6.seq - Bacterial sequence entries, part 6.
262. gbbct60.seq - Bacterial sequence entries, part 60.
263. gbbct61.seq - Bacterial sequence entries, part 61.
264. gbbct62.seq - Bacterial sequence entries, part 62.
265. gbbct63.seq - Bacterial sequence entries, part 63.
266. gbbct64.seq - Bacterial sequence entries, part 64.
267. gbbct65.seq - Bacterial sequence entries, part 65.
268. gbbct66.seq - Bacterial sequence entries, part 66.
269. gbbct67.seq - Bacterial sequence entries, part 67.
270. gbbct68.seq - Bacterial sequence entries, part 68.
271. gbbct69.seq - Bacterial sequence entries, part 69.
272. gbbct7.seq - Bacterial sequence entries, part 7.
273. gbbct70.seq - Bacterial sequence entries, part 70.
274. gbbct71.seq - Bacterial sequence entries, part 71.
275. gbbct72.seq - Bacterial sequence entries, part 72.
276. gbbct73.seq - Bacterial sequence entries, part 73.
277. gbbct74.seq - Bacterial sequence entries, part 74.
278. gbbct75.seq - Bacterial sequence entries, part 75.
279. gbbct76.seq - Bacterial sequence entries, part 76.
280. gbbct77.seq - Bacterial sequence entries, part 77.
281. gbbct78.seq - Bacterial sequence entries, part 78.
282. gbbct79.seq - Bacterial sequence entries, part 79.
283. gbbct8.seq - Bacterial sequence entries, part 8.
284. gbbct80.seq - Bacterial sequence entries, part 80.
285. gbbct81.seq - Bacterial sequence entries, part 81.
286. gbbct82.seq - Bacterial sequence entries, part 82.
287. gbbct83.seq - Bacterial sequence entries, part 83.
288. gbbct84.seq - Bacterial sequence entries, part 84.
289. gbbct85.seq - Bacterial sequence entries, part 85.
290. gbbct86.seq - Bacterial sequence entries, part 86.
291. gbbct87.seq - Bacterial sequence entries, part 87.
292. gbbct88.seq - Bacterial sequence entries, part 88.
293. gbbct89.seq - Bacterial sequence entries, part 89.
294. gbbct9.seq - Bacterial sequence entries, part 9.
295. gbbct90.seq - Bacterial sequence entries, part 90.
296. gbbct91.seq - Bacterial sequence entries, part 91.
297. gbbct92.seq - Bacterial sequence entries, part 92.
298. gbbct93.seq - Bacterial sequence entries, part 93.
299. gbbct94.seq - Bacterial sequence entries, part 94.
300. gbbct95.seq - Bacterial sequence entries, part 95.
301. gbbct96.seq - Bacterial sequence entries, part 96.
302. gbbct97.seq - Bacterial sequence entries, part 97.
303. gbbct98.seq - Bacterial sequence entries, part 98.
304. gbbct99.seq - Bacterial sequence entries, part 99.
305. gbchg.txt - Accession numbers of entries updated since the previous release.
306. gbcon1.seq - Constructed sequence entries, part 1.
307. gbcon10.seq - Constructed sequence entries, part 10.
308. gbcon100.seq - Constructed sequence entries, part 100.
309. gbcon101.seq - Constructed sequence entries, part 101.
310. gbcon102.seq - Constructed sequence entries, part 102.
311. gbcon103.seq - Constructed sequence entries, part 103.
312. gbcon104.seq - Constructed sequence entries, part 104.
313. gbcon105.seq - Constructed sequence entries, part 105.
314. gbcon106.seq - Constructed sequence entries, part 106.
315. gbcon107.seq - Constructed sequence entries, part 107.
316. gbcon108.seq - Constructed sequence entries, part 108.
317. gbcon109.seq - Constructed sequence entries, part 109.
318. gbcon11.seq - Constructed sequence entries, part 11.
319. gbcon110.seq - Constructed sequence entries, part 110.
320. gbcon111.seq - Constructed sequence entries, part 111.
321. gbcon112.seq - Constructed sequence entries, part 112.
322. gbcon113.seq - Constructed sequence entries, part 113.
323. gbcon114.seq - Constructed sequence entries, part 114.
324. gbcon115.seq - Constructed sequence entries, part 115.
325. gbcon116.seq - Constructed sequence entries, part 116.
326. gbcon117.seq - Constructed sequence entries, part 117.
327. gbcon118.seq - Constructed sequence entries, part 118.
328. gbcon119.seq - Constructed sequence entries, part 119.
329. gbcon12.seq - Constructed sequence entries, part 12.
330. gbcon120.seq - Constructed sequence entries, part 120.
331. gbcon121.seq - Constructed sequence entries, part 121.
332. gbcon122.seq - Constructed sequence entries, part 122.
333. gbcon123.seq - Constructed sequence entries, part 123.
334. gbcon124.seq - Constructed sequence entries, part 124.
335. gbcon125.seq - Constructed sequence entries, part 125.
336. gbcon126.seq - Constructed sequence entries, part 126.
337. gbcon127.seq - Constructed sequence entries, part 127.
338. gbcon128.seq - Constructed sequence entries, part 128.
339. gbcon129.seq - Constructed sequence entries, part 129.
340. gbcon13.seq - Constructed sequence entries, part 13.
341. gbcon130.seq - Constructed sequence entries, part 130.
342. gbcon131.seq - Constructed sequence entries, part 131.
343. gbcon132.seq - Constructed sequence entries, part 132.
344. gbcon133.seq - Constructed sequence entries, part 133.
345. gbcon134.seq - Constructed sequence entries, part 134.
346. gbcon135.seq - Constructed sequence entries, part 135.
347. gbcon136.seq - Constructed sequence entries, part 136.
348. gbcon137.seq - Constructed sequence entries, part 137.
349. gbcon138.seq - Constructed sequence entries, part 138.
350. gbcon139.seq - Constructed sequence entries, part 139.
351. gbcon14.seq - Constructed sequence entries, part 14.
352. gbcon140.seq - Constructed sequence entries, part 140.
353. gbcon141.seq - Constructed sequence entries, part 141.
354. gbcon142.seq - Constructed sequence entries, part 142.
355. gbcon143.seq - Constructed sequence entries, part 143.
356. gbcon144.seq - Constructed sequence entries, part 144.
357. gbcon145.seq - Constructed sequence entries, part 145.
358. gbcon146.seq - Constructed sequence entries, part 146.
359. gbcon147.seq - Constructed sequence entries, part 147.
360. gbcon148.seq - Constructed sequence entries, part 148.
361. gbcon149.seq - Constructed sequence entries, part 149.
362. gbcon15.seq - Constructed sequence entries, part 15.
363. gbcon150.seq - Constructed sequence entries, part 150.
364. gbcon151.seq - Constructed sequence entries, part 151.
365. gbcon152.seq - Constructed sequence entries, part 152.
366. gbcon153.seq - Constructed sequence entries, part 153.
367. gbcon154.seq - Constructed sequence entries, part 154.
368. gbcon155.seq - Constructed sequence entries, part 155.
369. gbcon156.seq - Constructed sequence entries, part 156.
370. gbcon157.seq - Constructed sequence entries, part 157.
371. gbcon158.seq - Constructed sequence entries, part 158.
372. gbcon159.seq - Constructed sequence entries, part 159.
373. gbcon16.seq - Constructed sequence entries, part 16.
374. gbcon160.seq - Constructed sequence entries, part 160.
375. gbcon161.seq - Constructed sequence entries, part 161.
376. gbcon162.seq - Constructed sequence entries, part 162.
377. gbcon163.seq - Constructed sequence entries, part 163.
378. gbcon164.seq - Constructed sequence entries, part 164.
379. gbcon165.seq - Constructed sequence entries, part 165.
380. gbcon166.seq - Constructed sequence entries, part 166.
381. gbcon167.seq - Constructed sequence entries, part 167.
382. gbcon168.seq - Constructed sequence entries, part 168.
383. gbcon169.seq - Constructed sequence entries, part 169.
384. gbcon17.seq - Constructed sequence entries, part 17.
385. gbcon170.seq - Constructed sequence entries, part 170.
386. gbcon171.seq - Constructed sequence entries, part 171.
387. gbcon172.seq - Constructed sequence entries, part 172.
388. gbcon173.seq - Constructed sequence entries, part 173.
389. gbcon174.seq - Constructed sequence entries, part 174.
390. gbcon175.seq - Constructed sequence entries, part 175.
391. gbcon176.seq - Constructed sequence entries, part 176.
392. gbcon177.seq - Constructed sequence entries, part 177.
393. gbcon178.seq - Constructed sequence entries, part 178.
394. gbcon179.seq - Constructed sequence entries, part 179.
395. gbcon18.seq - Constructed sequence entries, part 18.
396. gbcon180.seq - Constructed sequence entries, part 180.
397. gbcon181.seq - Constructed sequence entries, part 181.
398. gbcon182.seq - Constructed sequence entries, part 182.
399. gbcon183.seq - Constructed sequence entries, part 183.
400. gbcon184.seq - Constructed sequence entries, part 184.
401. gbcon185.seq - Constructed sequence entries, part 185.
402. gbcon186.seq - Constructed sequence entries, part 186.
403. gbcon187.seq - Constructed sequence entries, part 187.
404. gbcon188.seq - Constructed sequence entries, part 188.
405. gbcon189.seq - Constructed sequence entries, part 189.
406. gbcon19.seq - Constructed sequence entries, part 19.
407. gbcon190.seq - Constructed sequence entries, part 190.
408. gbcon191.seq - Constructed sequence entries, part 191.
409. gbcon192.seq - Constructed sequence entries, part 192.
410. gbcon193.seq - Constructed sequence entries, part 193.
411. gbcon194.seq - Constructed sequence entries, part 194.
412. gbcon195.seq - Constructed sequence entries, part 195.
413. gbcon196.seq - Constructed sequence entries, part 196.
414. gbcon197.seq - Constructed sequence entries, part 197.
415. gbcon198.seq - Constructed sequence entries, part 198.
416. gbcon199.seq - Constructed sequence entries, part 199.
417. gbcon2.seq - Constructed sequence entries, part 2.
418. gbcon20.seq - Constructed sequence entries, part 20.
419. gbcon200.seq - Constructed sequence entries, part 200.
420. gbcon201.seq - Constructed sequence entries, part 201.
421. gbcon202.seq - Constructed sequence entries, part 202.
422. gbcon203.seq - Constructed sequence entries, part 203.
423. gbcon204.seq - Constructed sequence entries, part 204.
424. gbcon205.seq - Constructed sequence entries, part 205.
425. gbcon206.seq - Constructed sequence entries, part 206.
426. gbcon207.seq - Constructed sequence entries, part 207.
427. gbcon208.seq - Constructed sequence entries, part 208.
428. gbcon209.seq - Constructed sequence entries, part 209.
429. gbcon21.seq - Constructed sequence entries, part 21.
430. gbcon210.seq - Constructed sequence entries, part 210.
431. gbcon211.seq - Constructed sequence entries, part 211.
432. gbcon212.seq - Constructed sequence entries, part 212.
433. gbcon213.seq - Constructed sequence entries, part 213.
434. gbcon214.seq - Constructed sequence entries, part 214.
435. gbcon215.seq - Constructed sequence entries, part 215.
436. gbcon216.seq - Constructed sequence entries, part 216.
437. gbcon217.seq - Constructed sequence entries, part 217.
438. gbcon218.seq - Constructed sequence entries, part 218.
439. gbcon219.seq - Constructed sequence entries, part 219.
440. gbcon22.seq - Constructed sequence entries, part 22.
441. gbcon220.seq - Constructed sequence entries, part 220.
442. gbcon221.seq - Constructed sequence entries, part 221.
443. gbcon222.seq - Constructed sequence entries, part 222.
444. gbcon223.seq - Constructed sequence entries, part 223.
445. gbcon224.seq - Constructed sequence entries, part 224.
446. gbcon225.seq - Constructed sequence entries, part 225.
447. gbcon226.seq - Constructed sequence entries, part 226.
448. gbcon227.seq - Constructed sequence entries, part 227.
449. gbcon228.seq - Constructed sequence entries, part 228.
450. gbcon229.seq - Constructed sequence entries, part 229.
451. gbcon23.seq - Constructed sequence entries, part 23.
452. gbcon230.seq - Constructed sequence entries, part 230.
453. gbcon231.seq - Constructed sequence entries, part 231.
454. gbcon232.seq - Constructed sequence entries, part 232.
455. gbcon233.seq - Constructed sequence entries, part 233.
456. gbcon234.seq - Constructed sequence entries, part 234.
457. gbcon235.seq - Constructed sequence entries, part 235.
458. gbcon236.seq - Constructed sequence entries, part 236.
459. gbcon237.seq - Constructed sequence entries, part 237.
460. gbcon238.seq - Constructed sequence entries, part 238.
461. gbcon239.seq - Constructed sequence entries, part 239.
462. gbcon24.seq - Constructed sequence entries, part 24.
463. gbcon240.seq - Constructed sequence entries, part 240.
464. gbcon241.seq - Constructed sequence entries, part 241.
465. gbcon242.seq - Constructed sequence entries, part 242.
466. gbcon243.seq - Constructed sequence entries, part 243.
467. gbcon244.seq - Constructed sequence entries, part 244.
468. gbcon245.seq - Constructed sequence entries, part 245.
469. gbcon246.seq - Constructed sequence entries, part 246.
470. gbcon247.seq - Constructed sequence entries, part 247.
471. gbcon248.seq - Constructed sequence entries, part 248.
472. gbcon249.seq - Constructed sequence entries, part 249.
473. gbcon25.seq - Constructed sequence entries, part 25.
474. gbcon250.seq - Constructed sequence entries, part 250.
475. gbcon251.seq - Constructed sequence entries, part 251.
476. gbcon252.seq - Constructed sequence entries, part 252.
477. gbcon253.seq - Constructed sequence entries, part 253.
478. gbcon254.seq - Constructed sequence entries, part 254.
479. gbcon255.seq - Constructed sequence entries, part 255.
480. gbcon256.seq - Constructed sequence entries, part 256.
481. gbcon257.seq - Constructed sequence entries, part 257.
482. gbcon258.seq - Constructed sequence entries, part 258.
483. gbcon259.seq - Constructed sequence entries, part 259.
484. gbcon26.seq - Constructed sequence entries, part 26.
485. gbcon260.seq - Constructed sequence entries, part 260.
486. gbcon261.seq - Constructed sequence entries, part 261.
487. gbcon262.seq - Constructed sequence entries, part 262.
488. gbcon263.seq - Constructed sequence entries, part 263.
489. gbcon264.seq - Constructed sequence entries, part 264.
490. gbcon265.seq - Constructed sequence entries, part 265.
491. gbcon266.seq - Constructed sequence entries, part 266.
492. gbcon267.seq - Constructed sequence entries, part 267.
493. gbcon268.seq - Constructed sequence entries, part 268.
494. gbcon269.seq - Constructed sequence entries, part 269.
495. gbcon27.seq - Constructed sequence entries, part 27.
496. gbcon270.seq - Constructed sequence entries, part 270.
497. gbcon271.seq - Constructed sequence entries, part 271.
498. gbcon272.seq - Constructed sequence entries, part 272.
499. gbcon273.seq - Constructed sequence entries, part 273.
500. gbcon274.seq - Constructed sequence entries, part 274.
501. gbcon275.seq - Constructed sequence entries, part 275.
502. gbcon276.seq - Constructed sequence entries, part 276.
503. gbcon277.seq - Constructed sequence entries, part 277.
504. gbcon278.seq - Constructed sequence entries, part 278.
505. gbcon279.seq - Constructed sequence entries, part 279.
506. gbcon28.seq - Constructed sequence entries, part 28.
507. gbcon280.seq - Constructed sequence entries, part 280.
508. gbcon281.seq - Constructed sequence entries, part 281.
509. gbcon282.seq - Constructed sequence entries, part 282.
510. gbcon283.seq - Constructed sequence entries, part 283.
511. gbcon284.seq - Constructed sequence entries, part 284.
512. gbcon285.seq - Constructed sequence entries, part 285.
513. gbcon286.seq - Constructed sequence entries, part 286.
514. gbcon287.seq - Constructed sequence entries, part 287.
515. gbcon288.seq - Constructed sequence entries, part 288.
516. gbcon289.seq - Constructed sequence entries, part 289.
517. gbcon29.seq - Constructed sequence entries, part 29.
518. gbcon290.seq - Constructed sequence entries, part 290.
519. gbcon291.seq - Constructed sequence entries, part 291.
520. gbcon292.seq - Constructed sequence entries, part 292.
521. gbcon293.seq - Constructed sequence entries, part 293.
522. gbcon294.seq - Constructed sequence entries, part 294.
523. gbcon295.seq - Constructed sequence entries, part 295.
524. gbcon296.seq - Constructed sequence entries, part 296.
525. gbcon297.seq - Constructed sequence entries, part 297.
526. gbcon298.seq - Constructed sequence entries, part 298.
527. gbcon299.seq - Constructed sequence entries, part 299.
528. gbcon3.seq - Constructed sequence entries, part 3.
529. gbcon30.seq - Constructed sequence entries, part 30.
530. gbcon300.seq - Constructed sequence entries, part 300.
531. gbcon301.seq - Constructed sequence entries, part 301.
532. gbcon302.seq - Constructed sequence entries, part 302.
533. gbcon303.seq - Constructed sequence entries, part 303.
534. gbcon304.seq - Constructed sequence entries, part 304.
535. gbcon305.seq - Constructed sequence entries, part 305.
536. gbcon306.seq - Constructed sequence entries, part 306.
537. gbcon307.seq - Constructed sequence entries, part 307.
538. gbcon308.seq - Constructed sequence entries, part 308.
539. gbcon309.seq - Constructed sequence entries, part 309.
540. gbcon31.seq - Constructed sequence entries, part 31.
541. gbcon310.seq - Constructed sequence entries, part 310.
542. gbcon311.seq - Constructed sequence entries, part 311.
543. gbcon312.seq - Constructed sequence entries, part 312.
544. gbcon313.seq - Constructed sequence entries, part 313.
545. gbcon314.seq - Constructed sequence entries, part 314.
546. gbcon315.seq - Constructed sequence entries, part 315.
547. gbcon316.seq - Constructed sequence entries, part 316.
548. gbcon317.seq - Constructed sequence entries, part 317.
549. gbcon318.seq - Constructed sequence entries, part 318.
550. gbcon319.seq - Constructed sequence entries, part 319.
551. gbcon32.seq - Constructed sequence entries, part 32.
552. gbcon320.seq - Constructed sequence entries, part 320.
553. gbcon321.seq - Constructed sequence entries, part 321.
554. gbcon322.seq - Constructed sequence entries, part 322.
555. gbcon323.seq - Constructed sequence entries, part 323.
556. gbcon324.seq - Constructed sequence entries, part 324.
557. gbcon325.seq - Constructed sequence entries, part 325.
558. gbcon326.seq - Constructed sequence entries, part 326.
559. gbcon327.seq - Constructed sequence entries, part 327.
560. gbcon328.seq - Constructed sequence entries, part 328.
561. gbcon329.seq - Constructed sequence entries, part 329.
562. gbcon33.seq - Constructed sequence entries, part 33.
563. gbcon330.seq - Constructed sequence entries, part 330.
564. gbcon331.seq - Constructed sequence entries, part 331.
565. gbcon332.seq - Constructed sequence entries, part 332.
566. gbcon333.seq - Constructed sequence entries, part 333.
567. gbcon334.seq - Constructed sequence entries, part 334.
568. gbcon335.seq - Constructed sequence entries, part 335.
569. gbcon336.seq - Constructed sequence entries, part 336.
570. gbcon337.seq - Constructed sequence entries, part 337.
571. gbcon338.seq - Constructed sequence entries, part 338.
572. gbcon339.seq - Constructed sequence entries, part 339.
573. gbcon34.seq - Constructed sequence entries, part 34.
574. gbcon340.seq - Constructed sequence entries, part 340.
575. gbcon341.seq - Constructed sequence entries, part 341.
576. gbcon342.seq - Constructed sequence entries, part 342.
577. gbcon343.seq - Constructed sequence entries, part 343.
578. gbcon344.seq - Constructed sequence entries, part 344.
579. gbcon345.seq - Constructed sequence entries, part 345.
580. gbcon346.seq - Constructed sequence entries, part 346.
581. gbcon347.seq - Constructed sequence entries, part 347.
582. gbcon348.seq - Constructed sequence entries, part 348.
583. gbcon349.seq - Constructed sequence entries, part 349.
584. gbcon35.seq - Constructed sequence entries, part 35.
585. gbcon350.seq - Constructed sequence entries, part 350.
586. gbcon351.seq - Constructed sequence entries, part 351.
587. gbcon352.seq - Constructed sequence entries, part 352.
588. gbcon353.seq - Constructed sequence entries, part 353.
589. gbcon354.seq - Constructed sequence entries, part 354.
590. gbcon355.seq - Constructed sequence entries, part 355.
591. gbcon356.seq - Constructed sequence entries, part 356.
592. gbcon357.seq - Constructed sequence entries, part 357.
593. gbcon36.seq - Constructed sequence entries, part 36.
594. gbcon37.seq - Constructed sequence entries, part 37.
595. gbcon38.seq - Constructed sequence entries, part 38.
596. gbcon39.seq - Constructed sequence entries, part 39.
597. gbcon4.seq - Constructed sequence entries, part 4.
598. gbcon40.seq - Constructed sequence entries, part 40.
599. gbcon41.seq - Constructed sequence entries, part 41.
600. gbcon42.seq - Constructed sequence entries, part 42.
601. gbcon43.seq - Constructed sequence entries, part 43.
602. gbcon44.seq - Constructed sequence entries, part 44.
603. gbcon45.seq - Constructed sequence entries, part 45.
604. gbcon46.seq - Constructed sequence entries, part 46.
605. gbcon47.seq - Constructed sequence entries, part 47.
606. gbcon48.seq - Constructed sequence entries, part 48.
607. gbcon49.seq - Constructed sequence entries, part 49.
608. gbcon5.seq - Constructed sequence entries, part 5.
609. gbcon50.seq - Constructed sequence entries, part 50.
610. gbcon51.seq - Constructed sequence entries, part 51.
611. gbcon52.seq - Constructed sequence entries, part 52.
612. gbcon53.seq - Constructed sequence entries, part 53.
613. gbcon54.seq - Constructed sequence entries, part 54.
614. gbcon55.seq - Constructed sequence entries, part 55.
615. gbcon56.seq - Constructed sequence entries, part 56.
616. gbcon57.seq - Constructed sequence entries, part 57.
617. gbcon58.seq - Constructed sequence entries, part 58.
618. gbcon59.seq - Constructed sequence entries, part 59.
619. gbcon6.seq - Constructed sequence entries, part 6.
620. gbcon60.seq - Constructed sequence entries, part 60.
621. gbcon61.seq - Constructed sequence entries, part 61.
622. gbcon62.seq - Constructed sequence entries, part 62.
623. gbcon63.seq - Constructed sequence entries, part 63.
624. gbcon64.seq - Constructed sequence entries, part 64.
625. gbcon65.seq - Constructed sequence entries, part 65.
626. gbcon66.seq - Constructed sequence entries, part 66.
627. gbcon67.seq - Constructed sequence entries, part 67.
628. gbcon68.seq - Constructed sequence entries, part 68.
629. gbcon69.seq - Constructed sequence entries, part 69.
630. gbcon7.seq - Constructed sequence entries, part 7.
631. gbcon70.seq - Constructed sequence entries, part 70.
632. gbcon71.seq - Constructed sequence entries, part 71.
633. gbcon72.seq - Constructed sequence entries, part 72.
634. gbcon73.seq - Constructed sequence entries, part 73.
635. gbcon74.seq - Constructed sequence entries, part 74.
636. gbcon75.seq - Constructed sequence entries, part 75.
637. gbcon76.seq - Constructed sequence entries, part 76.
638. gbcon77.seq - Constructed sequence entries, part 77.
639. gbcon78.seq - Constructed sequence entries, part 78.
640. gbcon79.seq - Constructed sequence entries, part 79.
641. gbcon8.seq - Constructed sequence entries, part 8.
642. gbcon80.seq - Constructed sequence entries, part 80.
643. gbcon81.seq - Constructed sequence entries, part 81.
644. gbcon82.seq - Constructed sequence entries, part 82.
645. gbcon83.seq - Constructed sequence entries, part 83.
646. gbcon84.seq - Constructed sequence entries, part 84.
647. gbcon85.seq - Constructed sequence entries, part 85.
648. gbcon86.seq - Constructed sequence entries, part 86.
649. gbcon87.seq - Constructed sequence entries, part 87.
650. gbcon88.seq - Constructed sequence entries, part 88.
651. gbcon89.seq - Constructed sequence entries, part 89.
652. gbcon9.seq - Constructed sequence entries, part 9.
653. gbcon90.seq - Constructed sequence entries, part 90.
654. gbcon91.seq - Constructed sequence entries, part 91.
655. gbcon92.seq - Constructed sequence entries, part 92.
656. gbcon93.seq - Constructed sequence entries, part 93.
657. gbcon94.seq - Constructed sequence entries, part 94.
658. gbcon95.seq - Constructed sequence entries, part 95.
659. gbcon96.seq - Constructed sequence entries, part 96.
660. gbcon97.seq - Constructed sequence entries, part 97.
661. gbcon98.seq - Constructed sequence entries, part 98.
662. gbcon99.seq - Constructed sequence entries, part 99.
663. gbdel.txt - Accession numbers of entries deleted since the previous release.
664. gbenv1.seq - Environmental sampling sequence entries, part 1.
665. gbenv10.seq - Environmental sampling sequence entries, part 10.
666. gbenv11.seq - Environmental sampling sequence entries, part 11.
667. gbenv12.seq - Environmental sampling sequence entries, part 12.
668. gbenv13.seq - Environmental sampling sequence entries, part 13.
669. gbenv14.seq - Environmental sampling sequence entries, part 14.
670. gbenv15.seq - Environmental sampling sequence entries, part 15.
671. gbenv16.seq - Environmental sampling sequence entries, part 16.
672. gbenv17.seq - Environmental sampling sequence entries, part 17.
673. gbenv18.seq - Environmental sampling sequence entries, part 18.
674. gbenv19.seq - Environmental sampling sequence entries, part 19.
675. gbenv2.seq - Environmental sampling sequence entries, part 2.
676. gbenv20.seq - Environmental sampling sequence entries, part 20.
677. gbenv21.seq - Environmental sampling sequence entries, part 21.
678. gbenv22.seq - Environmental sampling sequence entries, part 22.
679. gbenv23.seq - Environmental sampling sequence entries, part 23.
680. gbenv24.seq - Environmental sampling sequence entries, part 24.
681. gbenv25.seq - Environmental sampling sequence entries, part 25.
682. gbenv26.seq - Environmental sampling sequence entries, part 26.
683. gbenv27.seq - Environmental sampling sequence entries, part 27.
684. gbenv28.seq - Environmental sampling sequence entries, part 28.
685. gbenv29.seq - Environmental sampling sequence entries, part 29.
686. gbenv3.seq - Environmental sampling sequence entries, part 3.
687. gbenv30.seq - Environmental sampling sequence entries, part 30.
688. gbenv31.seq - Environmental sampling sequence entries, part 31.
689. gbenv32.seq - Environmental sampling sequence entries, part 32.
690. gbenv33.seq - Environmental sampling sequence entries, part 33.
691. gbenv34.seq - Environmental sampling sequence entries, part 34.
692. gbenv35.seq - Environmental sampling sequence entries, part 35.
693. gbenv36.seq - Environmental sampling sequence entries, part 36.
694. gbenv37.seq - Environmental sampling sequence entries, part 37.
695. gbenv38.seq - Environmental sampling sequence entries, part 38.
696. gbenv39.seq - Environmental sampling sequence entries, part 39.
697. gbenv4.seq - Environmental sampling sequence entries, part 4.
698. gbenv40.seq - Environmental sampling sequence entries, part 40.
699. gbenv41.seq - Environmental sampling sequence entries, part 41.
700. gbenv42.seq - Environmental sampling sequence entries, part 42.
701. gbenv43.seq - Environmental sampling sequence entries, part 43.
702. gbenv44.seq - Environmental sampling sequence entries, part 44.
703. gbenv45.seq - Environmental sampling sequence entries, part 45.
704. gbenv46.seq - Environmental sampling sequence entries, part 46.
705. gbenv47.seq - Environmental sampling sequence entries, part 47.
706. gbenv48.seq - Environmental sampling sequence entries, part 48.
707. gbenv49.seq - Environmental sampling sequence entries, part 49.
708. gbenv5.seq - Environmental sampling sequence entries, part 5.
709. gbenv50.seq - Environmental sampling sequence entries, part 50.
710. gbenv51.seq - Environmental sampling sequence entries, part 51.
711. gbenv52.seq - Environmental sampling sequence entries, part 52.
712. gbenv53.seq - Environmental sampling sequence entries, part 53.
713. gbenv54.seq - Environmental sampling sequence entries, part 54.
714. gbenv55.seq - Environmental sampling sequence entries, part 55.
715. gbenv56.seq - Environmental sampling sequence entries, part 56.
716. gbenv57.seq - Environmental sampling sequence entries, part 57.
717. gbenv58.seq - Environmental sampling sequence entries, part 58.
718. gbenv59.seq - Environmental sampling sequence entries, part 59.
719. gbenv6.seq - Environmental sampling sequence entries, part 6.
720. gbenv60.seq - Environmental sampling sequence entries, part 60.
721. gbenv61.seq - Environmental sampling sequence entries, part 61.
722. gbenv62.seq - Environmental sampling sequence entries, part 62.
723. gbenv63.seq - Environmental sampling sequence entries, part 63.
724. gbenv64.seq - Environmental sampling sequence entries, part 64.
725. gbenv65.seq - Environmental sampling sequence entries, part 65.
726. gbenv66.seq - Environmental sampling sequence entries, part 66.
727. gbenv67.seq - Environmental sampling sequence entries, part 67.
728. gbenv68.seq - Environmental sampling sequence entries, part 68.
729. gbenv69.seq - Environmental sampling sequence entries, part 69.
730. gbenv7.seq - Environmental sampling sequence entries, part 7.
731. gbenv70.seq - Environmental sampling sequence entries, part 70.
732. gbenv71.seq - Environmental sampling sequence entries, part 71.
733. gbenv72.seq - Environmental sampling sequence entries, part 72.
734. gbenv73.seq - Environmental sampling sequence entries, part 73.
735. gbenv74.seq - Environmental sampling sequence entries, part 74.
736. gbenv75.seq - Environmental sampling sequence entries, part 75.
737. gbenv76.seq - Environmental sampling sequence entries, part 76.
738. gbenv77.seq - Environmental sampling sequence entries, part 77.
739. gbenv78.seq - Environmental sampling sequence entries, part 78.
740. gbenv79.seq - Environmental sampling sequence entries, part 79.
741. gbenv8.seq - Environmental sampling sequence entries, part 8.
742. gbenv80.seq - Environmental sampling sequence entries, part 80.
743. gbenv81.seq - Environmental sampling sequence entries, part 81.
744. gbenv82.seq - Environmental sampling sequence entries, part 82.
745. gbenv83.seq - Environmental sampling sequence entries, part 83.
746. gbenv84.seq - Environmental sampling sequence entries, part 84.
747. gbenv85.seq - Environmental sampling sequence entries, part 85.
748. gbenv86.seq - Environmental sampling sequence entries, part 86.
749. gbenv87.seq - Environmental sampling sequence entries, part 87.
750. gbenv88.seq - Environmental sampling sequence entries, part 88.
751. gbenv89.seq - Environmental sampling sequence entries, part 89.
752. gbenv9.seq - Environmental sampling sequence entries, part 9.
753. gbenv90.seq - Environmental sampling sequence entries, part 90.
754. gbenv91.seq - Environmental sampling sequence entries, part 91.
755. gbenv92.seq - Environmental sampling sequence entries, part 92.
756. gbenv93.seq - Environmental sampling sequence entries, part 93.
757. gbenv94.seq - Environmental sampling sequence entries, part 94.
758. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
759. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
760. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
761. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
762. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
763. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
764. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
765. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
766. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
767. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
768. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
769. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
770. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
771. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
772. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
773. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
774. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
775. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
776. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
777. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
778. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
779. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
780. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
781. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
782. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
783. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
784. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
785. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
786. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
787. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
788. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
789. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
790. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
791. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
792. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
793. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
794. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
795. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
796. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
797. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
798. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
799. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
800. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
801. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
802. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
803. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
804. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
805. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
806. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
807. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
808. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
809. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
810. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
811. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
812. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
813. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
814. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
815. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
816. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
817. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
818. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
819. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
820. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
821. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
822. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
823. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
824. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
825. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
826. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
827. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
828. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
829. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
830. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
831. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
832. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
833. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
834. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
835. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
836. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
837. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
838. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
839. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
840. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
841. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
842. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
843. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
844. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
845. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
846. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
847. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
848. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
849. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
850. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
851. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
852. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
853. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
854. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
855. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
856. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
857. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
858. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
859. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
860. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
861. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
862. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
863. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
864. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
865. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
866. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
867. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
868. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
869. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
870. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
871. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
872. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
873. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
874. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
875. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
876. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
877. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
878. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
879. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
880. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
881. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
882. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
883. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
884. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
885. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
886. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
887. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
888. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
889. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
890. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
891. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
892. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
893. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
894. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
895. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
896. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
897. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
898. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
899. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
900. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
901. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
902. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
903. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
904. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
905. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
906. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
907. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
908. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
909. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
910. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
911. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
912. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
913. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
914. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
915. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
916. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
917. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
918. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
919. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
920. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
921. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
922. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
923. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
924. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
925. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
926. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
927. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
928. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
929. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
930. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
931. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
932. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
933. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
934. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
935. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
936. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
937. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
938. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
939. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
940. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
941. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
942. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
943. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
944. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
945. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
946. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
947. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
948. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
949. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
950. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
951. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
952. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
953. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
954. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
955. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
956. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
957. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
958. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
959. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
960. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
961. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
962. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
963. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
964. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
965. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
966. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
967. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
968. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
969. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
970. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
971. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
972. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
973. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
974. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
975. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
976. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
977. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
978. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
979. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
980. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
981. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
982. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
983. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
984. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
985. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
986. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
987. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
988. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
989. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
990. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
991. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
992. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
993. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
994. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
995. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
996. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
997. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
998. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
999. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1000. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1001. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1002. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1003. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1004. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1005. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1006. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1007. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1008. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1009. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1010. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1011. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1012. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1013. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1014. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1015. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1016. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1017. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1018. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1019. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1020. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1021. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1022. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1023. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1024. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1025. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1026. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1027. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1028. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1029. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1030. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1031. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1032. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1033. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1034. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1035. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1036. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1037. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1038. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1039. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1040. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1041. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1042. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1043. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1044. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1045. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1046. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1047. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1048. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1049. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1050. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1051. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1052. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1053. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1054. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1055. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1056. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1057. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1058. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1059. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1060. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1061. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1062. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1063. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1064. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1065. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1066. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1067. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1068. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1069. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1070. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1071. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1072. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1073. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1074. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1075. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1076. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1077. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1078. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1079. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1080. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1081. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1082. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1083. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1084. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1085. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1086. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1087. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1088. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1089. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1090. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1091. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1092. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1093. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1094. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1095. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1096. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1097. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1098. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1099. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1100. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1101. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1102. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1103. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1104. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1105. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1106. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1107. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1108. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1109. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1110. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1111. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1112. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1113. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1114. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1115. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1116. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1117. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1118. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1119. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1120. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1121. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1122. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1123. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1124. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1125. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1126. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1127. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1128. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1129. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1130. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1131. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1132. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1133. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1134. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1135. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1136. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1137. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1138. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1139. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1140. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1141. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1142. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1143. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1144. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1145. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1146. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1147. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1148. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1149. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1150. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1151. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1152. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1153. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1154. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1155. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1156. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1157. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1158. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1159. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1160. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1161. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1162. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1163. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1164. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1165. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1166. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1167. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1168. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1169. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1170. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1171. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1172. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1173. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1174. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1175. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1176. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1177. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1178. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1179. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1180. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1181. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1182. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1183. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1184. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1185. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1186. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1187. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1188. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1189. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1190. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1191. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1192. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1193. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1194. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1195. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1196. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1197. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1198. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1199. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1200. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1201. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1202. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1203. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1204. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1205. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1206. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1207. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1208. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1209. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1210. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1211. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1212. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1213. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1214. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1215. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1216. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1217. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1218. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1219. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1220. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1221. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1222. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1223. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1224. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1225. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1226. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1227. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1228. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1229. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1230. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1231. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1232. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1233. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1234. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1235. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1236. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1237. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1238. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1239. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1240. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1241. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1242. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1243. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1244. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1245. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1246. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1247. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1248. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1249. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1250. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1251. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1252. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1253. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1254. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1255. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1256. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1257. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1258. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1259. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1260. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1261. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1262. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1263. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1264. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1265. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1266. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1267. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1268. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1269. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1270. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1271. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1272. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1273. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1274. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1275. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1276. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1277. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1278. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1279. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1280. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1281. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1282. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1283. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1284. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1285. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1286. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1287. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1288. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1289. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1290. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1291. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1292. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1293. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1294. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1295. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1296. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1297. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1298. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1299. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1300. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1301. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1302. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1303. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1304. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1305. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1306. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1307. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1308. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1309. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1310. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1311. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1312. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1313. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1314. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1315. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1316. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1317. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1318. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1319. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1320. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1321. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1322. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1323. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1324. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1325. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1326. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1327. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1328. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1329. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1330. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1331. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1332. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1333. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1334. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1335. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1336. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1337. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1338. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1339. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1340. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1341. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1342. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1343. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1344. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1345. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1346. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1347. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1348. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1349. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1350. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1351. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1352. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1353. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1354. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1355. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1356. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1357. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1358. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1359. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1360. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1361. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1362. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1363. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1364. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1365. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1366. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1367. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1368. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1369. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1370. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1371. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1372. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1373. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1374. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1375. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1376. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1377. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1378. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1379. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1380. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1381. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1382. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1383. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1384. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1385. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1386. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1387. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1388. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1389. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1390. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1391. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1392. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1393. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1394. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1395. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1396. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1397. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1398. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1399. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1400. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1401. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1402. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1403. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1404. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1405. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1406. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1407. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1408. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1409. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1410. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1411. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1412. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1413. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1414. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1415. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1416. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1417. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1418. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1419. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1420. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1421. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1422. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1423. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1424. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1425. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1426. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1427. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1428. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1429. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1430. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1431. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1432. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1433. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1434. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1435. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1436. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1437. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1438. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1439. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1440. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1441. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1442. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1443. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1444. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1445. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1446. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1447. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1448. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1449. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1450. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1451. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1452. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1453. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1454. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1455. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1456. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1457. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1458. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1459. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1460. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1461. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1462. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1463. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1464. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1465. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1466. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1467. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1468. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1469. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1470. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1471. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1472. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1473. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1474. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1475. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1476. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1477. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1478. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1479. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1480. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1481. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1482. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1483. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1484. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1485. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1486. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1487. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1488. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1489. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1490. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1491. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1492. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1493. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1494. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1495. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1496. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1497. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1498. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1499. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1500. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1501. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1502. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1503. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1504. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1505. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1506. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1507. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1508. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1509. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1510. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1511. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1512. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1513. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1514. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1515. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1516. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1517. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1518. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1519. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1520. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1521. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1522. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1523. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1524. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1525. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1526. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1527. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1528. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1529. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1530. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1531. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1532. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1533. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1534. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1535. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1536. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1537. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1538. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1539. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1540. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1541. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1542. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1543. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1544. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1545. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1546. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1547. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1548. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1549. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1550. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1551. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1552. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1553. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1554. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1555. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1556. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1557. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1558. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1559. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1560. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1561. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1562. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1563. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1564. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1565. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1566. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1567. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1568. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1569. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1570. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1571. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1572. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1573. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1574. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1575. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1576. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1577. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1578. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1579. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1580. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1581. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1582. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1583. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1584. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1585. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1586. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1587. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1588. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1589. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1590. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1591. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1592. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1593. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1594. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1595. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1596. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1597. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1598. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1599. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1600. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1601. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1602. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1603. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1604. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1605. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1606. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1607. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1608. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1609. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1610. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1611. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1612. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1613. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1614. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1615. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1616. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1617. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1618. gbhtg154.seq - HTGS (high throughput genomic sequencing) sequence entries, part 154.
1619. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1620. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1621. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1622. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1623. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1624. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1625. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1626. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1627. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1628. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1629. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1630. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1631. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1632. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1633. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1634. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1635. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1636. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1637. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1638. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1639. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1640. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1641. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1642. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1643. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1644. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1645. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1646. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1647. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1648. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1649. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1650. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1651. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1652. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1653. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1654. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1655. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1656. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1657. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1658. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1659. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1660. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1661. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1662. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1663. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1664. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1665. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1666. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1667. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1668. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1669. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1670. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1671. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1672. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1673. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1674. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1675. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1676. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1677. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1678. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1679. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1680. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1681. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1682. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1683. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1684. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1685. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1686. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1687. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1688. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1689. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1690. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1691. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1692. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1693. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1694. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1695. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1696. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1697. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1698. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1699. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1700. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1701. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1702. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1703. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1704. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1705. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1706. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1707. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1708. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1709. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1710. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1711. gbinv1.seq - Invertebrate sequence entries, part 1.
1712. gbinv10.seq - Invertebrate sequence entries, part 10.
1713. gbinv100.seq - Invertebrate sequence entries, part 100.
1714. gbinv101.seq - Invertebrate sequence entries, part 101.
1715. gbinv102.seq - Invertebrate sequence entries, part 102.
1716. gbinv103.seq - Invertebrate sequence entries, part 103.
1717. gbinv104.seq - Invertebrate sequence entries, part 104.
1718. gbinv105.seq - Invertebrate sequence entries, part 105.
1719. gbinv106.seq - Invertebrate sequence entries, part 106.
1720. gbinv107.seq - Invertebrate sequence entries, part 107.
1721. gbinv108.seq - Invertebrate sequence entries, part 108.
1722. gbinv109.seq - Invertebrate sequence entries, part 109.
1723. gbinv11.seq - Invertebrate sequence entries, part 11.
1724. gbinv110.seq - Invertebrate sequence entries, part 110.
1725. gbinv111.seq - Invertebrate sequence entries, part 111.
1726. gbinv112.seq - Invertebrate sequence entries, part 112.
1727. gbinv113.seq - Invertebrate sequence entries, part 113.
1728. gbinv114.seq - Invertebrate sequence entries, part 114.
1729. gbinv115.seq - Invertebrate sequence entries, part 115.
1730. gbinv116.seq - Invertebrate sequence entries, part 116.
1731. gbinv117.seq - Invertebrate sequence entries, part 117.
1732. gbinv118.seq - Invertebrate sequence entries, part 118.
1733. gbinv119.seq - Invertebrate sequence entries, part 119.
1734. gbinv12.seq - Invertebrate sequence entries, part 12.
1735. gbinv120.seq - Invertebrate sequence entries, part 120.
1736. gbinv121.seq - Invertebrate sequence entries, part 121.
1737. gbinv122.seq - Invertebrate sequence entries, part 122.
1738. gbinv123.seq - Invertebrate sequence entries, part 123.
1739. gbinv124.seq - Invertebrate sequence entries, part 124.
1740. gbinv125.seq - Invertebrate sequence entries, part 125.
1741. gbinv126.seq - Invertebrate sequence entries, part 126.
1742. gbinv127.seq - Invertebrate sequence entries, part 127.
1743. gbinv128.seq - Invertebrate sequence entries, part 128.
1744. gbinv129.seq - Invertebrate sequence entries, part 129.
1745. gbinv13.seq - Invertebrate sequence entries, part 13.
1746. gbinv130.seq - Invertebrate sequence entries, part 130.
1747. gbinv131.seq - Invertebrate sequence entries, part 131.
1748. gbinv132.seq - Invertebrate sequence entries, part 132.
1749. gbinv133.seq - Invertebrate sequence entries, part 133.
1750. gbinv134.seq - Invertebrate sequence entries, part 134.
1751. gbinv135.seq - Invertebrate sequence entries, part 135.
1752. gbinv136.seq - Invertebrate sequence entries, part 136.
1753. gbinv137.seq - Invertebrate sequence entries, part 137.
1754. gbinv138.seq - Invertebrate sequence entries, part 138.
1755. gbinv139.seq - Invertebrate sequence entries, part 139.
1756. gbinv14.seq - Invertebrate sequence entries, part 14.
1757. gbinv140.seq - Invertebrate sequence entries, part 140.
1758. gbinv141.seq - Invertebrate sequence entries, part 141.
1759. gbinv142.seq - Invertebrate sequence entries, part 142.
1760. gbinv143.seq - Invertebrate sequence entries, part 143.
1761. gbinv144.seq - Invertebrate sequence entries, part 144.
1762. gbinv145.seq - Invertebrate sequence entries, part 145.
1763. gbinv146.seq - Invertebrate sequence entries, part 146.
1764. gbinv147.seq - Invertebrate sequence entries, part 147.
1765. gbinv148.seq - Invertebrate sequence entries, part 148.
1766. gbinv149.seq - Invertebrate sequence entries, part 149.
1767. gbinv15.seq - Invertebrate sequence entries, part 15.
1768. gbinv150.seq - Invertebrate sequence entries, part 150.
1769. gbinv151.seq - Invertebrate sequence entries, part 151.
1770. gbinv16.seq - Invertebrate sequence entries, part 16.
1771. gbinv17.seq - Invertebrate sequence entries, part 17.
1772. gbinv18.seq - Invertebrate sequence entries, part 18.
1773. gbinv19.seq - Invertebrate sequence entries, part 19.
1774. gbinv2.seq - Invertebrate sequence entries, part 2.
1775. gbinv20.seq - Invertebrate sequence entries, part 20.
1776. gbinv21.seq - Invertebrate sequence entries, part 21.
1777. gbinv22.seq - Invertebrate sequence entries, part 22.
1778. gbinv23.seq - Invertebrate sequence entries, part 23.
1779. gbinv24.seq - Invertebrate sequence entries, part 24.
1780. gbinv25.seq - Invertebrate sequence entries, part 25.
1781. gbinv26.seq - Invertebrate sequence entries, part 26.
1782. gbinv27.seq - Invertebrate sequence entries, part 27.
1783. gbinv28.seq - Invertebrate sequence entries, part 28.
1784. gbinv29.seq - Invertebrate sequence entries, part 29.
1785. gbinv3.seq - Invertebrate sequence entries, part 3.
1786. gbinv30.seq - Invertebrate sequence entries, part 30.
1787. gbinv31.seq - Invertebrate sequence entries, part 31.
1788. gbinv32.seq - Invertebrate sequence entries, part 32.
1789. gbinv33.seq - Invertebrate sequence entries, part 33.
1790. gbinv34.seq - Invertebrate sequence entries, part 34.
1791. gbinv35.seq - Invertebrate sequence entries, part 35.
1792. gbinv36.seq - Invertebrate sequence entries, part 36.
1793. gbinv37.seq - Invertebrate sequence entries, part 37.
1794. gbinv38.seq - Invertebrate sequence entries, part 38.
1795. gbinv39.seq - Invertebrate sequence entries, part 39.
1796. gbinv4.seq - Invertebrate sequence entries, part 4.
1797. gbinv40.seq - Invertebrate sequence entries, part 40.
1798. gbinv41.seq - Invertebrate sequence entries, part 41.
1799. gbinv42.seq - Invertebrate sequence entries, part 42.
1800. gbinv43.seq - Invertebrate sequence entries, part 43.
1801. gbinv44.seq - Invertebrate sequence entries, part 44.
1802. gbinv45.seq - Invertebrate sequence entries, part 45.
1803. gbinv46.seq - Invertebrate sequence entries, part 46.
1804. gbinv47.seq - Invertebrate sequence entries, part 47.
1805. gbinv48.seq - Invertebrate sequence entries, part 48.
1806. gbinv49.seq - Invertebrate sequence entries, part 49.
1807. gbinv5.seq - Invertebrate sequence entries, part 5.
1808. gbinv50.seq - Invertebrate sequence entries, part 50.
1809. gbinv51.seq - Invertebrate sequence entries, part 51.
1810. gbinv52.seq - Invertebrate sequence entries, part 52.
1811. gbinv53.seq - Invertebrate sequence entries, part 53.
1812. gbinv54.seq - Invertebrate sequence entries, part 54.
1813. gbinv55.seq - Invertebrate sequence entries, part 55.
1814. gbinv56.seq - Invertebrate sequence entries, part 56.
1815. gbinv57.seq - Invertebrate sequence entries, part 57.
1816. gbinv58.seq - Invertebrate sequence entries, part 58.
1817. gbinv59.seq - Invertebrate sequence entries, part 59.
1818. gbinv6.seq - Invertebrate sequence entries, part 6.
1819. gbinv60.seq - Invertebrate sequence entries, part 60.
1820. gbinv61.seq - Invertebrate sequence entries, part 61.
1821. gbinv62.seq - Invertebrate sequence entries, part 62.
1822. gbinv63.seq - Invertebrate sequence entries, part 63.
1823. gbinv64.seq - Invertebrate sequence entries, part 64.
1824. gbinv65.seq - Invertebrate sequence entries, part 65.
1825. gbinv66.seq - Invertebrate sequence entries, part 66.
1826. gbinv67.seq - Invertebrate sequence entries, part 67.
1827. gbinv68.seq - Invertebrate sequence entries, part 68.
1828. gbinv69.seq - Invertebrate sequence entries, part 69.
1829. gbinv7.seq - Invertebrate sequence entries, part 7.
1830. gbinv70.seq - Invertebrate sequence entries, part 70.
1831. gbinv71.seq - Invertebrate sequence entries, part 71.
1832. gbinv72.seq - Invertebrate sequence entries, part 72.
1833. gbinv73.seq - Invertebrate sequence entries, part 73.
1834. gbinv74.seq - Invertebrate sequence entries, part 74.
1835. gbinv75.seq - Invertebrate sequence entries, part 75.
1836. gbinv76.seq - Invertebrate sequence entries, part 76.
1837. gbinv77.seq - Invertebrate sequence entries, part 77.
1838. gbinv78.seq - Invertebrate sequence entries, part 78.
1839. gbinv79.seq - Invertebrate sequence entries, part 79.
1840. gbinv8.seq - Invertebrate sequence entries, part 8.
1841. gbinv80.seq - Invertebrate sequence entries, part 80.
1842. gbinv81.seq - Invertebrate sequence entries, part 81.
1843. gbinv82.seq - Invertebrate sequence entries, part 82.
1844. gbinv83.seq - Invertebrate sequence entries, part 83.
1845. gbinv84.seq - Invertebrate sequence entries, part 84.
1846. gbinv85.seq - Invertebrate sequence entries, part 85.
1847. gbinv86.seq - Invertebrate sequence entries, part 86.
1848. gbinv87.seq - Invertebrate sequence entries, part 87.
1849. gbinv88.seq - Invertebrate sequence entries, part 88.
1850. gbinv89.seq - Invertebrate sequence entries, part 89.
1851. gbinv9.seq - Invertebrate sequence entries, part 9.
1852. gbinv90.seq - Invertebrate sequence entries, part 90.
1853. gbinv91.seq - Invertebrate sequence entries, part 91.
1854. gbinv92.seq - Invertebrate sequence entries, part 92.
1855. gbinv93.seq - Invertebrate sequence entries, part 93.
1856. gbinv94.seq - Invertebrate sequence entries, part 94.
1857. gbinv95.seq - Invertebrate sequence entries, part 95.
1858. gbinv96.seq - Invertebrate sequence entries, part 96.
1859. gbinv97.seq - Invertebrate sequence entries, part 97.
1860. gbinv98.seq - Invertebrate sequence entries, part 98.
1861. gbinv99.seq - Invertebrate sequence entries, part 99.
1862. gbmam1.seq - Other mammalian sequence entries, part 1.
1863. gbmam10.seq - Other mammalian sequence entries, part 10.
1864. gbmam11.seq - Other mammalian sequence entries, part 11.
1865. gbmam12.seq - Other mammalian sequence entries, part 12.
1866. gbmam13.seq - Other mammalian sequence entries, part 13.
1867. gbmam14.seq - Other mammalian sequence entries, part 14.
1868. gbmam15.seq - Other mammalian sequence entries, part 15.
1869. gbmam16.seq - Other mammalian sequence entries, part 16.
1870. gbmam17.seq - Other mammalian sequence entries, part 17.
1871. gbmam18.seq - Other mammalian sequence entries, part 18.
1872. gbmam19.seq - Other mammalian sequence entries, part 19.
1873. gbmam2.seq - Other mammalian sequence entries, part 2.
1874. gbmam20.seq - Other mammalian sequence entries, part 20.
1875. gbmam21.seq - Other mammalian sequence entries, part 21.
1876. gbmam22.seq - Other mammalian sequence entries, part 22.
1877. gbmam23.seq - Other mammalian sequence entries, part 23.
1878. gbmam24.seq - Other mammalian sequence entries, part 24.
1879. gbmam25.seq - Other mammalian sequence entries, part 25.
1880. gbmam26.seq - Other mammalian sequence entries, part 26.
1881. gbmam27.seq - Other mammalian sequence entries, part 27.
1882. gbmam28.seq - Other mammalian sequence entries, part 28.
1883. gbmam29.seq - Other mammalian sequence entries, part 29.
1884. gbmam3.seq - Other mammalian sequence entries, part 3.
1885. gbmam30.seq - Other mammalian sequence entries, part 30.
1886. gbmam31.seq - Other mammalian sequence entries, part 31.
1887. gbmam32.seq - Other mammalian sequence entries, part 32.
1888. gbmam33.seq - Other mammalian sequence entries, part 33.
1889. gbmam34.seq - Other mammalian sequence entries, part 34.
1890. gbmam35.seq - Other mammalian sequence entries, part 35.
1891. gbmam36.seq - Other mammalian sequence entries, part 36.
1892. gbmam37.seq - Other mammalian sequence entries, part 37.
1893. gbmam38.seq - Other mammalian sequence entries, part 38.
1894. gbmam39.seq - Other mammalian sequence entries, part 39.
1895. gbmam4.seq - Other mammalian sequence entries, part 4.
1896. gbmam5.seq - Other mammalian sequence entries, part 5.
1897. gbmam6.seq - Other mammalian sequence entries, part 6.
1898. gbmam7.seq - Other mammalian sequence entries, part 7.
1899. gbmam8.seq - Other mammalian sequence entries, part 8.
1900. gbmam9.seq - Other mammalian sequence entries, part 9.
1901. gbnew.txt - Accession numbers of entries new since the previous release.
1902. gbpat1.seq - Patent sequence entries, part 1.
1903. gbpat10.seq - Patent sequence entries, part 10.
1904. gbpat100.seq - Patent sequence entries, part 100.
1905. gbpat101.seq - Patent sequence entries, part 101.
1906. gbpat102.seq - Patent sequence entries, part 102.
1907. gbpat103.seq - Patent sequence entries, part 103.
1908. gbpat104.seq - Patent sequence entries, part 104.
1909. gbpat105.seq - Patent sequence entries, part 105.
1910. gbpat106.seq - Patent sequence entries, part 106.
1911. gbpat107.seq - Patent sequence entries, part 107.
1912. gbpat108.seq - Patent sequence entries, part 108.
1913. gbpat109.seq - Patent sequence entries, part 109.
1914. gbpat11.seq - Patent sequence entries, part 11.
1915. gbpat110.seq - Patent sequence entries, part 110.
1916. gbpat111.seq - Patent sequence entries, part 111.
1917. gbpat112.seq - Patent sequence entries, part 112.
1918. gbpat113.seq - Patent sequence entries, part 113.
1919. gbpat114.seq - Patent sequence entries, part 114.
1920. gbpat115.seq - Patent sequence entries, part 115.
1921. gbpat116.seq - Patent sequence entries, part 116.
1922. gbpat117.seq - Patent sequence entries, part 117.
1923. gbpat118.seq - Patent sequence entries, part 118.
1924. gbpat119.seq - Patent sequence entries, part 119.
1925. gbpat12.seq - Patent sequence entries, part 12.
1926. gbpat120.seq - Patent sequence entries, part 120.
1927. gbpat121.seq - Patent sequence entries, part 121.
1928. gbpat122.seq - Patent sequence entries, part 122.
1929. gbpat123.seq - Patent sequence entries, part 123.
1930. gbpat124.seq - Patent sequence entries, part 124.
1931. gbpat125.seq - Patent sequence entries, part 125.
1932. gbpat126.seq - Patent sequence entries, part 126.
1933. gbpat127.seq - Patent sequence entries, part 127.
1934. gbpat128.seq - Patent sequence entries, part 128.
1935. gbpat129.seq - Patent sequence entries, part 129.
1936. gbpat13.seq - Patent sequence entries, part 13.
1937. gbpat130.seq - Patent sequence entries, part 130.
1938. gbpat131.seq - Patent sequence entries, part 131.
1939. gbpat132.seq - Patent sequence entries, part 132.
1940. gbpat133.seq - Patent sequence entries, part 133.
1941. gbpat134.seq - Patent sequence entries, part 134.
1942. gbpat135.seq - Patent sequence entries, part 135.
1943. gbpat136.seq - Patent sequence entries, part 136.
1944. gbpat137.seq - Patent sequence entries, part 137.
1945. gbpat138.seq - Patent sequence entries, part 138.
1946. gbpat139.seq - Patent sequence entries, part 139.
1947. gbpat14.seq - Patent sequence entries, part 14.
1948. gbpat140.seq - Patent sequence entries, part 140.
1949. gbpat141.seq - Patent sequence entries, part 141.
1950. gbpat142.seq - Patent sequence entries, part 142.
1951. gbpat143.seq - Patent sequence entries, part 143.
1952. gbpat144.seq - Patent sequence entries, part 144.
1953. gbpat145.seq - Patent sequence entries, part 145.
1954. gbpat146.seq - Patent sequence entries, part 146.
1955. gbpat147.seq - Patent sequence entries, part 147.
1956. gbpat148.seq - Patent sequence entries, part 148.
1957. gbpat149.seq - Patent sequence entries, part 149.
1958. gbpat15.seq - Patent sequence entries, part 15.
1959. gbpat150.seq - Patent sequence entries, part 150.
1960. gbpat151.seq - Patent sequence entries, part 151.
1961. gbpat152.seq - Patent sequence entries, part 152.
1962. gbpat153.seq - Patent sequence entries, part 153.
1963. gbpat154.seq - Patent sequence entries, part 154.
1964. gbpat155.seq - Patent sequence entries, part 155.
1965. gbpat156.seq - Patent sequence entries, part 156.
1966. gbpat157.seq - Patent sequence entries, part 157.
1967. gbpat158.seq - Patent sequence entries, part 158.
1968. gbpat159.seq - Patent sequence entries, part 159.
1969. gbpat16.seq - Patent sequence entries, part 16.
1970. gbpat160.seq - Patent sequence entries, part 160.
1971. gbpat161.seq - Patent sequence entries, part 161.
1972. gbpat162.seq - Patent sequence entries, part 162.
1973. gbpat163.seq - Patent sequence entries, part 163.
1974. gbpat164.seq - Patent sequence entries, part 164.
1975. gbpat165.seq - Patent sequence entries, part 165.
1976. gbpat166.seq - Patent sequence entries, part 166.
1977. gbpat167.seq - Patent sequence entries, part 167.
1978. gbpat168.seq - Patent sequence entries, part 168.
1979. gbpat169.seq - Patent sequence entries, part 169.
1980. gbpat17.seq - Patent sequence entries, part 17.
1981. gbpat170.seq - Patent sequence entries, part 170.
1982. gbpat171.seq - Patent sequence entries, part 171.
1983. gbpat172.seq - Patent sequence entries, part 172.
1984. gbpat173.seq - Patent sequence entries, part 173.
1985. gbpat174.seq - Patent sequence entries, part 174.
1986. gbpat175.seq - Patent sequence entries, part 175.
1987. gbpat176.seq - Patent sequence entries, part 176.
1988. gbpat177.seq - Patent sequence entries, part 177.
1989. gbpat178.seq - Patent sequence entries, part 178.
1990. gbpat179.seq - Patent sequence entries, part 179.
1991. gbpat18.seq - Patent sequence entries, part 18.
1992. gbpat180.seq - Patent sequence entries, part 180.
1993. gbpat181.seq - Patent sequence entries, part 181.
1994. gbpat182.seq - Patent sequence entries, part 182.
1995. gbpat183.seq - Patent sequence entries, part 183.
1996. gbpat184.seq - Patent sequence entries, part 184.
1997. gbpat185.seq - Patent sequence entries, part 185.
1998. gbpat186.seq - Patent sequence entries, part 186.
1999. gbpat187.seq - Patent sequence entries, part 187.
2000. gbpat188.seq - Patent sequence entries, part 188.
2001. gbpat189.seq - Patent sequence entries, part 189.
2002. gbpat19.seq - Patent sequence entries, part 19.
2003. gbpat190.seq - Patent sequence entries, part 190.
2004. gbpat191.seq - Patent sequence entries, part 191.
2005. gbpat192.seq - Patent sequence entries, part 192.
2006. gbpat193.seq - Patent sequence entries, part 193.
2007. gbpat194.seq - Patent sequence entries, part 194.
2008. gbpat195.seq - Patent sequence entries, part 195.
2009. gbpat196.seq - Patent sequence entries, part 196.
2010. gbpat197.seq - Patent sequence entries, part 197.
2011. gbpat198.seq - Patent sequence entries, part 198.
2012. gbpat199.seq - Patent sequence entries, part 199.
2013. gbpat2.seq - Patent sequence entries, part 2.
2014. gbpat20.seq - Patent sequence entries, part 20.
2015. gbpat200.seq - Patent sequence entries, part 200.
2016. gbpat201.seq - Patent sequence entries, part 201.
2017. gbpat202.seq - Patent sequence entries, part 202.
2018. gbpat203.seq - Patent sequence entries, part 203.
2019. gbpat204.seq - Patent sequence entries, part 204.
2020. gbpat205.seq - Patent sequence entries, part 205.
2021. gbpat206.seq - Patent sequence entries, part 206.
2022. gbpat207.seq - Patent sequence entries, part 207.
2023. gbpat208.seq - Patent sequence entries, part 208.
2024. gbpat209.seq - Patent sequence entries, part 209.
2025. gbpat21.seq - Patent sequence entries, part 21.
2026. gbpat210.seq - Patent sequence entries, part 210.
2027. gbpat211.seq - Patent sequence entries, part 211.
2028. gbpat212.seq - Patent sequence entries, part 212.
2029. gbpat213.seq - Patent sequence entries, part 213.
2030. gbpat214.seq - Patent sequence entries, part 214.
2031. gbpat215.seq - Patent sequence entries, part 215.
2032. gbpat216.seq - Patent sequence entries, part 216.
2033. gbpat217.seq - Patent sequence entries, part 217.
2034. gbpat218.seq - Patent sequence entries, part 218.
2035. gbpat219.seq - Patent sequence entries, part 219.
2036. gbpat22.seq - Patent sequence entries, part 22.
2037. gbpat220.seq - Patent sequence entries, part 220.
2038. gbpat221.seq - Patent sequence entries, part 221.
2039. gbpat222.seq - Patent sequence entries, part 222.
2040. gbpat223.seq - Patent sequence entries, part 223.
2041. gbpat224.seq - Patent sequence entries, part 224.
2042. gbpat225.seq - Patent sequence entries, part 225.
2043. gbpat226.seq - Patent sequence entries, part 226.
2044. gbpat227.seq - Patent sequence entries, part 227.
2045. gbpat228.seq - Patent sequence entries, part 228.
2046. gbpat229.seq - Patent sequence entries, part 229.
2047. gbpat23.seq - Patent sequence entries, part 23.
2048. gbpat230.seq - Patent sequence entries, part 230.
2049. gbpat231.seq - Patent sequence entries, part 231.
2050. gbpat232.seq - Patent sequence entries, part 232.
2051. gbpat233.seq - Patent sequence entries, part 233.
2052. gbpat234.seq - Patent sequence entries, part 234.
2053. gbpat235.seq - Patent sequence entries, part 235.
2054. gbpat236.seq - Patent sequence entries, part 236.
2055. gbpat237.seq - Patent sequence entries, part 237.
2056. gbpat238.seq - Patent sequence entries, part 238.
2057. gbpat239.seq - Patent sequence entries, part 239.
2058. gbpat24.seq - Patent sequence entries, part 24.
2059. gbpat240.seq - Patent sequence entries, part 240.
2060. gbpat241.seq - Patent sequence entries, part 241.
2061. gbpat242.seq - Patent sequence entries, part 242.
2062. gbpat243.seq - Patent sequence entries, part 243.
2063. gbpat244.seq - Patent sequence entries, part 244.
2064. gbpat245.seq - Patent sequence entries, part 245.
2065. gbpat246.seq - Patent sequence entries, part 246.
2066. gbpat247.seq - Patent sequence entries, part 247.
2067. gbpat248.seq - Patent sequence entries, part 248.
2068. gbpat249.seq - Patent sequence entries, part 249.
2069. gbpat25.seq - Patent sequence entries, part 25.
2070. gbpat250.seq - Patent sequence entries, part 250.
2071. gbpat251.seq - Patent sequence entries, part 251.
2072. gbpat252.seq - Patent sequence entries, part 252.
2073. gbpat253.seq - Patent sequence entries, part 253.
2074. gbpat254.seq - Patent sequence entries, part 254.
2075. gbpat255.seq - Patent sequence entries, part 255.
2076. gbpat256.seq - Patent sequence entries, part 256.
2077. gbpat257.seq - Patent sequence entries, part 257.
2078. gbpat258.seq - Patent sequence entries, part 258.
2079. gbpat259.seq - Patent sequence entries, part 259.
2080. gbpat26.seq - Patent sequence entries, part 26.
2081. gbpat260.seq - Patent sequence entries, part 260.
2082. gbpat261.seq - Patent sequence entries, part 261.
2083. gbpat262.seq - Patent sequence entries, part 262.
2084. gbpat263.seq - Patent sequence entries, part 263.
2085. gbpat264.seq - Patent sequence entries, part 264.
2086. gbpat265.seq - Patent sequence entries, part 265.
2087. gbpat266.seq - Patent sequence entries, part 266.
2088. gbpat267.seq - Patent sequence entries, part 267.
2089. gbpat268.seq - Patent sequence entries, part 268.
2090. gbpat269.seq - Patent sequence entries, part 269.
2091. gbpat27.seq - Patent sequence entries, part 27.
2092. gbpat270.seq - Patent sequence entries, part 270.
2093. gbpat271.seq - Patent sequence entries, part 271.
2094. gbpat272.seq - Patent sequence entries, part 272.
2095. gbpat273.seq - Patent sequence entries, part 273.
2096. gbpat274.seq - Patent sequence entries, part 274.
2097. gbpat275.seq - Patent sequence entries, part 275.
2098. gbpat276.seq - Patent sequence entries, part 276.
2099. gbpat277.seq - Patent sequence entries, part 277.
2100. gbpat278.seq - Patent sequence entries, part 278.
2101. gbpat279.seq - Patent sequence entries, part 279.
2102. gbpat28.seq - Patent sequence entries, part 28.
2103. gbpat280.seq - Patent sequence entries, part 280.
2104. gbpat29.seq - Patent sequence entries, part 29.
2105. gbpat3.seq - Patent sequence entries, part 3.
2106. gbpat30.seq - Patent sequence entries, part 30.
2107. gbpat31.seq - Patent sequence entries, part 31.
2108. gbpat32.seq - Patent sequence entries, part 32.
2109. gbpat33.seq - Patent sequence entries, part 33.
2110. gbpat34.seq - Patent sequence entries, part 34.
2111. gbpat35.seq - Patent sequence entries, part 35.
2112. gbpat36.seq - Patent sequence entries, part 36.
2113. gbpat37.seq - Patent sequence entries, part 37.
2114. gbpat38.seq - Patent sequence entries, part 38.
2115. gbpat39.seq - Patent sequence entries, part 39.
2116. gbpat4.seq - Patent sequence entries, part 4.
2117. gbpat40.seq - Patent sequence entries, part 40.
2118. gbpat41.seq - Patent sequence entries, part 41.
2119. gbpat42.seq - Patent sequence entries, part 42.
2120. gbpat43.seq - Patent sequence entries, part 43.
2121. gbpat44.seq - Patent sequence entries, part 44.
2122. gbpat45.seq - Patent sequence entries, part 45.
2123. gbpat46.seq - Patent sequence entries, part 46.
2124. gbpat47.seq - Patent sequence entries, part 47.
2125. gbpat48.seq - Patent sequence entries, part 48.
2126. gbpat49.seq - Patent sequence entries, part 49.
2127. gbpat5.seq - Patent sequence entries, part 5.
2128. gbpat50.seq - Patent sequence entries, part 50.
2129. gbpat51.seq - Patent sequence entries, part 51.
2130. gbpat52.seq - Patent sequence entries, part 52.
2131. gbpat53.seq - Patent sequence entries, part 53.
2132. gbpat54.seq - Patent sequence entries, part 54.
2133. gbpat55.seq - Patent sequence entries, part 55.
2134. gbpat56.seq - Patent sequence entries, part 56.
2135. gbpat57.seq - Patent sequence entries, part 57.
2136. gbpat58.seq - Patent sequence entries, part 58.
2137. gbpat59.seq - Patent sequence entries, part 59.
2138. gbpat6.seq - Patent sequence entries, part 6.
2139. gbpat60.seq - Patent sequence entries, part 60.
2140. gbpat61.seq - Patent sequence entries, part 61.
2141. gbpat62.seq - Patent sequence entries, part 62.
2142. gbpat63.seq - Patent sequence entries, part 63.
2143. gbpat64.seq - Patent sequence entries, part 64.
2144. gbpat65.seq - Patent sequence entries, part 65.
2145. gbpat66.seq - Patent sequence entries, part 66.
2146. gbpat67.seq - Patent sequence entries, part 67.
2147. gbpat68.seq - Patent sequence entries, part 68.
2148. gbpat69.seq - Patent sequence entries, part 69.
2149. gbpat7.seq - Patent sequence entries, part 7.
2150. gbpat70.seq - Patent sequence entries, part 70.
2151. gbpat71.seq - Patent sequence entries, part 71.
2152. gbpat72.seq - Patent sequence entries, part 72.
2153. gbpat73.seq - Patent sequence entries, part 73.
2154. gbpat74.seq - Patent sequence entries, part 74.
2155. gbpat75.seq - Patent sequence entries, part 75.
2156. gbpat76.seq - Patent sequence entries, part 76.
2157. gbpat77.seq - Patent sequence entries, part 77.
2158. gbpat78.seq - Patent sequence entries, part 78.
2159. gbpat79.seq - Patent sequence entries, part 79.
2160. gbpat8.seq - Patent sequence entries, part 8.
2161. gbpat80.seq - Patent sequence entries, part 80.
2162. gbpat81.seq - Patent sequence entries, part 81.
2163. gbpat82.seq - Patent sequence entries, part 82.
2164. gbpat83.seq - Patent sequence entries, part 83.
2165. gbpat84.seq - Patent sequence entries, part 84.
2166. gbpat85.seq - Patent sequence entries, part 85.
2167. gbpat86.seq - Patent sequence entries, part 86.
2168. gbpat87.seq - Patent sequence entries, part 87.
2169. gbpat88.seq - Patent sequence entries, part 88.
2170. gbpat89.seq - Patent sequence entries, part 89.
2171. gbpat9.seq - Patent sequence entries, part 9.
2172. gbpat90.seq - Patent sequence entries, part 90.
2173. gbpat91.seq - Patent sequence entries, part 91.
2174. gbpat92.seq - Patent sequence entries, part 92.
2175. gbpat93.seq - Patent sequence entries, part 93.
2176. gbpat94.seq - Patent sequence entries, part 94.
2177. gbpat95.seq - Patent sequence entries, part 95.
2178. gbpat96.seq - Patent sequence entries, part 96.
2179. gbpat97.seq - Patent sequence entries, part 97.
2180. gbpat98.seq - Patent sequence entries, part 98.
2181. gbpat99.seq - Patent sequence entries, part 99.
2182. gbphg1.seq - Phage sequence entries, part 1.
2183. gbphg2.seq - Phage sequence entries, part 2.
2184. gbphg3.seq - Phage sequence entries, part 3.
2185. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2186. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2187. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2188. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2189. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2190. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2191. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2192. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2193. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2194. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2195. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2196. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2197. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2198. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2199. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2200. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2201. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2202. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2203. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2204. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2205. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2206. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2207. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2208. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2209. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2210. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2211. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2212. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2213. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2214. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2215. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2216. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2217. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2218. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2219. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2220. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2221. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2222. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2223. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2224. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2225. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2226. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2227. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2228. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2229. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2230. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2231. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2232. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2233. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2234. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2235. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2236. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2237. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2238. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2239. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2240. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2241. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2242. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2243. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2244. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2245. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2246. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2247. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2248. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2249. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2250. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2251. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2252. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2253. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2254. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2255. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2256. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2257. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2258. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2259. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2260. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2261. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2262. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2263. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2264. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2265. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2266. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2267. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2268. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2269. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2270. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2271. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2272. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2273. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2274. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2275. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2276. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2277. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2278. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2279. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2280. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2281. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2282. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2283. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2284. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2285. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2286. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2287. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2288. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2289. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2290. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2291. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2292. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2293. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2294. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2295. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2296. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2297. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2298. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2299. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2300. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2301. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2302. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2303. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2304. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2305. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2306. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2307. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2308. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2309. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2310. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2311. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2312. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2313. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2314. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2315. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2316. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2317. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2318. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2319. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2320. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2321. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2322. gbpri1.seq - Primate sequence entries, part 1.
2323. gbpri10.seq - Primate sequence entries, part 10.
2324. gbpri11.seq - Primate sequence entries, part 11.
2325. gbpri12.seq - Primate sequence entries, part 12.
2326. gbpri13.seq - Primate sequence entries, part 13.
2327. gbpri14.seq - Primate sequence entries, part 14.
2328. gbpri15.seq - Primate sequence entries, part 15.
2329. gbpri16.seq - Primate sequence entries, part 16.
2330. gbpri17.seq - Primate sequence entries, part 17.
2331. gbpri18.seq - Primate sequence entries, part 18.
2332. gbpri19.seq - Primate sequence entries, part 19.
2333. gbpri2.seq - Primate sequence entries, part 2.
2334. gbpri20.seq - Primate sequence entries, part 20.
2335. gbpri21.seq - Primate sequence entries, part 21.
2336. gbpri22.seq - Primate sequence entries, part 22.
2337. gbpri23.seq - Primate sequence entries, part 23.
2338. gbpri24.seq - Primate sequence entries, part 24.
2339. gbpri25.seq - Primate sequence entries, part 25.
2340. gbpri26.seq - Primate sequence entries, part 26.
2341. gbpri27.seq - Primate sequence entries, part 27.
2342. gbpri28.seq - Primate sequence entries, part 28.
2343. gbpri29.seq - Primate sequence entries, part 29.
2344. gbpri3.seq - Primate sequence entries, part 3.
2345. gbpri30.seq - Primate sequence entries, part 30.
2346. gbpri31.seq - Primate sequence entries, part 31.
2347. gbpri32.seq - Primate sequence entries, part 32.
2348. gbpri33.seq - Primate sequence entries, part 33.
2349. gbpri34.seq - Primate sequence entries, part 34.
2350. gbpri35.seq - Primate sequence entries, part 35.
2351. gbpri36.seq - Primate sequence entries, part 36.
2352. gbpri37.seq - Primate sequence entries, part 37.
2353. gbpri38.seq - Primate sequence entries, part 38.
2354. gbpri39.seq - Primate sequence entries, part 39.
2355. gbpri4.seq - Primate sequence entries, part 4.
2356. gbpri40.seq - Primate sequence entries, part 40.
2357. gbpri41.seq - Primate sequence entries, part 41.
2358. gbpri42.seq - Primate sequence entries, part 42.
2359. gbpri43.seq - Primate sequence entries, part 43.
2360. gbpri44.seq - Primate sequence entries, part 44.
2361. gbpri45.seq - Primate sequence entries, part 45.
2362. gbpri46.seq - Primate sequence entries, part 46.
2363. gbpri47.seq - Primate sequence entries, part 47.
2364. gbpri48.seq - Primate sequence entries, part 48.
2365. gbpri49.seq - Primate sequence entries, part 49.
2366. gbpri5.seq - Primate sequence entries, part 5.
2367. gbpri50.seq - Primate sequence entries, part 50.
2368. gbpri51.seq - Primate sequence entries, part 51.
2369. gbpri52.seq - Primate sequence entries, part 52.
2370. gbpri53.seq - Primate sequence entries, part 53.
2371. gbpri54.seq - Primate sequence entries, part 54.
2372. gbpri55.seq - Primate sequence entries, part 55.
2373. gbpri6.seq - Primate sequence entries, part 6.
2374. gbpri7.seq - Primate sequence entries, part 7.
2375. gbpri8.seq - Primate sequence entries, part 8.
2376. gbpri9.seq - Primate sequence entries, part 9.
2377. gbrel.txt - Release notes (this document).
2378. gbrod1.seq - Rodent sequence entries, part 1.
2379. gbrod10.seq - Rodent sequence entries, part 10.
2380. gbrod11.seq - Rodent sequence entries, part 11.
2381. gbrod12.seq - Rodent sequence entries, part 12.
2382. gbrod13.seq - Rodent sequence entries, part 13.
2383. gbrod14.seq - Rodent sequence entries, part 14.
2384. gbrod15.seq - Rodent sequence entries, part 15.
2385. gbrod16.seq - Rodent sequence entries, part 16.
2386. gbrod17.seq - Rodent sequence entries, part 17.
2387. gbrod18.seq - Rodent sequence entries, part 18.
2388. gbrod19.seq - Rodent sequence entries, part 19.
2389. gbrod2.seq - Rodent sequence entries, part 2.
2390. gbrod20.seq - Rodent sequence entries, part 20.
2391. gbrod21.seq - Rodent sequence entries, part 21.
2392. gbrod22.seq - Rodent sequence entries, part 22.
2393. gbrod23.seq - Rodent sequence entries, part 23.
2394. gbrod24.seq - Rodent sequence entries, part 24.
2395. gbrod25.seq - Rodent sequence entries, part 25.
2396. gbrod26.seq - Rodent sequence entries, part 26.
2397. gbrod27.seq - Rodent sequence entries, part 27.
2398. gbrod28.seq - Rodent sequence entries, part 28.
2399. gbrod29.seq - Rodent sequence entries, part 29.
2400. gbrod3.seq - Rodent sequence entries, part 3.
2401. gbrod30.seq - Rodent sequence entries, part 30.
2402. gbrod4.seq - Rodent sequence entries, part 4.
2403. gbrod5.seq - Rodent sequence entries, part 5.
2404. gbrod6.seq - Rodent sequence entries, part 6.
2405. gbrod7.seq - Rodent sequence entries, part 7.
2406. gbrod8.seq - Rodent sequence entries, part 8.
2407. gbrod9.seq - Rodent sequence entries, part 9.
2408. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2409. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2410. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2411. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2412. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2413. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2414. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2415. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2416. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2417. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2418. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2419. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2420. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2421. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2422. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2423. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2424. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2425. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2426. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2427. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2428. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2429. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2430. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2431. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2432. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2433. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2434. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2435. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2436. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2437. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2438. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2439. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2440. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2441. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2442. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2443. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2444. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2445. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2446. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2447. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2448. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2449. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2450. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2451. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2452. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2453. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2454. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2455. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2456. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2457. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2458. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2459. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2460. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2461. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2462. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2463. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2464. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2465. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2466. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2467. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2468. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2469. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2470. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2471. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2472. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2473. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2474. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2475. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2476. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2477. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2478. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2479. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2480. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2481. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2482. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2483. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2484. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2485. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2486. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2487. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2488. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2489. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2490. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2491. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2492. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2493. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2494. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2495. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2496. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2497. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2498. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2499. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2500. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2501. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2502. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2503. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2504. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2505. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2506. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2507. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2508. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2509. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2510. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2511. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2512. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2513. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2514. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2515. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2516. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2517. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2518. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2519. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2520. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2521. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2522. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2523. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2524. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2525. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2526. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2527. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2528. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2529. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2530. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2531. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2532. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2533. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2534. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2535. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2536. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2537. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2538. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2539. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2540. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2541. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2542. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2543. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2544. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
2545. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
2546. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
2547. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
2548. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2549. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2550. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
2551. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
2552. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
2553. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
2554. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
2555. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
2556. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
2557. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
2558. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
2559. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
2560. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2561. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
2562. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
2563. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
2564. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
2565. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
2566. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
2567. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
2568. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
2569. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
2570. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
2571. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2572. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
2573. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
2574. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
2575. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
2576. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
2577. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
2578. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
2579. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
2580. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
2581. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
2582. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2583. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2584. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2585. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2586. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2587. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2588. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2589. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2590. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2591. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2592. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2593. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2594. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2595. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2596. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2597. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2598. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2599. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2600. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2601. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2602. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2603. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2604. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2605. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2606. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2607. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2608. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2609. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2610. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2611. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2612. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2613. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2614. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2615. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2616. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2617. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2618. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2619. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2620. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2621. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2622. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2623. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2624. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2625. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2626. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2627. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2628. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2629. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2630. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2631. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2632. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2633. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2634. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2635. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2636. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2637. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2638. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2639. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2640. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2641. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2642. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2643. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2644. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2645. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2646. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2647. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2648. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2649. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2650. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2651. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2652. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2653. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2654. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2655. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2656. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2657. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2658. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2659. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2660. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2661. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2662. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2663. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2664. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2665. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2666. gbuna1.seq - Unannotated sequence entries, part 1.
2667. gbvrl1.seq - Viral sequence entries, part 1.
2668. gbvrl10.seq - Viral sequence entries, part 10.
2669. gbvrl11.seq - Viral sequence entries, part 11.
2670. gbvrl12.seq - Viral sequence entries, part 12.
2671. gbvrl13.seq - Viral sequence entries, part 13.
2672. gbvrl14.seq - Viral sequence entries, part 14.
2673. gbvrl15.seq - Viral sequence entries, part 15.
2674. gbvrl16.seq - Viral sequence entries, part 16.
2675. gbvrl17.seq - Viral sequence entries, part 17.
2676. gbvrl18.seq - Viral sequence entries, part 18.
2677. gbvrl19.seq - Viral sequence entries, part 19.
2678. gbvrl2.seq - Viral sequence entries, part 2.
2679. gbvrl20.seq - Viral sequence entries, part 20.
2680. gbvrl21.seq - Viral sequence entries, part 21.
2681. gbvrl22.seq - Viral sequence entries, part 22.
2682. gbvrl23.seq - Viral sequence entries, part 23.
2683. gbvrl24.seq - Viral sequence entries, part 24.
2684. gbvrl25.seq - Viral sequence entries, part 25.
2685. gbvrl26.seq - Viral sequence entries, part 26.
2686. gbvrl27.seq - Viral sequence entries, part 27.
2687. gbvrl28.seq - Viral sequence entries, part 28.
2688. gbvrl29.seq - Viral sequence entries, part 29.
2689. gbvrl3.seq - Viral sequence entries, part 3.
2690. gbvrl30.seq - Viral sequence entries, part 30.
2691. gbvrl31.seq - Viral sequence entries, part 31.
2692. gbvrl32.seq - Viral sequence entries, part 32.
2693. gbvrl33.seq - Viral sequence entries, part 33.
2694. gbvrl34.seq - Viral sequence entries, part 34.
2695. gbvrl35.seq - Viral sequence entries, part 35.
2696. gbvrl36.seq - Viral sequence entries, part 36.
2697. gbvrl37.seq - Viral sequence entries, part 37.
2698. gbvrl38.seq - Viral sequence entries, part 38.
2699. gbvrl39.seq - Viral sequence entries, part 39.
2700. gbvrl4.seq - Viral sequence entries, part 4.
2701. gbvrl40.seq - Viral sequence entries, part 40.
2702. gbvrl41.seq - Viral sequence entries, part 41.
2703. gbvrl42.seq - Viral sequence entries, part 42.
2704. gbvrl43.seq - Viral sequence entries, part 43.
2705. gbvrl44.seq - Viral sequence entries, part 44.
2706. gbvrl45.seq - Viral sequence entries, part 45.
2707. gbvrl5.seq - Viral sequence entries, part 5.
2708. gbvrl6.seq - Viral sequence entries, part 6.
2709. gbvrl7.seq - Viral sequence entries, part 7.
2710. gbvrl8.seq - Viral sequence entries, part 8.
2711. gbvrl9.seq - Viral sequence entries, part 9.
2712. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2713. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2714. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2715. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2716. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2717. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2718. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2719. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2720. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2721. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2722. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2723. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2724. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2725. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2726. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2727. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2728. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2729. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2730. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2731. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2732. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2733. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2734. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2735. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2736. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2737. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2738. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2739. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2740. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2741. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2742. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2743. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2744. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2745. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2746. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2747. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2748. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2749. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2750. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2751. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2752. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2753. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2754. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2755. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2756. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2757. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2758. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2759. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2760. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2761. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2762. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2763. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2764. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2765. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2766. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2767. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2768. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2769. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2770. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2771. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2772. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2773. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2774. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 217.0 flatfiles require roughly 809 GB (sequence
files only) or 810 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249998540     gbbct1.seq
 246913373     gbbct10.seq
 245862162     gbbct100.seq
 244362573     gbbct101.seq
 242532407     gbbct102.seq
 247851013     gbbct103.seq
 167385327     gbbct104.seq
 249320829     gbbct105.seq
 239666506     gbbct106.seq
 245048917     gbbct107.seq
 247107455     gbbct108.seq
 246696518     gbbct109.seq
 242156996     gbbct11.seq
 246730740     gbbct110.seq
 238756212     gbbct111.seq
 241794792     gbbct112.seq
 249774720     gbbct113.seq
 247057654     gbbct114.seq
 245008588     gbbct115.seq
  36729652     gbbct116.seq
 245338461     gbbct117.seq
 246570708     gbbct118.seq
 247975814     gbbct119.seq
 243160321     gbbct12.seq
 246027520     gbbct120.seq
 242851972     gbbct121.seq
 244775885     gbbct122.seq
 244531304     gbbct123.seq
 236113599     gbbct124.seq
 240476563     gbbct125.seq
 132170845     gbbct126.seq
 247757177     gbbct127.seq
 240369157     gbbct128.seq
 247517878     gbbct129.seq
 247761146     gbbct13.seq
 248102184     gbbct130.seq
 248249947     gbbct131.seq
 235445299     gbbct132.seq
 246393680     gbbct133.seq
 248610726     gbbct134.seq
 246239313     gbbct135.seq
 242271697     gbbct136.seq
 249537757     gbbct137.seq
 242211369     gbbct138.seq
 175045842     gbbct139.seq
 245875370     gbbct14.seq
 246017452     gbbct140.seq
 245236207     gbbct141.seq
 247814065     gbbct142.seq
 243322432     gbbct143.seq
 248205520     gbbct144.seq
 248627603     gbbct145.seq
 195420586     gbbct146.seq
 240266950     gbbct147.seq
 246082630     gbbct148.seq
 247905913     gbbct149.seq
 244928764     gbbct15.seq
 247917208     gbbct150.seq
 249708331     gbbct151.seq
 246427755     gbbct152.seq
 249471914     gbbct153.seq
 218699376     gbbct154.seq
 243209338     gbbct155.seq
 243662912     gbbct156.seq
 247409998     gbbct157.seq
 241328923     gbbct158.seq
 241068998     gbbct159.seq
 247804609     gbbct16.seq
 247668732     gbbct160.seq
 248956464     gbbct161.seq
 246031759     gbbct162.seq
 239904340     gbbct163.seq
 244608420     gbbct164.seq
 241783052     gbbct165.seq
 245367141     gbbct166.seq
 247049477     gbbct167.seq
  63161546     gbbct168.seq
 237250540     gbbct169.seq
 240182483     gbbct17.seq
 249574802     gbbct170.seq
 244622467     gbbct171.seq
 242637621     gbbct172.seq
 248237949     gbbct173.seq
 244019047     gbbct174.seq
 244171032     gbbct175.seq
 248857324     gbbct176.seq
 247245416     gbbct177.seq
 229606402     gbbct178.seq
 244134035     gbbct179.seq
 242646846     gbbct18.seq
 242666477     gbbct180.seq
 249313084     gbbct181.seq
 242876363     gbbct182.seq
 234613820     gbbct183.seq
 247233437     gbbct184.seq
 246036968     gbbct185.seq
 242118559     gbbct186.seq
 249717386     gbbct187.seq
 241249726     gbbct188.seq
 249725683     gbbct189.seq
 244869682     gbbct19.seq
 191751381     gbbct190.seq
 243912160     gbbct191.seq
 248420311     gbbct192.seq
 246891205     gbbct193.seq
 247331712     gbbct194.seq
 249273687     gbbct195.seq
 244110569     gbbct196.seq
 243588224     gbbct197.seq
 241351195     gbbct198.seq
 249382430     gbbct199.seq
 243710818     gbbct2.seq
 249923907     gbbct20.seq
 242565121     gbbct200.seq
 246960670     gbbct201.seq
 242263112     gbbct202.seq
 246307704     gbbct203.seq
 242800942     gbbct204.seq
  57975785     gbbct205.seq
 249756076     gbbct206.seq
 249312284     gbbct207.seq
 243184487     gbbct208.seq
 241058558     gbbct209.seq
 133284711     gbbct21.seq
 240331256     gbbct210.seq
 247310092     gbbct211.seq
 243433615     gbbct212.seq
 240398483     gbbct213.seq
 212754868     gbbct214.seq
 244875040     gbbct215.seq
 239677586     gbbct216.seq
 249728112     gbbct217.seq
 242564811     gbbct218.seq
 249439377     gbbct219.seq
 242167720     gbbct22.seq
 243890899     gbbct220.seq
 248705615     gbbct221.seq
 246632544     gbbct222.seq
 244085469     gbbct223.seq
 249308667     gbbct224.seq
  12256236     gbbct225.seq
 244726166     gbbct226.seq
 248831564     gbbct227.seq
 249668581     gbbct228.seq
 247282505     gbbct229.seq
 249997643     gbbct23.seq
 249956089     gbbct230.seq
 249104707     gbbct231.seq
 247486305     gbbct232.seq
 238045378     gbbct233.seq
 243743091     gbbct234.seq
 248078946     gbbct235.seq
 174972770     gbbct236.seq
 236494273     gbbct237.seq
 245174303     gbbct238.seq
 245830791     gbbct239.seq
 247522106     gbbct24.seq
 241160430     gbbct240.seq
 242947600     gbbct241.seq
 230750275     gbbct242.seq
 243279552     gbbct243.seq
 239989282     gbbct244.seq
 247542166     gbbct245.seq
 247965085     gbbct246.seq
 249945162     gbbct247.seq
  94113372     gbbct248.seq
 247369327     gbbct249.seq
 249361661     gbbct25.seq
  59925061     gbbct250.seq
   6911536     gbbct251.seq
  14291404     gbbct252.seq
  23053516     gbbct253.seq
  44954717     gbbct254.seq
  87618974     gbbct255.seq
 170556803     gbbct256.seq
 249997973     gbbct257.seq
 249999191     gbbct258.seq
 248300647     gbbct259.seq
 248385087     gbbct26.seq
 246541553     gbbct260.seq
 240334242     gbbct261.seq
 235510850     gbbct262.seq
 246528325     gbbct263.seq
 244732689     gbbct264.seq
 249699525     gbbct265.seq
 249997827     gbbct266.seq
  74042675     gbbct267.seq
 245194611     gbbct268.seq
 244535046     gbbct269.seq
 245177654     gbbct27.seq
 249219825     gbbct270.seq
 247587938     gbbct271.seq
 245840255     gbbct272.seq
 249997890     gbbct273.seq
 249998208     gbbct274.seq
 249997539     gbbct275.seq
    989907     gbbct276.seq
 249997493     gbbct277.seq
 249999276     gbbct278.seq
 249998725     gbbct279.seq
 242877044     gbbct28.seq
  46209183     gbbct280.seq
 249998275     gbbct281.seq
 249998470     gbbct282.seq
  66428629     gbbct283.seq
 249673967     gbbct284.seq
 174153172     gbbct285.seq
 249998951     gbbct286.seq
  38510618     gbbct287.seq
 249997784     gbbct288.seq
 249940607     gbbct289.seq
 239673850     gbbct29.seq
 249949196     gbbct290.seq
 243663521     gbbct291.seq
 249490348     gbbct292.seq
 195129246     gbbct293.seq
 249884556     gbbct294.seq
 244001381     gbbct295.seq
 241351997     gbbct296.seq
 239205575     gbbct297.seq
 239499876     gbbct298.seq
 242379650     gbbct299.seq
 246565788     gbbct3.seq
 217808721     gbbct30.seq
 249897315     gbbct300.seq
 248730207     gbbct301.seq
 242971045     gbbct302.seq
 245792538     gbbct303.seq
 224853639     gbbct304.seq
 242805093     gbbct31.seq
 245839027     gbbct32.seq
 248682248     gbbct33.seq
 247882843     gbbct34.seq
 249145730     gbbct35.seq
 244437000     gbbct36.seq
 247334075     gbbct37.seq
 249976230     gbbct38.seq
 249765555     gbbct39.seq
 249515650     gbbct4.seq
 240923051     gbbct40.seq
 244794873     gbbct41.seq
 249644022     gbbct42.seq
 165341868     gbbct43.seq
 247445600     gbbct44.seq
 246944380     gbbct45.seq
 248190828     gbbct46.seq
 246578815     gbbct47.seq
 241956782     gbbct48.seq
 246672058     gbbct49.seq
 249998870     gbbct5.seq
 249203001     gbbct50.seq
 246431882     gbbct51.seq
 239781959     gbbct52.seq
 248871193     gbbct53.seq
 248937305     gbbct54.seq
 245189715     gbbct55.seq
  49416025     gbbct56.seq
 244556647     gbbct57.seq
 245263215     gbbct58.seq
 239712399     gbbct59.seq
  55781926     gbbct6.seq
 247756176     gbbct60.seq
 239867034     gbbct61.seq
 247439974     gbbct62.seq
 249952581     gbbct63.seq
 247308442     gbbct64.seq
 247646037     gbbct65.seq
 248873450     gbbct66.seq
 248406395     gbbct67.seq
 247579673     gbbct68.seq
 249838407     gbbct69.seq
 238860784     gbbct7.seq
  63782053     gbbct70.seq
 248758956     gbbct71.seq
 248625192     gbbct72.seq
 249954317     gbbct73.seq
 246771170     gbbct74.seq
 240224060     gbbct75.seq
 243723208     gbbct76.seq
 249623622     gbbct77.seq
 243776697     gbbct78.seq
 246916030     gbbct79.seq
 161547448     gbbct8.seq
 247966596     gbbct80.seq
 244973003     gbbct81.seq
 241930281     gbbct82.seq
 243096444     gbbct83.seq
  93947264     gbbct84.seq
 249871206     gbbct85.seq
 245927972     gbbct86.seq
 245491421     gbbct87.seq
 247030440     gbbct88.seq
 249497859     gbbct89.seq
 249050866     gbbct9.seq
 246724010     gbbct90.seq
 248462233     gbbct91.seq
 241818006     gbbct92.seq
 246928933     gbbct93.seq
 248325202     gbbct94.seq
  26340214     gbbct95.seq
 249007093     gbbct96.seq
 239564117     gbbct97.seq
 249502506     gbbct98.seq
 245702789     gbbct99.seq
  11547226     gbchg.txt
 249754879     gbcon1.seq
 249996041     gbcon10.seq
  73407612     gbcon100.seq
 249998421     gbcon101.seq
 249998946     gbcon102.seq
 249996185     gbcon103.seq
 249995145     gbcon104.seq
 249998953     gbcon105.seq
  32427016     gbcon106.seq
 249994975     gbcon107.seq
 249999581     gbcon108.seq
 249997722     gbcon109.seq
 249495436     gbcon11.seq
 249997541     gbcon110.seq
 208220377     gbcon111.seq
 249992153     gbcon112.seq
 249998787     gbcon113.seq
 249995953     gbcon114.seq
 249999393     gbcon115.seq
 250000027     gbcon116.seq
 143584215     gbcon117.seq
 249995301     gbcon118.seq
 249999496     gbcon119.seq
 249896120     gbcon12.seq
 249998124     gbcon120.seq
 249999708     gbcon121.seq
 249996885     gbcon122.seq
 166460579     gbcon123.seq
 249995504     gbcon124.seq
 249997107     gbcon125.seq
 249999227     gbcon126.seq
 243174054     gbcon127.seq
 174526309     gbcon128.seq
 249996492     gbcon129.seq
 247318376     gbcon13.seq
 249997985     gbcon130.seq
  52243108     gbcon131.seq
 249999899     gbcon132.seq
 249987289     gbcon133.seq
 212159589     gbcon134.seq
 203092435     gbcon135.seq
 249999964     gbcon136.seq
 249123104     gbcon137.seq
 249562162     gbcon138.seq
 249997670     gbcon139.seq
 249545221     gbcon14.seq
 249998133     gbcon140.seq
 154468358     gbcon141.seq
 249997581     gbcon142.seq
 249492030     gbcon143.seq
 246625249     gbcon144.seq
 244014257     gbcon145.seq
 249999386     gbcon146.seq
 249915891     gbcon147.seq
 249994136     gbcon148.seq
  93611727     gbcon149.seq
 245562324     gbcon15.seq
 249999281     gbcon150.seq
 249963874     gbcon151.seq
 249042783     gbcon152.seq
 249997571     gbcon153.seq
 249996807     gbcon154.seq
 249959296     gbcon155.seq
 248534647     gbcon156.seq
 249998868     gbcon157.seq
  77131005     gbcon158.seq
 249997889     gbcon159.seq
 236987056     gbcon16.seq
 249999098     gbcon160.seq
 249592774     gbcon161.seq
 249999051     gbcon162.seq
 146743115     gbcon163.seq
 249999163     gbcon164.seq
 249999421     gbcon165.seq
 249999050     gbcon166.seq
 249999409     gbcon167.seq
 249999628     gbcon168.seq
 249995238     gbcon169.seq
 249835219     gbcon17.seq
 249999438     gbcon170.seq
 249998047     gbcon171.seq
  61022730     gbcon172.seq
 249999124     gbcon173.seq
 249992786     gbcon174.seq
 249999222     gbcon175.seq
 249998010     gbcon176.seq
 201769902     gbcon177.seq
 249999463     gbcon178.seq
 249956957     gbcon179.seq
 248106534     gbcon18.seq
 249995060     gbcon180.seq
 249092209     gbcon181.seq
 249930092     gbcon182.seq
 249997515     gbcon183.seq
 249936271     gbcon184.seq
 249912674     gbcon185.seq
 249999407     gbcon186.seq
 227916706     gbcon187.seq
 249997182     gbcon188.seq
 249996972     gbcon189.seq
 249694964     gbcon19.seq
 249999527     gbcon190.seq
 249999824     gbcon191.seq
 249931877     gbcon192.seq
 249997527     gbcon193.seq
  29949353     gbcon194.seq
 249998551     gbcon195.seq
 249998712     gbcon196.seq
 249584381     gbcon197.seq
 249848618     gbcon198.seq
 242270029     gbcon199.seq
 249756523     gbcon2.seq
 248148397     gbcon20.seq
 249999877     gbcon200.seq
 249999542     gbcon201.seq
 249997449     gbcon202.seq
 250000178     gbcon203.seq
 249998044     gbcon204.seq
 250000061     gbcon205.seq
 249913169     gbcon206.seq
 249999226     gbcon207.seq
 117912925     gbcon208.seq
 249999259     gbcon209.seq
 249997341     gbcon21.seq
 249999298     gbcon210.seq
 249996283     gbcon211.seq
 249998745     gbcon212.seq
 205607173     gbcon213.seq
 249996001     gbcon214.seq
 249998524     gbcon215.seq
 249999955     gbcon216.seq
 249998250     gbcon217.seq
 163866121     gbcon218.seq
 250000103     gbcon219.seq
  70934036     gbcon22.seq
 249997454     gbcon220.seq
 249999723     gbcon221.seq
 249411124     gbcon222.seq
 249998596     gbcon223.seq
 246517634     gbcon224.seq
 249997413     gbcon225.seq
 249998485     gbcon226.seq
 249979520     gbcon227.seq
 249999840     gbcon228.seq
 249863777     gbcon229.seq
 249993008     gbcon23.seq
 249997171     gbcon230.seq
 185748651     gbcon231.seq
 249998617     gbcon232.seq
 249995784     gbcon233.seq
 249998545     gbcon234.seq
 249998150     gbcon235.seq
 221900223     gbcon236.seq
 249998954     gbcon237.seq
 249999862     gbcon238.seq
 249999109     gbcon239.seq
 249999110     gbcon24.seq
 249997810     gbcon240.seq
 167370136     gbcon241.seq
 249998975     gbcon242.seq
 249999342     gbcon243.seq
 249993886     gbcon244.seq
 249983608     gbcon245.seq
 249997216     gbcon246.seq
 220202367     gbcon247.seq
 249996817     gbcon248.seq
 249233155     gbcon249.seq
 249998996     gbcon25.seq
 249893352     gbcon250.seq
 249996028     gbcon251.seq
 249992079     gbcon252.seq
 249993023     gbcon253.seq
 249993912     gbcon254.seq
 249999812     gbcon255.seq
  21621150     gbcon256.seq
 249997790     gbcon257.seq
 249998872     gbcon258.seq
 249949308     gbcon259.seq
 249997358     gbcon26.seq
 249998934     gbcon260.seq
 249995591     gbcon261.seq
 126794597     gbcon262.seq
 249998331     gbcon263.seq
 249874563     gbcon264.seq
 249946469     gbcon265.seq
 250000032     gbcon266.seq
 249990184     gbcon267.seq
 249998893     gbcon268.seq
 183890652     gbcon269.seq
 250000240     gbcon27.seq
 249999962     gbcon270.seq
 249996982     gbcon271.seq
 249987851     gbcon272.seq
 249998390     gbcon273.seq
 249998892     gbcon274.seq
 249999650     gbcon275.seq
 249999897     gbcon276.seq
  25046915     gbcon277.seq
 249993984     gbcon278.seq
 249975639     gbcon279.seq
 249999627     gbcon28.seq
 250000185     gbcon280.seq
 249992295     gbcon281.seq
 249998813     gbcon282.seq
 118248972     gbcon283.seq
 249999438     gbcon284.seq
 249996270     gbcon285.seq
 249997984     gbcon286.seq
 249815715     gbcon287.seq
 249995029     gbcon288.seq
 130300787     gbcon289.seq
  91646555     gbcon29.seq
 249998557     gbcon290.seq
 249953364     gbcon291.seq
 249999371     gbcon292.seq
 250000228     gbcon293.seq
 249876840     gbcon294.seq
 117414877     gbcon295.seq
 249994666     gbcon296.seq
 249994930     gbcon297.seq
 249988364     gbcon298.seq
 249958199     gbcon299.seq
 249659590     gbcon3.seq
 249998086     gbcon30.seq
 250000175     gbcon300.seq
 249999400     gbcon301.seq
 138724832     gbcon302.seq
 249405562     gbcon303.seq
 249984475     gbcon304.seq
 249853249     gbcon305.seq
 249999926     gbcon306.seq
 249999458     gbcon307.seq
 249978925     gbcon308.seq
 249999122     gbcon309.seq
 249999757     gbcon31.seq
 250000081     gbcon310.seq
 109973492     gbcon311.seq
 249673753     gbcon312.seq
 249998484     gbcon313.seq
 249984935     gbcon314.seq
 249982194     gbcon315.seq
 249936581     gbcon316.seq
 249999142     gbcon317.seq
  86605058     gbcon318.seq
 249996332     gbcon319.seq
 249999739     gbcon32.seq
 249998103     gbcon320.seq
 249999600     gbcon321.seq
 249999582     gbcon322.seq
 249998680     gbcon323.seq
 249948534     gbcon324.seq
 249998730     gbcon325.seq
 249998178     gbcon326.seq
  77091952     gbcon327.seq
 249999793     gbcon328.seq
 249998403     gbcon329.seq
 249999316     gbcon33.seq
 249989845     gbcon330.seq
 249993695     gbcon331.seq
 249945178     gbcon332.seq
  62403785     gbcon333.seq
 249998896     gbcon334.seq
 249998688     gbcon335.seq
 249997681     gbcon336.seq
 249676377     gbcon337.seq
 249998864     gbcon338.seq
 249455726     gbcon339.seq
 244852771     gbcon34.seq
 249037650     gbcon340.seq
 152674783     gbcon341.seq
 250000009     gbcon342.seq
 249999657     gbcon343.seq
 249999310     gbcon344.seq
 249998557     gbcon345.seq
  42833441     gbcon346.seq
 249998287     gbcon347.seq
 249999132     gbcon348.seq
 249987566     gbcon349.seq
 249988451     gbcon35.seq
 249995355     gbcon350.seq
 249998168     gbcon351.seq
 249922681     gbcon352.seq
 250000205     gbcon353.seq
 250000062     gbcon354.seq
 250000021     gbcon355.seq
   4549194     gbcon356.seq
    206491     gbcon357.seq
 249993782     gbcon36.seq
  22972596     gbcon37.seq
 249997702     gbcon38.seq
 248806791     gbcon39.seq
 249665937     gbcon4.seq
 133502566     gbcon40.seq
 129847485     gbcon41.seq
 249996964     gbcon42.seq
 248492228     gbcon43.seq
 249996793     gbcon44.seq
 249998711     gbcon45.seq
 125645945     gbcon46.seq
 249998408     gbcon47.seq
 249999994     gbcon48.seq
 249998690     gbcon49.seq
 249998590     gbcon5.seq
 249999465     gbcon50.seq
 249970462     gbcon51.seq
 215825824     gbcon52.seq
 249995573     gbcon53.seq
 249996408     gbcon54.seq
 249994120     gbcon55.seq
 249994952     gbcon56.seq
 249998384     gbcon57.seq
 249996413     gbcon58.seq
  73437195     gbcon59.seq
 249881726     gbcon6.seq
 249998712     gbcon60.seq
 249998158     gbcon61.seq
 249996631     gbcon62.seq
 249998184     gbcon63.seq
 249997010     gbcon64.seq
  53203903     gbcon65.seq
 249995129     gbcon66.seq
 249997080     gbcon67.seq
 249999244     gbcon68.seq
 249997768     gbcon69.seq
 199375157     gbcon7.seq
 249999302     gbcon70.seq
  46505761     gbcon71.seq
 249997479     gbcon72.seq
 250000123     gbcon73.seq
 249999337     gbcon74.seq
 249997135     gbcon75.seq
 249996958     gbcon76.seq
 163671197     gbcon77.seq
 249996154     gbcon78.seq
 250000031     gbcon79.seq
 249993350     gbcon8.seq
 249995010     gbcon80.seq
 249997630     gbcon81.seq
 194598585     gbcon82.seq
 249997650     gbcon83.seq
 249997746     gbcon84.seq
 249995972     gbcon85.seq
 249996499     gbcon86.seq
 249998163     gbcon87.seq
   7197220     gbcon88.seq
 249996246     gbcon89.seq
 246642676     gbcon9.seq
 249997498     gbcon90.seq
 249996448     gbcon91.seq
 249998072     gbcon92.seq
 249997897     gbcon93.seq
 108419384     gbcon94.seq
 249999177     gbcon95.seq
 250000223     gbcon96.seq
 249994923     gbcon97.seq
 249998335     gbcon98.seq
 249999420     gbcon99.seq
    177516     gbdel.txt
 249999288     gbenv1.seq
 249998825     gbenv10.seq
 250000011     gbenv11.seq
 249998514     gbenv12.seq
  60884423     gbenv13.seq
 249998883     gbenv14.seq
 249998908     gbenv15.seq
 249998242     gbenv16.seq
 249998868     gbenv17.seq
 249997851     gbenv18.seq
 249998788     gbenv19.seq
 249999963     gbenv2.seq
 249999735     gbenv20.seq
 249998323     gbenv21.seq
   8239748     gbenv22.seq
 249999497     gbenv23.seq
 249998908     gbenv24.seq
 249999579     gbenv25.seq
 249999134     gbenv26.seq
 182410265     gbenv27.seq
 249998698     gbenv28.seq
 249996656     gbenv29.seq
 250000185     gbenv3.seq
 250000171     gbenv30.seq
 249999701     gbenv31.seq
 249998345     gbenv32.seq
 249999243     gbenv33.seq
  73643127     gbenv34.seq
 249999624     gbenv35.seq
 249998437     gbenv36.seq
 249998870     gbenv37.seq
 249997082     gbenv38.seq
 187922870     gbenv39.seq
 249997848     gbenv4.seq
 249998988     gbenv40.seq
 250000090     gbenv41.seq
 249997752     gbenv42.seq
 249996479     gbenv43.seq
 249997778     gbenv44.seq
 249997640     gbenv45.seq
  54659643     gbenv46.seq
 250000171     gbenv47.seq
 250000242     gbenv48.seq
 249999819     gbenv49.seq
 244237274     gbenv5.seq
 249999903     gbenv50.seq
 199521080     gbenv51.seq
 249999671     gbenv52.seq
 249999817     gbenv53.seq
 249999144     gbenv54.seq
 249999932     gbenv55.seq
 249998055     gbenv56.seq
  89518585     gbenv57.seq
 249999193     gbenv58.seq
 249998732     gbenv59.seq
 249998680     gbenv6.seq
 249999637     gbenv60.seq
 249998557     gbenv61.seq
 249999905     gbenv62.seq
 221769450     gbenv63.seq
 249998242     gbenv64.seq
 249998008     gbenv65.seq
 249999841     gbenv66.seq
 249996803     gbenv67.seq
 249996580     gbenv68.seq
  93205584     gbenv69.seq
 250000015     gbenv7.seq
 249997968     gbenv70.seq
 249999999     gbenv71.seq
 249999391     gbenv72.seq
 250000058     gbenv73.seq
 249999137     gbenv74.seq
 154132598     gbenv75.seq
 249998433     gbenv76.seq
 249998172     gbenv77.seq
 249997788     gbenv78.seq
 249999921     gbenv79.seq
 169352261     gbenv8.seq
 249998049     gbenv80.seq
  98380929     gbenv81.seq
 249998404     gbenv82.seq
 249998322     gbenv83.seq
 249998774     gbenv84.seq
 249999574     gbenv85.seq
 193590077     gbenv86.seq
 249997939     gbenv87.seq
 249999744     gbenv88.seq
 249998394     gbenv89.seq
 249998175     gbenv9.seq
 249999890     gbenv90.seq
 249998202     gbenv91.seq
 250000072     gbenv92.seq
 249998085     gbenv93.seq
  92617012     gbenv94.seq
 524289610     gbest1.seq
 524291732     gbest10.seq
 524289081     gbest100.seq
 524291315     gbest101.seq
 524289364     gbest102.seq
 524290598     gbest103.seq
 351987771     gbest104.seq
 524291441     gbest105.seq
 524290817     gbest106.seq
 524289728     gbest107.seq
 382655422     gbest108.seq
 386099419     gbest109.seq
 524290799     gbest11.seq
 379997094     gbest110.seq
 380732844     gbest111.seq
 377637454     gbest112.seq
 381814445     gbest113.seq
 386019645     gbest114.seq
 385194800     gbest115.seq
 384028559     gbest116.seq
 380337472     gbest117.seq
 403509258     gbest118.seq
 482056114     gbest119.seq
 524290855     gbest12.seq
 524290513     gbest120.seq
 524291433     gbest121.seq
 524289815     gbest122.seq
 524290471     gbest123.seq
 474154755     gbest124.seq
 524290456     gbest125.seq
 524290466     gbest126.seq
 524290575     gbest127.seq
 524290269     gbest128.seq
 524289017     gbest129.seq
 146304798     gbest13.seq
 524289685     gbest130.seq
 524289504     gbest131.seq
 524289020     gbest132.seq
 524291485     gbest133.seq
 524288739     gbest134.seq
 524289251     gbest135.seq
 524290167     gbest136.seq
 290134472     gbest137.seq
 524290195     gbest138.seq
 524292163     gbest139.seq
 524289335     gbest14.seq
 524289605     gbest140.seq
 524292245     gbest141.seq
 524291856     gbest142.seq
 524289346     gbest143.seq
 524289012     gbest144.seq
 524288962     gbest145.seq
 524289591     gbest146.seq
 524289526     gbest147.seq
 524292379     gbest148.seq
 524291782     gbest149.seq
 524288868     gbest15.seq
 524288889     gbest150.seq
 469757125     gbest151.seq
 524289152     gbest152.seq
 524289615     gbest153.seq
 524292070     gbest154.seq
 524290439     gbest155.seq
 524289709     gbest156.seq
 524290083     gbest157.seq
 524290094     gbest158.seq
 524289142     gbest159.seq
 524290363     gbest16.seq
 524290957     gbest160.seq
 524292554     gbest161.seq
 524288938     gbest162.seq
 524290212     gbest163.seq
 239259394     gbest164.seq
 524290748     gbest165.seq
 524290497     gbest166.seq
 524290433     gbest167.seq
 524290726     gbest168.seq
 524289580     gbest169.seq
 524291161     gbest17.seq
 524291626     gbest170.seq
 524290736     gbest171.seq
 524292239     gbest172.seq
 524290152     gbest173.seq
 524290717     gbest174.seq
 524289271     gbest175.seq
 524289787     gbest176.seq
 524290296     gbest177.seq
  92324332     gbest178.seq
 524288887     gbest179.seq
 524290440     gbest18.seq
 524290228     gbest180.seq
 524290198     gbest181.seq
 524290734     gbest182.seq
 524289961     gbest183.seq
 524288889     gbest184.seq
 524290405     gbest185.seq
 524289707     gbest186.seq
 524290732     gbest187.seq
 524289653     gbest188.seq
 524290052     gbest189.seq
 524291025     gbest19.seq
 524289435     gbest190.seq
 458870547     gbest191.seq
 524292666     gbest192.seq
 524289282     gbest193.seq
 524292147     gbest194.seq
 524290087     gbest195.seq
 524289700     gbest196.seq
 524288922     gbest197.seq
 524289132     gbest198.seq
 524289249     gbest199.seq
 524289133     gbest2.seq
 524289305     gbest20.seq
 524289450     gbest200.seq
 524291745     gbest201.seq
 524291407     gbest202.seq
 524291629     gbest203.seq
 524288816     gbest204.seq
  40866745     gbest205.seq
 524289967     gbest206.seq
 524290340     gbest207.seq
 524289842     gbest208.seq
 524290955     gbest209.seq
 524289452     gbest21.seq
 524288769     gbest210.seq
 524290730     gbest211.seq
 524289420     gbest212.seq
 524290488     gbest213.seq
 524289628     gbest214.seq
 524289006     gbest215.seq
 473785303     gbest216.seq
 524289582     gbest217.seq
 524290596     gbest218.seq
 524290945     gbest219.seq
 492357904     gbest22.seq
 524290968     gbest220.seq
 524289041     gbest221.seq
 524289139     gbest222.seq
 524290470     gbest223.seq
 524291883     gbest224.seq
 524291586     gbest225.seq
 524289727     gbest226.seq
 524290543     gbest227.seq
 524289443     gbest228.seq
 462565387     gbest229.seq
 491395782     gbest23.seq
 524290004     gbest230.seq
 524292405     gbest231.seq
 524289574     gbest232.seq
 524290812     gbest233.seq
 524291140     gbest234.seq
 524290794     gbest235.seq
 524291106     gbest236.seq
 524290640     gbest237.seq
 524291232     gbest238.seq
 524288967     gbest239.seq
 502307449     gbest24.seq
 524289623     gbest240.seq
 524291313     gbest241.seq
 524293018     gbest242.seq
 524289343     gbest243.seq
 248124297     gbest244.seq
 524289950     gbest245.seq
 524291251     gbest246.seq
 524290042     gbest247.seq
 524289119     gbest248.seq
 524288758     gbest249.seq
 326346690     gbest25.seq
 524290302     gbest250.seq
 524289237     gbest251.seq
 520302695     gbest252.seq
 524290730     gbest253.seq
 524289894     gbest254.seq
 524290392     gbest255.seq
 332774875     gbest256.seq
 524289056     gbest257.seq
 524289647     gbest258.seq
 524292114     gbest259.seq
 524290540     gbest26.seq
 524291792     gbest260.seq
 524290811     gbest261.seq
 524290149     gbest262.seq
 524289714     gbest263.seq
 524291725     gbest264.seq
 524290017     gbest265.seq
 524290660     gbest266.seq
 218560342     gbest267.seq
 524290284     gbest268.seq
 524290748     gbest269.seq
 524289076     gbest27.seq
 524290083     gbest270.seq
 524291838     gbest271.seq
 524289206     gbest272.seq
 524290845     gbest273.seq
 524288941     gbest274.seq
 524290462     gbest275.seq
 524291465     gbest276.seq
 524290379     gbest277.seq
 524290164     gbest278.seq
 371151250     gbest279.seq
 524290035     gbest28.seq
 524289925     gbest280.seq
 524289831     gbest281.seq
 524290299     gbest282.seq
 524289499     gbest283.seq
 524290479     gbest284.seq
 524289637     gbest285.seq
 524288736     gbest286.seq
 524291752     gbest287.seq
 524289609     gbest288.seq
 524290925     gbest289.seq
 524294034     gbest29.seq
 524290039     gbest290.seq
 289503538     gbest291.seq
 524290045     gbest292.seq
 524290958     gbest293.seq
 524290484     gbest294.seq
 524290633     gbest295.seq
 524290248     gbest296.seq
 524289363     gbest297.seq
 524288993     gbest298.seq
 524288782     gbest299.seq
 488091336     gbest3.seq
 524290592     gbest30.seq
 524289537     gbest300.seq
 524290436     gbest301.seq
 469660122     gbest302.seq
 324108190     gbest303.seq
 475497685     gbest304.seq
 472635332     gbest305.seq
 524290692     gbest306.seq
 524290399     gbest307.seq
 524291851     gbest308.seq
 524290057     gbest309.seq
 524289010     gbest31.seq
 524291072     gbest310.seq
 524290023     gbest311.seq
 524289142     gbest312.seq
 524291143     gbest313.seq
 524291706     gbest314.seq
 524291592     gbest315.seq
 378936144     gbest316.seq
 524291691     gbest317.seq
 524289933     gbest318.seq
 524289070     gbest319.seq
 524289199     gbest32.seq
 524289585     gbest320.seq
 524289265     gbest321.seq
 524290884     gbest322.seq
 524290944     gbest323.seq
 524289594     gbest324.seq
 524291612     gbest325.seq
 524290339     gbest326.seq
 524288821     gbest327.seq
 514167541     gbest328.seq
 517236091     gbest329.seq
 524290617     gbest33.seq
 231026806     gbest330.seq
 524289437     gbest331.seq
 524290232     gbest332.seq
 524292522     gbest333.seq
 524290762     gbest334.seq
 524289155     gbest335.seq
 524289760     gbest336.seq
 494708424     gbest337.seq
 524290826     gbest338.seq
 524292111     gbest339.seq
 509451147     gbest34.seq
 524290155     gbest340.seq
 524289115     gbest341.seq
 524289484     gbest342.seq
 524290519     gbest343.seq
 335801207     gbest344.seq
 524291314     gbest345.seq
 524290188     gbest346.seq
 524289186     gbest347.seq
 524291804     gbest348.seq
 524290107     gbest349.seq
 486412494     gbest35.seq
 524290536     gbest350.seq
 510770237     gbest351.seq
 524289099     gbest352.seq
 524294900     gbest353.seq
 524288940     gbest354.seq
 524288917     gbest355.seq
 524292631     gbest356.seq
 524288846     gbest357.seq
 524291963     gbest358.seq
 142941157     gbest359.seq
 488144371     gbest36.seq
 524288921     gbest360.seq
 524289667     gbest361.seq
 524288871     gbest362.seq
 524290055     gbest363.seq
 524289966     gbest364.seq
 524291627     gbest365.seq
 524290059     gbest366.seq
 524289007     gbest367.seq
 524289990     gbest368.seq
 524290242     gbest369.seq
 486961608     gbest37.seq
 524288810     gbest370.seq
  66532340     gbest371.seq
 524290157     gbest372.seq
 524291019     gbest373.seq
 524291159     gbest374.seq
 524290823     gbest375.seq
 524289557     gbest376.seq
 524290346     gbest377.seq
 492693989     gbest378.seq
 524289318     gbest379.seq
 481688002     gbest38.seq
 524288756     gbest380.seq
 524292104     gbest381.seq
 524291866     gbest382.seq
 265922078     gbest383.seq
 524290766     gbest384.seq
 524290948     gbest385.seq
 524289967     gbest386.seq
 524289636     gbest387.seq
 524288987     gbest388.seq
 524289078     gbest389.seq
 485612724     gbest39.seq
 524290393     gbest390.seq
 524291055     gbest391.seq
 524290362     gbest392.seq
 524292593     gbest393.seq
 206590699     gbest394.seq
 524289417     gbest395.seq
 524290058     gbest396.seq
 524289917     gbest397.seq
 524289370     gbest398.seq
 524289623     gbest399.seq
 524290360     gbest4.seq
 134655447     gbest40.seq
 524288841     gbest400.seq
 524289684     gbest401.seq
 524289736     gbest402.seq
 524291704     gbest403.seq
 524290440     gbest404.seq
 524290015     gbest405.seq
 524291269     gbest406.seq
 417165692     gbest407.seq
 524289968     gbest408.seq
 524289502     gbest409.seq
 524288883     gbest41.seq
 524290803     gbest410.seq
 524291778     gbest411.seq
 524291054     gbest412.seq
 524289176     gbest413.seq
 524290518     gbest414.seq
 524290193     gbest415.seq
 524291383     gbest416.seq
 524289491     gbest417.seq
 524289710     gbest418.seq
 524289620     gbest419.seq
 524162079     gbest42.seq
 524291937     gbest420.seq
   2301654     gbest421.seq
 524290686     gbest422.seq
 524289476     gbest423.seq
 524290429     gbest424.seq
 524290547     gbest425.seq
 524289455     gbest426.seq
 524293209     gbest427.seq
 524294155     gbest428.seq
 524292766     gbest429.seq
 524289370     gbest43.seq
 524294635     gbest430.seq
 524290067     gbest431.seq
 524290408     gbest432.seq
 524289354     gbest433.seq
 524289944     gbest434.seq
 524289258     gbest435.seq
 130902578     gbest436.seq
 524289709     gbest437.seq
 524290299     gbest438.seq
 524291079     gbest439.seq
 524290192     gbest44.seq
 524289297     gbest440.seq
 524290393     gbest441.seq
 524291147     gbest442.seq
 524290345     gbest443.seq
 524290419     gbest444.seq
 524291681     gbest445.seq
 524289996     gbest446.seq
 524289357     gbest447.seq
 524290891     gbest448.seq
 163043076     gbest449.seq
 524290345     gbest45.seq
 524289591     gbest450.seq
 524290621     gbest451.seq
 524290266     gbest452.seq
 524288766     gbest453.seq
 524290734     gbest454.seq
 524289900     gbest455.seq
 524290162     gbest456.seq
 524291108     gbest457.seq
 524290692     gbest458.seq
 524290695     gbest459.seq
 524289018     gbest46.seq
 482943530     gbest460.seq
 524291094     gbest461.seq
 524289163     gbest462.seq
 524289263     gbest463.seq
 524289354     gbest464.seq
 524290877     gbest465.seq
 524291840     gbest466.seq
 524290157     gbest467.seq
 524289596     gbest468.seq
 524288812     gbest469.seq
 524289264     gbest47.seq
 524291172     gbest470.seq
 524289335     gbest471.seq
 388279282     gbest472.seq
 524291474     gbest473.seq
 524291252     gbest474.seq
 524290054     gbest475.seq
 524288902     gbest476.seq
 524289659     gbest477.seq
 524289446     gbest478.seq
 524289493     gbest479.seq
 524290971     gbest48.seq
 524289915     gbest480.seq
 317590348     gbest481.seq
 524291869     gbest49.seq
 524291216     gbest5.seq
 524291985     gbest50.seq
 524290101     gbest51.seq
 524290542     gbest52.seq
 524289043     gbest53.seq
 236913169     gbest54.seq
 524290177     gbest55.seq
 524290969     gbest56.seq
 524289335     gbest57.seq
 524290477     gbest58.seq
 524289676     gbest59.seq
 524289922     gbest6.seq
 524289145     gbest60.seq
 524291725     gbest61.seq
 524291459     gbest62.seq
 524289162     gbest63.seq
 524289665     gbest64.seq
 524288816     gbest65.seq
 524290780     gbest66.seq
 446789006     gbest67.seq
 524288966     gbest68.seq
 524290244     gbest69.seq
 524289562     gbest7.seq
 524290980     gbest70.seq
 524289127     gbest71.seq
 524290075     gbest72.seq
 524288757     gbest73.seq
 524289322     gbest74.seq
 524292884     gbest75.seq
 524296864     gbest76.seq
 524290789     gbest77.seq
 524291849     gbest78.seq
 524292084     gbest79.seq
 524291692     gbest8.seq
 166200892     gbest80.seq
 524290023     gbest81.seq
 524290971     gbest82.seq
 524290269     gbest83.seq
 524290779     gbest84.seq
 524290617     gbest85.seq
 524291688     gbest86.seq
 524289823     gbest87.seq
 524292461     gbest88.seq
 524289484     gbest89.seq
 524290308     gbest9.seq
 524289557     gbest90.seq
 524291711     gbest91.seq
 447847255     gbest92.seq
 524291742     gbest93.seq
 524290738     gbest94.seq
 524290251     gbest95.seq
 524289700     gbest96.seq
 524290553     gbest97.seq
 524289944     gbest98.seq
 524290982     gbest99.seq
 524289587     gbgss1.seq
 524290500     gbgss10.seq
 524289254     gbgss100.seq
 524291942     gbgss101.seq
 524292263     gbgss102.seq
 524289515     gbgss103.seq
 416309963     gbgss104.seq
 524291750     gbgss105.seq
 524290573     gbgss106.seq
 524290089     gbgss107.seq
 524288810     gbgss108.seq
 524291185     gbgss109.seq
 524289284     gbgss11.seq
 524288961     gbgss110.seq
 524290007     gbgss111.seq
 524289239     gbgss112.seq
 524290752     gbgss113.seq
 524288726     gbgss114.seq
 524290806     gbgss115.seq
  51474765     gbgss116.seq
 524289419     gbgss117.seq
 524289457     gbgss118.seq
 524289853     gbgss119.seq
 524292328     gbgss12.seq
 524288824     gbgss120.seq
 524290967     gbgss121.seq
 524290649     gbgss122.seq
 524289095     gbgss123.seq
 524290448     gbgss124.seq
 524289588     gbgss125.seq
 524291821     gbgss126.seq
 524292539     gbgss127.seq
 524288774     gbgss128.seq
 198255718     gbgss129.seq
 524292285     gbgss13.seq
 524289462     gbgss130.seq
 524289011     gbgss131.seq
 524290462     gbgss132.seq
 524290721     gbgss133.seq
 524289833     gbgss134.seq
 524289865     gbgss135.seq
 524289563     gbgss136.seq
 524289136     gbgss137.seq
 524289328     gbgss138.seq
 506004286     gbgss139.seq
 524292177     gbgss14.seq
 498420394     gbgss140.seq
 179574002     gbgss141.seq
 524289563     gbgss142.seq
 524290105     gbgss143.seq
 524288725     gbgss144.seq
 524289456     gbgss145.seq
 524289055     gbgss146.seq
 524289089     gbgss147.seq
 524290996     gbgss148.seq
 524289844     gbgss149.seq
 524290702     gbgss15.seq
 524289981     gbgss150.seq
 524291116     gbgss151.seq
 327428451     gbgss152.seq
 524289503     gbgss153.seq
 524291231     gbgss154.seq
 524292658     gbgss155.seq
 524288988     gbgss156.seq
 524290530     gbgss157.seq
 524291062     gbgss158.seq
 524291090     gbgss159.seq
 524291024     gbgss16.seq
 524289253     gbgss160.seq
 524290853     gbgss161.seq
 524290380     gbgss162.seq
 524290657     gbgss163.seq
 524291645     gbgss164.seq
 129497132     gbgss165.seq
 524290110     gbgss166.seq
 524290613     gbgss167.seq
 524290430     gbgss168.seq
 524288955     gbgss169.seq
 524289161     gbgss17.seq
 524290896     gbgss170.seq
 524290022     gbgss171.seq
 524289097     gbgss172.seq
 417822281     gbgss173.seq
 249998457     gbgss174.seq
 249997727     gbgss175.seq
 249998129     gbgss176.seq
 249997964     gbgss177.seq
  31810345     gbgss178.seq
 249997137     gbgss179.seq
 524289979     gbgss18.seq
 250000033     gbgss180.seq
 249998542     gbgss181.seq
 249998168     gbgss182.seq
 224919493     gbgss183.seq
 249998415     gbgss184.seq
 249999205     gbgss185.seq
 249999508     gbgss186.seq
 250000175     gbgss187.seq
 193957356     gbgss188.seq
 249997950     gbgss189.seq
 302707718     gbgss19.seq
 249998694     gbgss190.seq
 249998786     gbgss191.seq
 249999485     gbgss192.seq
 249997276     gbgss193.seq
  71085900     gbgss194.seq
 249999828     gbgss195.seq
   2112081     gbgss196.seq
  80349448     gbgss197.seq
 249999264     gbgss198.seq
 249998529     gbgss199.seq
 524290458     gbgss2.seq
 524289779     gbgss20.seq
  87602941     gbgss200.seq
 249999685     gbgss201.seq
 249998355     gbgss202.seq
 250000242     gbgss203.seq
 202974017     gbgss204.seq
 249999232     gbgss205.seq
 249999415     gbgss206.seq
 249999535     gbgss207.seq
 246297144     gbgss208.seq
 249997836     gbgss209.seq
 524290010     gbgss21.seq
 249999647     gbgss210.seq
 249998223     gbgss211.seq
 244710946     gbgss212.seq
 249999336     gbgss213.seq
 249996623     gbgss214.seq
 249999794     gbgss215.seq
 249996718     gbgss216.seq
 126591595     gbgss217.seq
 249997387     gbgss218.seq
 249997998     gbgss219.seq
 524289712     gbgss22.seq
 249999931     gbgss220.seq
 249998615     gbgss221.seq
  92409107     gbgss222.seq
 249999742     gbgss223.seq
 249999443     gbgss224.seq
 249998584     gbgss225.seq
 249998226     gbgss226.seq
 249999180     gbgss227.seq
 143902147     gbgss228.seq
 249997846     gbgss229.seq
 524291691     gbgss23.seq
 249999124     gbgss230.seq
 249997821     gbgss231.seq
 249997789     gbgss232.seq
  84917634     gbgss233.seq
 249999461     gbgss234.seq
 249999350     gbgss235.seq
 249998406     gbgss236.seq
 249998619     gbgss237.seq
 249999398     gbgss238.seq
 249998013     gbgss239.seq
 524290555     gbgss24.seq
 108071868     gbgss240.seq
 249999266     gbgss241.seq
 249999352     gbgss242.seq
 249999943     gbgss243.seq
  56997815     gbgss244.seq
  53334267     gbgss245.seq
 249999101     gbgss246.seq
 249999225     gbgss247.seq
 249999246     gbgss248.seq
 250000245     gbgss249.seq
 524289673     gbgss25.seq
 249999181     gbgss250.seq
 249997776     gbgss251.seq
 212341896     gbgss252.seq
 249999617     gbgss253.seq
 250000113     gbgss254.seq
 249997380     gbgss255.seq
 249999823     gbgss256.seq
  27507329     gbgss257.seq
 249997661     gbgss258.seq
 249999221     gbgss259.seq
 524290090     gbgss26.seq
 249996455     gbgss260.seq
 249997767     gbgss261.seq
 249999776     gbgss262.seq
 249999649     gbgss263.seq
 191301715     gbgss264.seq
 249998299     gbgss265.seq
 249999964     gbgss266.seq
 249999490     gbgss267.seq
 227730674     gbgss268.seq
 249998576     gbgss269.seq
 524291868     gbgss27.seq
 249998098     gbgss270.seq
 249998682     gbgss271.seq
 249996687     gbgss272.seq
 249997377     gbgss273.seq
 249998886     gbgss274.seq
 133882428     gbgss275.seq
 249999342     gbgss276.seq
 249998535     gbgss277.seq
 249997745     gbgss278.seq
 249998494     gbgss279.seq
 524290601     gbgss28.seq
 232359855     gbgss280.seq
 249997371     gbgss281.seq
 249997691     gbgss282.seq
 249997807     gbgss283.seq
 249996653     gbgss284.seq
 249998033     gbgss285.seq
 122000632     gbgss286.seq
 249999562     gbgss287.seq
 249998752     gbgss288.seq
 249999600     gbgss289.seq
 524289057     gbgss29.seq
 249999029     gbgss290.seq
 221982324     gbgss291.seq
 249999829     gbgss292.seq
 250000049     gbgss293.seq
 249999422     gbgss294.seq
 249998101     gbgss295.seq
  91611181     gbgss296.seq
 249998405     gbgss297.seq
 250000147     gbgss298.seq
 249999022     gbgss299.seq
 524288872     gbgss3.seq
 524289261     gbgss30.seq
 249998978     gbgss300.seq
 249999348     gbgss301.seq
 249998553     gbgss302.seq
 140417596     gbgss303.seq
  60088870     gbgss31.seq
 524290519     gbgss32.seq
 524289255     gbgss33.seq
 524288764     gbgss34.seq
 524290929     gbgss35.seq
 524290668     gbgss36.seq
 524289417     gbgss37.seq
 524290533     gbgss38.seq
 498950926     gbgss39.seq
 524291733     gbgss4.seq
 524289920     gbgss40.seq
 524291096     gbgss41.seq
 524288965     gbgss42.seq
  38920338     gbgss43.seq
 524289606     gbgss44.seq
 524289441     gbgss45.seq
 524289594     gbgss46.seq
 524289715     gbgss47.seq
 226129352     gbgss48.seq
 524289088     gbgss49.seq
 160046964     gbgss5.seq
 524291855     gbgss50.seq
 524289535     gbgss51.seq
 524290785     gbgss52.seq
 524290960     gbgss53.seq
 524290649     gbgss54.seq
 524289409     gbgss55.seq
 524291133     gbgss56.seq
 524290180     gbgss57.seq
 524289422     gbgss58.seq
 524289302     gbgss59.seq
 524290099     gbgss6.seq
  46483248     gbgss60.seq
 524290642     gbgss61.seq
 524289281     gbgss62.seq
 524291599     gbgss63.seq
 460094581     gbgss64.seq
 524289159     gbgss65.seq
 524291915     gbgss66.seq
 524290170     gbgss67.seq
 524289081     gbgss68.seq
 524289672     gbgss69.seq
 524290240     gbgss7.seq
 524289903     gbgss70.seq
 524289804     gbgss71.seq
 524290046     gbgss72.seq
 524291512     gbgss73.seq
 524290086     gbgss74.seq
 524291561     gbgss75.seq
 524289493     gbgss76.seq
  49439493     gbgss77.seq
 524291041     gbgss78.seq
 524291423     gbgss79.seq
 524289887     gbgss8.seq
 524291807     gbgss80.seq
 524288987     gbgss81.seq
 524291141     gbgss82.seq
 524291031     gbgss83.seq
 524291274     gbgss84.seq
 524290623     gbgss85.seq
 524289899     gbgss86.seq
 524290720     gbgss87.seq
 524291087     gbgss88.seq
 386608837     gbgss89.seq
 524290677     gbgss9.seq
 524292344     gbgss90.seq
 524292444     gbgss91.seq
 524289266     gbgss92.seq
 524292472     gbgss93.seq
 524290689     gbgss94.seq
 524292079     gbgss95.seq
 524289433     gbgss96.seq
 524290383     gbgss97.seq
 524292130     gbgss98.seq
 524291272     gbgss99.seq
 249989596     gbhtc1.seq
 249999739     gbhtc10.seq
 249998354     gbhtc11.seq
 114138144     gbhtc12.seq
 250000092     gbhtc13.seq
 249998913     gbhtc14.seq
 146585639     gbhtc15.seq
 249995319     gbhtc2.seq
 249993906     gbhtc3.seq
 249998396     gbhtc4.seq
 249989366     gbhtc5.seq
 249989186     gbhtc6.seq
 249996567     gbhtc7.seq
  85908087     gbhtc8.seq
 249998301     gbhtc9.seq
 249935589     gbhtg1.seq
 249953451     gbhtg10.seq
 249912439     gbhtg100.seq
 249866482     gbhtg101.seq
 249548804     gbhtg102.seq
 249905568     gbhtg103.seq
   3688468     gbhtg104.seq
 249815335     gbhtg105.seq
 249888148     gbhtg106.seq
 249851229     gbhtg107.seq
 249907584     gbhtg108.seq
 249989197     gbhtg109.seq
    799345     gbhtg11.seq
 249789219     gbhtg110.seq
 167859406     gbhtg111.seq
 249871484     gbhtg112.seq
 249961061     gbhtg113.seq
 249891820     gbhtg114.seq
 249930745     gbhtg115.seq
 249804783     gbhtg116.seq
 249885242     gbhtg117.seq
 249996057     gbhtg118.seq
 219373320     gbhtg119.seq
 249887872     gbhtg12.seq
 249852224     gbhtg120.seq
 249901917     gbhtg121.seq
 249988304     gbhtg122.seq
 249907211     gbhtg123.seq
 249918797     gbhtg124.seq
 249974119     gbhtg125.seq
 249870359     gbhtg126.seq
 249931510     gbhtg127.seq
 249827706     gbhtg128.seq
 249926259     gbhtg129.seq
 249967619     gbhtg13.seq
 249980450     gbhtg130.seq
    526931     gbhtg131.seq
 249979004     gbhtg132.seq
 249792568     gbhtg133.seq
 246328157     gbhtg134.seq
 249729843     gbhtg135.seq
 249950564     gbhtg136.seq
 141393711     gbhtg137.seq
 249860825     gbhtg138.seq
 249838305     gbhtg139.seq
 249584228     gbhtg14.seq
 249821150     gbhtg140.seq
 249911276     gbhtg141.seq
 249828373     gbhtg142.seq
 134515756     gbhtg143.seq
 249956990     gbhtg144.seq
 249814020     gbhtg145.seq
 249834009     gbhtg146.seq
 249921180     gbhtg147.seq
 249883288     gbhtg148.seq
 249904988     gbhtg149.seq
 249771919     gbhtg15.seq
 249880993     gbhtg150.seq
 249906014     gbhtg151.seq
 249928839     gbhtg152.seq
 249933812     gbhtg153.seq
 229136057     gbhtg154.seq
 249738514     gbhtg16.seq
 249165958     gbhtg17.seq
 249980023     gbhtg18.seq
 249676824     gbhtg19.seq
 249996522     gbhtg2.seq
 249986149     gbhtg20.seq
 237141818     gbhtg21.seq
 249756771     gbhtg22.seq
 249864682     gbhtg23.seq
 249983387     gbhtg24.seq
 249917977     gbhtg25.seq
 249757014     gbhtg26.seq
 249887744     gbhtg27.seq
 249957955     gbhtg28.seq
 249838343     gbhtg29.seq
 249996216     gbhtg3.seq
 249989516     gbhtg30.seq
 225321862     gbhtg31.seq
 249823624     gbhtg32.seq
 249917494     gbhtg33.seq
 249925313     gbhtg34.seq
 249914652     gbhtg35.seq
 249854042     gbhtg36.seq
 249811834     gbhtg37.seq
 249764454     gbhtg38.seq
 249623490     gbhtg39.seq
 249972436     gbhtg4.seq
 249836303     gbhtg40.seq
 224358179     gbhtg41.seq
 249873953     gbhtg42.seq
 249782842     gbhtg43.seq
 249972744     gbhtg44.seq
 249775813     gbhtg45.seq
 249969730     gbhtg46.seq
 249708936     gbhtg47.seq
 249863648     gbhtg48.seq
 249890163     gbhtg49.seq
 249908832     gbhtg5.seq
 249900107     gbhtg50.seq
 234820301     gbhtg51.seq
 249734905     gbhtg52.seq
 249972831     gbhtg53.seq
 249785177     gbhtg54.seq
 249720551     gbhtg55.seq
 249959801     gbhtg56.seq
  18795879     gbhtg57.seq
 249860951     gbhtg58.seq
 249828685     gbhtg59.seq
 249992589     gbhtg6.seq
 249998409     gbhtg60.seq
 249924871     gbhtg61.seq
 225131281     gbhtg62.seq
 249885321     gbhtg63.seq
 249908283     gbhtg64.seq
 249801379     gbhtg65.seq
 249764001     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249985806     gbhtg69.seq
 249808286     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249769227     gbhtg72.seq
 223428522     gbhtg73.seq
 249948289     gbhtg74.seq
 249890381     gbhtg75.seq
 249852564     gbhtg76.seq
 249954375     gbhtg77.seq
 235178036     gbhtg78.seq
 249882417     gbhtg79.seq
 249827100     gbhtg8.seq
 249980280     gbhtg80.seq
 249869955     gbhtg81.seq
 249894840     gbhtg82.seq
 202300570     gbhtg83.seq
 249873886     gbhtg84.seq
 249951229     gbhtg85.seq
 249869625     gbhtg86.seq
 249889142     gbhtg87.seq
 206020594     gbhtg88.seq
 249893096     gbhtg89.seq
 249952756     gbhtg9.seq
 249878126     gbhtg90.seq
 249782466     gbhtg91.seq
 249893923     gbhtg92.seq
 194413602     gbhtg93.seq
 249975890     gbhtg94.seq
 249987330     gbhtg95.seq
 249876035     gbhtg96.seq
 249800612     gbhtg97.seq
 161659006     gbhtg98.seq
 249873981     gbhtg99.seq
 249999688     gbinv1.seq
 249075874     gbinv10.seq
 249997555     gbinv100.seq
 249997832     gbinv101.seq
  80271449     gbinv102.seq
 249955085     gbinv103.seq
 249996849     gbinv104.seq
 249991952     gbinv105.seq
 249976130     gbinv106.seq
 249999980     gbinv107.seq
 249983498     gbinv108.seq
 249996598     gbinv109.seq
 248749950     gbinv11.seq
  89129686     gbinv110.seq
 249973375     gbinv111.seq
 249899693     gbinv112.seq
 249979396     gbinv113.seq
 249998795     gbinv114.seq
 249994232     gbinv115.seq
 249966582     gbinv116.seq
 249983747     gbinv117.seq
 249995961     gbinv118.seq
 249994417     gbinv119.seq
 249998501     gbinv12.seq
 151414969     gbinv120.seq
 249999545     gbinv121.seq
 249995664     gbinv122.seq
 249998338     gbinv123.seq
 249793471     gbinv124.seq
 249981535     gbinv125.seq
 249997903     gbinv126.seq
 243824572     gbinv127.seq
  52925611     gbinv128.seq
 249973860     gbinv129.seq
 249999705     gbinv13.seq
 249946261     gbinv130.seq
 249988320     gbinv131.seq
 249993992     gbinv132.seq
  28355116     gbinv133.seq
 250000131     gbinv134.seq
 249997724     gbinv135.seq
  59918656     gbinv136.seq
 249998579     gbinv137.seq
 249973278     gbinv138.seq
 249995075     gbinv139.seq
 102426238     gbinv14.seq
 249994925     gbinv140.seq
 148119999     gbinv141.seq
 249995603     gbinv142.seq
 249999045     gbinv143.seq
 249999297     gbinv144.seq
 249999642     gbinv145.seq
 249998443     gbinv146.seq
 249999508     gbinv147.seq
 249998498     gbinv148.seq
 249655194     gbinv149.seq
 249999004     gbinv15.seq
 247587031     gbinv150.seq
 226842850     gbinv151.seq
 249998402     gbinv16.seq
 249989881     gbinv17.seq
 166034514     gbinv18.seq
 249517628     gbinv19.seq
 249969455     gbinv2.seq
 247715986     gbinv20.seq
 249998499     gbinv21.seq
 249999683     gbinv22.seq
 249996352     gbinv23.seq
   2010123     gbinv24.seq
 230363724     gbinv25.seq
 175506967     gbinv26.seq
 249998982     gbinv27.seq
 249997747     gbinv28.seq
 227810370     gbinv29.seq
 249825266     gbinv3.seq
 249998100     gbinv30.seq
 249998450     gbinv31.seq
 249999223     gbinv32.seq
 249996837     gbinv33.seq
 183922730     gbinv34.seq
 249997341     gbinv35.seq
 249975665     gbinv36.seq
 249998754     gbinv37.seq
 249997660     gbinv38.seq
 187498202     gbinv39.seq
 205080681     gbinv4.seq
 249997047     gbinv40.seq
 249997206     gbinv41.seq
 249997733     gbinv42.seq
 249995794     gbinv43.seq
 118920309     gbinv44.seq
 250000071     gbinv45.seq
 249999707     gbinv46.seq
 249998670     gbinv47.seq
 249999471     gbinv48.seq
  95619268     gbinv49.seq
 249997894     gbinv5.seq
 249999833     gbinv50.seq
 249999442     gbinv51.seq
 249998751     gbinv52.seq
 249999188     gbinv53.seq
  98270846     gbinv54.seq
 249999400     gbinv55.seq
 249999558     gbinv56.seq
 249997401     gbinv57.seq
 250000069     gbinv58.seq
 249999228     gbinv59.seq
 249996901     gbinv6.seq
 250000153     gbinv60.seq
 200628052     gbinv61.seq
 249996070     gbinv62.seq
 250000157     gbinv63.seq
 249996695     gbinv64.seq
 249998998     gbinv65.seq
 249995043     gbinv66.seq
 162299642     gbinv67.seq
 249999790     gbinv68.seq
 250000189     gbinv69.seq
 249998024     gbinv7.seq
 250000091     gbinv70.seq
 201580572     gbinv71.seq
 249926462     gbinv72.seq
 249971937     gbinv73.seq
 247889588     gbinv74.seq
 249920717     gbinv75.seq
 249921421     gbinv76.seq
 249871878     gbinv77.seq
 249897317     gbinv78.seq
 221036085     gbinv79.seq
 234313404     gbinv8.seq
 249997947     gbinv80.seq
 249993437     gbinv81.seq
 249995495     gbinv82.seq
 249997709     gbinv83.seq
  51747128     gbinv84.seq
 249996142     gbinv85.seq
 249961763     gbinv86.seq
 249996526     gbinv87.seq
 249990785     gbinv88.seq
 249983105     gbinv89.seq
 249999527     gbinv9.seq
 249977710     gbinv90.seq
 249994985     gbinv91.seq
 249998590     gbinv92.seq
 249999068     gbinv93.seq
 224842193     gbinv94.seq
 249976996     gbinv95.seq
 249991734     gbinv96.seq
 249996378     gbinv97.seq
 249999578     gbinv98.seq
 249996455     gbinv99.seq
 249757871     gbmam1.seq
 338653945     gbmam10.seq
 315434421     gbmam11.seq
 162425861     gbmam12.seq
 150157348     gbmam13.seq
 159032552     gbmam14.seq
 136269244     gbmam15.seq
 122412969     gbmam16.seq
 248159424     gbmam17.seq
 202955099     gbmam18.seq
 208310894     gbmam19.seq
 249996442     gbmam2.seq
 209752374     gbmam20.seq
 197940571     gbmam21.seq
 230561883     gbmam22.seq
 220222486     gbmam23.seq
 123191148     gbmam24.seq
 191446547     gbmam25.seq
   9946563     gbmam26.seq
  43996573     gbmam27.seq
  91328397     gbmam28.seq
  88836150     gbmam29.seq
  85272907     gbmam3.seq
   6429575     gbmam30.seq
  21179271     gbmam31.seq
 249999881     gbmam32.seq
 202999823     gbmam33.seq
 250000107     gbmam34.seq
 249998349     gbmam35.seq
 249999872     gbmam36.seq
 206071766     gbmam37.seq
 249999596     gbmam38.seq
   2310103     gbmam39.seq
  83814876     gbmam4.seq
  71963309     gbmam5.seq
  22758099     gbmam6.seq
   1275077     gbmam7.seq
   2480909     gbmam8.seq
 375834671     gbmam9.seq
  25603810     gbnew.txt
 249999430     gbpat1.seq
 249999595     gbpat10.seq
 249999052     gbpat100.seq
 249998996     gbpat101.seq
 249999065     gbpat102.seq
 249999793     gbpat103.seq
 149112469     gbpat104.seq
 249999880     gbpat105.seq
 249998929     gbpat106.seq
 249928220     gbpat107.seq
 249824879     gbpat108.seq
 249998856     gbpat109.seq
 179859554     gbpat11.seq
 192956310     gbpat110.seq
 250000176     gbpat111.seq
 249999701     gbpat112.seq
 249997438     gbpat113.seq
  80215112     gbpat114.seq
 249999543     gbpat115.seq
 249999744     gbpat116.seq
 249765161     gbpat117.seq
 250000129     gbpat118.seq
 249999583     gbpat119.seq
 249995807     gbpat12.seq
  67188949     gbpat120.seq
 249998923     gbpat121.seq
 250000184     gbpat122.seq
 249999601     gbpat123.seq
 249999810     gbpat124.seq
 160252740     gbpat125.seq
 249999692     gbpat126.seq
 250000171     gbpat127.seq
 234780519     gbpat128.seq
 249991536     gbpat129.seq
 249998394     gbpat13.seq
 249970935     gbpat130.seq
 249999745     gbpat131.seq
 249999400     gbpat132.seq
 249994345     gbpat133.seq
  66832984     gbpat134.seq
 249992315     gbpat135.seq
 249999844     gbpat136.seq
 250000121     gbpat137.seq
 250000131     gbpat138.seq
 249999522     gbpat139.seq
 249999363     gbpat14.seq
  18435141     gbpat140.seq
 249999655     gbpat141.seq
 249998828     gbpat142.seq
 249999803     gbpat143.seq
 249999630     gbpat144.seq
  46945926     gbpat145.seq
 250000154     gbpat146.seq
 249998813     gbpat147.seq
 249998963     gbpat148.seq
 234578566     gbpat149.seq
 249995968     gbpat15.seq
 249999721     gbpat150.seq
 249999524     gbpat151.seq
 249999965     gbpat152.seq
  86839732     gbpat153.seq
 249999922     gbpat154.seq
 249998225     gbpat155.seq
 249999596     gbpat156.seq
  63844747     gbpat157.seq
 249997276     gbpat158.seq
 249997274     gbpat159.seq
 249999811     gbpat16.seq
 250000148     gbpat160.seq
 250000002     gbpat161.seq
 249999151     gbpat162.seq
 249998087     gbpat163.seq
 224199249     gbpat164.seq
 250000249     gbpat165.seq
 249999893     gbpat166.seq
 249999893     gbpat167.seq
 220539897     gbpat168.seq
 249999753     gbpat169.seq
  75613376     gbpat17.seq
 249999692     gbpat170.seq
 249999849     gbpat171.seq
  12451761     gbpat172.seq
 249950756     gbpat173.seq
 249998305     gbpat174.seq
 249999769     gbpat175.seq
 249998096     gbpat176.seq
  91698903     gbpat177.seq
 249999432     gbpat178.seq
 249999105     gbpat179.seq
 250000027     gbpat18.seq
 249998633     gbpat180.seq
 250000180     gbpat181.seq
   9115252     gbpat182.seq
 249999856     gbpat183.seq
 249999183     gbpat184.seq
 249999616     gbpat185.seq
 174952464     gbpat186.seq
 250000222     gbpat187.seq
 249995822     gbpat188.seq
 250000136     gbpat189.seq
 249999209     gbpat19.seq
 250000015     gbpat190.seq
  76767668     gbpat191.seq
 250000158     gbpat192.seq
 249987422     gbpat193.seq
 249999879     gbpat194.seq
 249996128     gbpat195.seq
 250000208     gbpat196.seq
 133308680     gbpat197.seq
 249998522     gbpat198.seq
 249997437     gbpat199.seq
 249994776     gbpat2.seq
 249999254     gbpat20.seq
 249999828     gbpat200.seq
 249997655     gbpat201.seq
 214703546     gbpat202.seq
 249999447     gbpat203.seq
 249208684     gbpat204.seq
 249997718     gbpat205.seq
 249999328     gbpat206.seq
 181207302     gbpat207.seq
 249548891     gbpat208.seq
 248510527     gbpat209.seq
 249996860     gbpat21.seq
 249998856     gbpat210.seq
 249999197     gbpat211.seq
 249922461     gbpat212.seq
 249999663     gbpat213.seq
  18031394     gbpat214.seq
 249998780     gbpat215.seq
 249997619     gbpat216.seq
 249998753     gbpat217.seq
 120256565     gbpat218.seq
 249998872     gbpat219.seq
 186230892     gbpat22.seq
 249997519     gbpat220.seq
 249999821     gbpat221.seq
 249999636     gbpat222.seq
 250000243     gbpat223.seq
 250000141     gbpat224.seq
 249999918     gbpat225.seq
 249999327     gbpat226.seq
  71832070     gbpat227.seq
 249999586     gbpat228.seq
 249999857     gbpat229.seq
 249999488     gbpat23.seq
 249999739     gbpat230.seq
 249999806     gbpat231.seq
 226268143     gbpat232.seq
 250000085     gbpat233.seq
 249999873     gbpat234.seq
 249997892     gbpat235.seq
 249999398     gbpat236.seq
  66984100     gbpat237.seq
 249998376     gbpat238.seq
 249998497     gbpat239.seq
 249823606     gbpat24.seq
 249995413     gbpat240.seq
 249996474     gbpat241.seq
 249997032     gbpat242.seq
 244578909     gbpat243.seq
 250000189     gbpat244.seq
 249999754     gbpat245.seq
 249999370     gbpat246.seq
 249999530     gbpat247.seq
  35678388     gbpat248.seq
 249999354     gbpat249.seq
 249999457     gbpat25.seq
 249994095     gbpat250.seq
 249999700     gbpat251.seq
 144872604     gbpat252.seq
 249706968     gbpat253.seq
 249999719     gbpat254.seq
 250000099     gbpat255.seq
  74014219     gbpat256.seq
 250000099     gbpat257.seq
 249999910     gbpat258.seq
 249999430     gbpat259.seq
 250000154     gbpat26.seq
 159281365     gbpat260.seq
 249998972     gbpat261.seq
 249953945     gbpat262.seq
 249999044     gbpat263.seq
 249999694     gbpat264.seq
 249995490     gbpat265.seq
 249995229     gbpat266.seq
  36010217     gbpat267.seq
 249999184     gbpat268.seq
 249996815     gbpat269.seq
  71839519     gbpat27.seq
 249997460     gbpat270.seq
 249999421     gbpat271.seq
 249998740     gbpat272.seq
 249998824     gbpat273.seq
  85906496     gbpat274.seq
 250000104     gbpat275.seq
 250000196     gbpat276.seq
 242183377     gbpat277.seq
 249999562     gbpat278.seq
 249999538     gbpat279.seq
 249999941     gbpat28.seq
 151089557     gbpat280.seq
 249998671     gbpat29.seq
 249999364     gbpat3.seq
 249999543     gbpat30.seq
 249998761     gbpat31.seq
 249998297     gbpat32.seq
 180416699     gbpat33.seq
 249998547     gbpat34.seq
 250000160     gbpat35.seq
 249999165     gbpat36.seq
 249999832     gbpat37.seq
 249999798     gbpat38.seq
 249999593     gbpat39.seq
 249998815     gbpat4.seq
 249838669     gbpat40.seq
 103949722     gbpat41.seq
 249999570     gbpat42.seq
 249969971     gbpat43.seq
 249999802     gbpat44.seq
 249999935     gbpat45.seq
 249996613     gbpat46.seq
 249935781     gbpat47.seq
 249999788     gbpat48.seq
 249999988     gbpat49.seq
  71663145     gbpat5.seq
 172110320     gbpat50.seq
 249997865     gbpat51.seq
 249999740     gbpat52.seq
 250000064     gbpat53.seq
 250000038     gbpat54.seq
 222935237     gbpat55.seq
 249999057     gbpat56.seq
 249999847     gbpat57.seq
 249999517     gbpat58.seq
 164755079     gbpat59.seq
 249998966     gbpat6.seq
 249911691     gbpat60.seq
 249997724     gbpat61.seq
 249999079     gbpat62.seq
 249998663     gbpat63.seq
 135956977     gbpat64.seq
 249999820     gbpat65.seq
 249998123     gbpat66.seq
 249996994     gbpat67.seq
 249998077     gbpat68.seq
 250000144     gbpat69.seq
 249999678     gbpat7.seq
 249999645     gbpat70.seq
 144901242     gbpat71.seq
 250000118     gbpat72.seq
 249999899     gbpat73.seq
 249998837     gbpat74.seq
 244400769     gbpat75.seq
 248968857     gbpat76.seq
 244458666     gbpat77.seq
 247877948     gbpat78.seq
 249999444     gbpat79.seq
 249991940     gbpat8.seq
 160632775     gbpat80.seq
 250000121     gbpat81.seq
 249999657     gbpat82.seq
 249999470     gbpat83.seq
 249999644     gbpat84.seq
 249996193     gbpat85.seq
 250000133     gbpat86.seq
  99350813     gbpat87.seq
 249157111     gbpat88.seq
 249998889     gbpat89.seq
 249999748     gbpat9.seq
 249999517     gbpat90.seq
 249999384     gbpat91.seq
 249999113     gbpat92.seq
 249999495     gbpat93.seq
 145308021     gbpat94.seq
 249999725     gbpat95.seq
 249998956     gbpat96.seq
 249999939     gbpat97.seq
 250000257     gbpat98.seq
 196973298     gbpat99.seq
 249999999     gbphg1.seq
 249826247     gbphg2.seq
 229521332     gbphg3.seq
 250000214     gbpln1.seq
 157135137     gbpln10.seq
 249999441     gbpln100.seq
 249998546     gbpln101.seq
 249999357     gbpln102.seq
  26522140     gbpln103.seq
 249997438     gbpln104.seq
 249994134     gbpln105.seq
 249999652     gbpln106.seq
 249996899     gbpln107.seq
  91582244     gbpln108.seq
 249999324     gbpln109.seq
 249996084     gbpln11.seq
 249474964     gbpln110.seq
 249998235     gbpln111.seq
 212662867     gbpln112.seq
 249999026     gbpln113.seq
 249997867     gbpln114.seq
 249999726     gbpln115.seq
 159006490     gbpln116.seq
 249880843     gbpln117.seq
 249994534     gbpln118.seq
 249998782     gbpln119.seq
 250000034     gbpln12.seq
 117741315     gbpln120.seq
 249998898     gbpln121.seq
 249999467     gbpln122.seq
 249997258     gbpln123.seq
 108800278     gbpln124.seq
 249999631     gbpln125.seq
 249997215     gbpln126.seq
 210753164     gbpln127.seq
 249025851     gbpln128.seq
 244142704     gbpln129.seq
 249995474     gbpln13.seq
 248572612     gbpln130.seq
 249999570     gbpln131.seq
 219472505     gbpln132.seq
 224206397     gbpln133.seq
 219408421     gbpln134.seq
 236598217     gbpln135.seq
 246204564     gbpln136.seq
 219499544     gbpln137.seq
 249976597     gbpln14.seq
 230978404     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
  20516461     gbpln19.seq
 250000208     gbpln2.seq
 242162427     gbpln20.seq
 249961170     gbpln21.seq
 248513124     gbpln22.seq
 249475018     gbpln23.seq
 235958414     gbpln24.seq
 232335792     gbpln25.seq
 233137901     gbpln26.seq
 235733976     gbpln27.seq
 199441006     gbpln28.seq
 195827791     gbpln29.seq
 249951295     gbpln3.seq
 249998513     gbpln30.seq
  98639627     gbpln31.seq
 249997393     gbpln32.seq
 136531002     gbpln33.seq
 206764402     gbpln34.seq
  85568779     gbpln35.seq
 193636853     gbpln36.seq
 225480575     gbpln37.seq
 242182266     gbpln38.seq
 249139593     gbpln39.seq
 248426652     gbpln4.seq
 249954292     gbpln40.seq
 249616496     gbpln41.seq
 248897172     gbpln42.seq
 151532914     gbpln43.seq
 249166356     gbpln44.seq
 249979188     gbpln45.seq
 249603032     gbpln46.seq
 248521786     gbpln47.seq
 249707687     gbpln48.seq
 248905881     gbpln49.seq
 249986583     gbpln5.seq
 249819331     gbpln50.seq
 249645264     gbpln51.seq
 248751388     gbpln52.seq
 231745280     gbpln53.seq
 232196221     gbpln54.seq
 248189908     gbpln55.seq
 249936863     gbpln56.seq
  54217712     gbpln57.seq
  40095425     gbpln58.seq
  75057058     gbpln59.seq
 249892998     gbpln6.seq
 249998698     gbpln60.seq
 249998304     gbpln61.seq
 249999930     gbpln62.seq
 113817285     gbpln63.seq
 249998326     gbpln64.seq
 249999839     gbpln65.seq
 249998573     gbpln66.seq
 249999245     gbpln67.seq
 150080963     gbpln68.seq
 249999057     gbpln69.seq
 249920344     gbpln7.seq
 250000046     gbpln70.seq
 249998425     gbpln71.seq
 249554055     gbpln72.seq
 246484184     gbpln73.seq
 249983049     gbpln74.seq
 249998841     gbpln75.seq
  49761193     gbpln76.seq
 249999196     gbpln77.seq
  50210775     gbpln78.seq
 212767647     gbpln79.seq
 249941394     gbpln8.seq
 249162585     gbpln80.seq
 187074600     gbpln81.seq
 997560866     gbpln82.seq
  56478630     gbpln83.seq
 215691664     gbpln84.seq
 171793674     gbpln85.seq
 197391160     gbpln86.seq
 177950644     gbpln87.seq
 196456279     gbpln88.seq
 189037066     gbpln89.seq
 249991186     gbpln9.seq
 220764647     gbpln90.seq
 227204520     gbpln91.seq
 224027197     gbpln92.seq
 248372246     gbpln93.seq
 189073767     gbpln94.seq
 249996625     gbpln95.seq
 249999802     gbpln96.seq
  62988613     gbpln97.seq
 250000103     gbpln98.seq
 249997251     gbpln99.seq
 149042483     gbpri1.seq
 249857188     gbpri10.seq
 144959826     gbpri11.seq
 249963263     gbpri12.seq
 249890704     gbpri13.seq
 249896089     gbpri14.seq
 249946723     gbpri15.seq
 249866001     gbpri16.seq
 249867628     gbpri17.seq
 249757996     gbpri18.seq
 249922745     gbpri19.seq
 249876636     gbpri2.seq
 249959015     gbpri20.seq
 249969459     gbpri21.seq
 249684154     gbpri22.seq
 249996838     gbpri23.seq
  61510057     gbpri24.seq
 163835241     gbpri25.seq
 249994943     gbpri26.seq
 247489911     gbpri27.seq
 249970709     gbpri28.seq
 249937746     gbpri29.seq
 249757213     gbpri3.seq
 249764453     gbpri30.seq
 249993115     gbpri31.seq
 249885937     gbpri32.seq
 249972226     gbpri33.seq
 249965632     gbpri34.seq
 249923998     gbpri35.seq
  23041389     gbpri36.seq
 249995315     gbpri37.seq
 250000024     gbpri38.seq
 249504909     gbpri39.seq
 249867318     gbpri4.seq
 249997026     gbpri40.seq
 249998791     gbpri41.seq
 201729991     gbpri42.seq
 249997540     gbpri43.seq
 249969416     gbpri44.seq
 249985161     gbpri45.seq
 249999337     gbpri46.seq
 133104448     gbpri47.seq
 249939471     gbpri48.seq
 249973497     gbpri49.seq
 249991969     gbpri5.seq
 218469902     gbpri50.seq
 314294187     gbpri51.seq
 258775309     gbpri52.seq
 268666448     gbpri53.seq
 249998603     gbpri54.seq
 176219297     gbpri55.seq
 249940062     gbpri6.seq
 249942075     gbpri7.seq
 249914573     gbpri8.seq
 249778445     gbpri9.seq
    453970     gbrel.txt
 249736541     gbrod1.seq
 249986924     gbrod10.seq
  82229266     gbrod11.seq
 249871281     gbrod12.seq
 249783723     gbrod13.seq
 249992850     gbrod14.seq
 249651610     gbrod15.seq
 249953745     gbrod16.seq
 249885180     gbrod17.seq
 249943440     gbrod18.seq
 249924259     gbrod19.seq
 249725876     gbrod2.seq
 249817986     gbrod20.seq
 249843909     gbrod21.seq
 204885340     gbrod22.seq
 249999282     gbrod23.seq
 249999445     gbrod24.seq
 249907194     gbrod25.seq
 249983854     gbrod26.seq
 249999492     gbrod27.seq
 249996676     gbrod28.seq
 249997987     gbrod29.seq
 249898431     gbrod3.seq
 199128361     gbrod30.seq
 249927365     gbrod4.seq
 249959287     gbrod5.seq
 249786740     gbrod6.seq
 249903605     gbrod7.seq
 249796022     gbrod8.seq
 249978578     gbrod9.seq
 249998946     gbsts1.seq
 249997905     gbsts10.seq
 210966786     gbsts11.seq
 249996524     gbsts12.seq
 250000181     gbsts13.seq
 249998420     gbsts14.seq
 249999696     gbsts15.seq
  26045416     gbsts16.seq
 250000234     gbsts17.seq
 249999379     gbsts18.seq
 250000050     gbsts19.seq
 249999407     gbsts2.seq
 187846972     gbsts20.seq
 249999577     gbsts3.seq
 249998356     gbsts4.seq
  42334415     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249997315     gbsts9.seq
 249995209     gbsyn1.seq
 249996488     gbsyn2.seq
 249980353     gbsyn3.seq
 249951244     gbsyn4.seq
 249965375     gbsyn5.seq
 249972256     gbsyn6.seq
 249999331     gbsyn7.seq
 249996309     gbsyn8.seq
  85952225     gbsyn9.seq
 249998789     gbtsa1.seq
  56875503     gbtsa10.seq
 249999189     gbtsa100.seq
 249999433     gbtsa101.seq
 249996526     gbtsa102.seq
 249998542     gbtsa103.seq
 107894053     gbtsa104.seq
 249999743     gbtsa105.seq
 249999340     gbtsa106.seq
 250000193     gbtsa107.seq
 249997708     gbtsa108.seq
 249999597     gbtsa109.seq
 249996711     gbtsa11.seq
 249998574     gbtsa110.seq
 228581442     gbtsa111.seq
 249998448     gbtsa112.seq
 249998116     gbtsa113.seq
 249999828     gbtsa114.seq
 249999325     gbtsa115.seq
 249994026     gbtsa116.seq
  16579382     gbtsa117.seq
 249998403     gbtsa118.seq
 249999879     gbtsa119.seq
 249996983     gbtsa12.seq
 249998407     gbtsa120.seq
 220818721     gbtsa121.seq
 249996276     gbtsa122.seq
 249998492     gbtsa123.seq
 249994958     gbtsa124.seq
 249998709     gbtsa125.seq
 249999528     gbtsa126.seq
 249998038     gbtsa127.seq
 173017184     gbtsa128.seq
 249999326     gbtsa129.seq
 249993453     gbtsa13.seq
 249997095     gbtsa130.seq
 249998452     gbtsa131.seq
 249997998     gbtsa132.seq
 249999141     gbtsa133.seq
 249999792     gbtsa134.seq
   8254827     gbtsa135.seq
 249999027     gbtsa136.seq
 249999626     gbtsa137.seq
 249999337     gbtsa138.seq
 249997377     gbtsa139.seq
 249998857     gbtsa14.seq
 136260650     gbtsa140.seq
 249998131     gbtsa141.seq
 249999514     gbtsa142.seq
 249997541     gbtsa143.seq
 249997718     gbtsa144.seq
  35878567     gbtsa145.seq
 249999033     gbtsa146.seq
 249996430     gbtsa147.seq
 249999407     gbtsa148.seq
 249999070     gbtsa149.seq
 212107370     gbtsa15.seq
 249998280     gbtsa150.seq
 249998961     gbtsa151.seq
 249997929     gbtsa152.seq
 249999837     gbtsa153.seq
  56029904     gbtsa154.seq
 249997859     gbtsa155.seq
 249998020     gbtsa156.seq
 249999234     gbtsa157.seq
 249997993     gbtsa158.seq
 249998073     gbtsa159.seq
 249998665     gbtsa16.seq
 249999025     gbtsa160.seq
  88482532     gbtsa161.seq
 249999569     gbtsa162.seq
 249998179     gbtsa163.seq
 249997593     gbtsa164.seq
 133634227     gbtsa165.seq
 250000051     gbtsa166.seq
 249997064     gbtsa167.seq
 249996807     gbtsa168.seq
 249995565     gbtsa169.seq
 249997851     gbtsa17.seq
 249999016     gbtsa170.seq
 249999347     gbtsa171.seq
 212464283     gbtsa172.seq
 249999604     gbtsa173.seq
 250000062     gbtsa174.seq
 249998057     gbtsa175.seq
 249999289     gbtsa176.seq
 249999094     gbtsa177.seq
 249995474     gbtsa178.seq
 235671082     gbtsa179.seq
 249996669     gbtsa18.seq
 249996624     gbtsa180.seq
 249997321     gbtsa181.seq
 249995617     gbtsa182.seq
 249994262     gbtsa183.seq
 249997299     gbtsa184.seq
 249994810     gbtsa185.seq
 249996107     gbtsa186.seq
 158803373     gbtsa187.seq
 249998144     gbtsa188.seq
 249999142     gbtsa189.seq
 249996821     gbtsa19.seq
 249995468     gbtsa190.seq
 249995022     gbtsa191.seq
 249996263     gbtsa192.seq
 249997899     gbtsa193.seq
 249998569     gbtsa194.seq
 249996478     gbtsa195.seq
 137489684     gbtsa196.seq
 249996764     gbtsa197.seq
 249998199     gbtsa198.seq
 249998750     gbtsa199.seq
 249998838     gbtsa2.seq
 184645681     gbtsa20.seq
 249997310     gbtsa200.seq
  17504918     gbtsa201.seq
 249994885     gbtsa202.seq
 249999243     gbtsa203.seq
 249989561     gbtsa204.seq
 249997860     gbtsa205.seq
 249998286     gbtsa206.seq
 174688788     gbtsa207.seq
 249999300     gbtsa208.seq
 249997856     gbtsa209.seq
 249998729     gbtsa21.seq
 249996155     gbtsa210.seq
 249996918     gbtsa211.seq
 249994050     gbtsa212.seq
 249997510     gbtsa213.seq
 249998407     gbtsa214.seq
 186774487     gbtsa215.seq
 249996159     gbtsa216.seq
 249996376     gbtsa217.seq
 249998017     gbtsa218.seq
 250000184     gbtsa219.seq
 249995960     gbtsa22.seq
 250000235     gbtsa220.seq
 249998424     gbtsa221.seq
 209204781     gbtsa222.seq
 249999871     gbtsa223.seq
 249998426     gbtsa224.seq
 249995429     gbtsa225.seq
 249999230     gbtsa226.seq
 249998719     gbtsa227.seq
 249999680     gbtsa228.seq
 147516971     gbtsa229.seq
 249998664     gbtsa23.seq
 249999524     gbtsa24.seq
 141487016     gbtsa25.seq
 249998989     gbtsa26.seq
 249996697     gbtsa27.seq
 249999341     gbtsa28.seq
 249994104     gbtsa29.seq
 249998033     gbtsa3.seq
 249995742     gbtsa30.seq
  14687257     gbtsa31.seq
 249999462     gbtsa32.seq
 249997921     gbtsa33.seq
 250000061     gbtsa34.seq
 249999369     gbtsa35.seq
 249998248     gbtsa36.seq
 250000200     gbtsa37.seq
  77824344     gbtsa38.seq
 249998838     gbtsa39.seq
 249998666     gbtsa4.seq
 249998049     gbtsa40.seq
 249998745     gbtsa41.seq
 249998655     gbtsa42.seq
 249999730     gbtsa43.seq
 249998189     gbtsa44.seq
 249999047     gbtsa45.seq
  35519576     gbtsa46.seq
 249996819     gbtsa47.seq
 249998958     gbtsa48.seq
 249998918     gbtsa49.seq
 154448941     gbtsa5.seq
 249999945     gbtsa50.seq
  77219842     gbtsa51.seq
 249997780     gbtsa52.seq
 249998411     gbtsa53.seq
 249998803     gbtsa54.seq
 249998916     gbtsa55.seq
 159863234     gbtsa56.seq
 250000009     gbtsa57.seq
 249998760     gbtsa58.seq
 249999183     gbtsa59.seq
 249997875     gbtsa6.seq
 249998062     gbtsa60.seq
 249997264     gbtsa61.seq
 249999006     gbtsa62.seq
 249999666     gbtsa63.seq
 246318645     gbtsa64.seq
 249999875     gbtsa65.seq
 249998311     gbtsa66.seq
 249997772     gbtsa67.seq
 249998444     gbtsa68.seq
 249999791     gbtsa69.seq
 249998005     gbtsa7.seq
 249998667     gbtsa70.seq
 232817222     gbtsa71.seq
 249998934     gbtsa72.seq
 249999138     gbtsa73.seq
 249999425     gbtsa74.seq
 249999985     gbtsa75.seq
 249994548     gbtsa76.seq
 249998653     gbtsa77.seq
 184594960     gbtsa78.seq
 249999580     gbtsa79.seq
 249999806     gbtsa8.seq
 249999459     gbtsa80.seq
 250000060     gbtsa81.seq
 249998829     gbtsa82.seq
 249995363     gbtsa83.seq
 111806279     gbtsa84.seq
 249997659     gbtsa85.seq
 249998620     gbtsa86.seq
 249998734     gbtsa87.seq
 249992900     gbtsa88.seq
 249999666     gbtsa89.seq
 249999617     gbtsa9.seq
  45985876     gbtsa90.seq
 250000084     gbtsa91.seq
 249998916     gbtsa92.seq
 249999940     gbtsa93.seq
 249999226     gbtsa94.seq
 249998671     gbtsa95.seq
 150715089     gbtsa96.seq
 250000251     gbtsa97.seq
 250000245     gbtsa98.seq
 249999623     gbtsa99.seq
    792470     gbuna1.seq
 249997784     gbvrl1.seq
 249996009     gbvrl10.seq
 249997555     gbvrl11.seq
 249999685     gbvrl12.seq
 249999573     gbvrl13.seq
 221393145     gbvrl14.seq
 249994301     gbvrl15.seq
 249998876     gbvrl16.seq
 249996914     gbvrl17.seq
 249999219     gbvrl18.seq
 229147533     gbvrl19.seq
 249998306     gbvrl2.seq
 249996643     gbvrl20.seq
 249996155     gbvrl21.seq
 250000113     gbvrl22.seq
 249999693     gbvrl23.seq
 142809167     gbvrl24.seq
 249998342     gbvrl25.seq
 249994565     gbvrl26.seq
 249997728     gbvrl27.seq
 249998150     gbvrl28.seq
 249999427     gbvrl29.seq
 249999443     gbvrl3.seq
  73744450     gbvrl30.seq
 250000057     gbvrl31.seq
 249999554     gbvrl32.seq
 249998938     gbvrl33.seq
 249999148     gbvrl34.seq
 249999104     gbvrl35.seq
  28118326     gbvrl36.seq
 249999296     gbvrl37.seq
 249998038     gbvrl38.seq
 249993880     gbvrl39.seq
 249989310     gbvrl4.seq
 249999170     gbvrl40.seq
 249997788     gbvrl41.seq
 249998292     gbvrl42.seq
 250000085     gbvrl43.seq
 249998857     gbvrl44.seq
  94562002     gbvrl45.seq
 249998973     gbvrl5.seq
  87198443     gbvrl6.seq
 249999573     gbvrl7.seq
 249997153     gbvrl8.seq
 249999928     gbvrl9.seq
 249999288     gbvrt1.seq
 249965139     gbvrt10.seq
 249916550     gbvrt11.seq
 136966761     gbvrt12.seq
 249949016     gbvrt13.seq
 249984377     gbvrt14.seq
 249994295     gbvrt15.seq
 249999565     gbvrt16.seq
 249999822     gbvrt17.seq
 249999351     gbvrt18.seq
  62746369     gbvrt19.seq
 249977941     gbvrt2.seq
 249958094     gbvrt20.seq
 249997054     gbvrt21.seq
 249999175     gbvrt22.seq
 249998573     gbvrt23.seq
 250000133     gbvrt24.seq
 109465393     gbvrt25.seq
 249998116     gbvrt26.seq
 249997875     gbvrt27.seq
 249999331     gbvrt28.seq
 199377772     gbvrt29.seq
 249999528     gbvrt3.seq
 249997654     gbvrt30.seq
 249997448     gbvrt31.seq
  29635036     gbvrt32.seq
 249995681     gbvrt33.seq
 191126428     gbvrt34.seq
 249999350     gbvrt35.seq
 249998855     gbvrt36.seq
 249999599     gbvrt37.seq
  96618154     gbvrt38.seq
 249999633     gbvrt39.seq
 249910648     gbvrt4.seq
 249999821     gbvrt40.seq
  92664074     gbvrt41.seq
 249999978     gbvrt42.seq
 249997957     gbvrt43.seq
 249098295     gbvrt44.seq
 242289875     gbvrt45.seq
 244398238     gbvrt46.seq
 245488178     gbvrt47.seq
 247593771     gbvrt48.seq
 249343689     gbvrt49.seq
 227189312     gbvrt5.seq
 249621733     gbvrt50.seq
 225552490     gbvrt51.seq
 249999335     gbvrt52.seq
 180507423     gbvrt53.seq
 246330940     gbvrt54.seq
 227143105     gbvrt55.seq
 249608691     gbvrt56.seq
 234447524     gbvrt57.seq
 249647333     gbvrt58.seq
 249740040     gbvrt59.seq
 249997951     gbvrt6.seq
 249797253     gbvrt60.seq
 249954226     gbvrt61.seq
 248825435     gbvrt62.seq
 135741345     gbvrt63.seq
 249992976     gbvrt7.seq
 249966135     gbvrt8.seq
 249867361     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63560      86577176
BCT10        14157      87882687
BCT100       44         107663978
BCT101       42         105130602
BCT102       62         107795837
BCT103       45         109538241
BCT104       24         74562824
BCT105       29         106059433
BCT106       23         100309671
BCT107       22         102815068
BCT108       22         103205495
BCT109       22         103088812
BCT11        2360       103149777
BCT110       22         103089220
BCT111       21         99801199
BCT112       21         101640086
BCT113       23         106816508
BCT114       46         109374721
BCT115       38         105562991
BCT116       6          15890032
BCT117       50         111764861
BCT118       60         109369965
BCT119       59         112726237
BCT12        70         115123597
BCT120       67         111056909
BCT121       44         111343032
BCT122       50         114715155
BCT123       57         110894677
BCT124       21         103150112
BCT125       30         107463152
BCT126       27         60879521
BCT127       44         114144416
BCT128       48         114538095
BCT129       59         112456580
BCT13        111        116076156
BCT130       41         109996351
BCT131       54         117427897
BCT132       32         106713806
BCT133       37         114373689
BCT134       60         111676584
BCT135       42         108493296
BCT136       30         111357445
BCT137       38         122972246
BCT138       54         111404870
BCT139       40         78198029
BCT14        70         113372788
BCT140       78         113214393
BCT141       41         111328192
BCT142       55         115146018
BCT143       68         108015728
BCT144       67         113877639
BCT145       65         117202546
BCT146       35         80922404
BCT147       62         99560423
BCT148       43         103972342
BCT149       32         107488349
BCT15        53         115328609
BCT150       41         111210922
BCT151       71         110513133
BCT152       45         107188803
BCT153       57         107202141
BCT154       58         96341110
BCT155       49         108194911
BCT156       56         106920572
BCT157       45         108873568
BCT158       43         106160881
BCT159       48         106248773
BCT16        74         122556134
BCT160       42         112528530
BCT161       48         109991844
BCT162       38         109022587
BCT163       36         105879377
BCT164       46         108172969
BCT165       45         107097450
BCT166       41         109632785
BCT167       36         111174240
BCT168       12         28297617
BCT169       93         99698834
BCT17        41         116033349
BCT170       39         110882155
BCT171       53         110426095
BCT172       46         106404159
BCT173       47         111747951
BCT174       36         107982312
BCT175       37         108017807
BCT176       50         108478863
BCT177       58         108429110
BCT178       51         105445356
BCT179       73         107479895
BCT18        68         116609452
BCT180       41         105028538
BCT181       57         109209302
BCT182       46         107920730
BCT183       29         100621890
BCT184       55         110497145
BCT185       66         111332490
BCT186       54         107547560
BCT187       61         110556009
BCT188       33         108804903
BCT189       87         113375676
BCT19        67         116152748
BCT190       36         86964915
BCT191       69         109734529
BCT192       43         109558177
BCT193       41         109065226
BCT194       52         109551316
BCT195       63         105722279
BCT196       87         102463356
BCT197       47         106320436
BCT198       43         105838597
BCT199       51         109165477
BCT2         30556      98365131
BCT20        52         122022726
BCT200       50         105188855
BCT201       36         106191110
BCT202       64         104015340
BCT203       42         109878841
BCT204       41         106406619
BCT205       10         24900982
BCT206       61         111248814
BCT207       63         110387414
BCT208       58         107261955
BCT209       61         102223916
BCT21        16013      57646594
BCT210       72         106450585
BCT211       95         109091638
BCT212       32         102495275
BCT213       32         106135679
BCT214       40         94412965
BCT215       61         107059161
BCT216       56         104934033
BCT217       84         109867267
BCT218       34         106426054
BCT219       55         108976322
BCT22        53816      84836472
BCT220       59         114496955
BCT221       39         110517758
BCT222       45         110239722
BCT223       40         106337424
BCT224       50         109568003
BCT225       4          5147745
BCT226       62         107195452
BCT227       43         109045457
BCT228       51         108758915
BCT229       57         109387591
BCT23        79         109838518
BCT230       77         107381468
BCT231       58         107489812
BCT232       47         107572804
BCT233       34         105872090
BCT234       57         111653707
BCT235       49         108701421
BCT236       45         76471704
BCT237       54         103946884
BCT238       40         106567307
BCT239       39         106727376
BCT24        143        95924047
BCT240       38         105287007
BCT241       39         115243328
BCT242       48         104431805
BCT243       66         111395426
BCT244       48         106403115
BCT245       55         107937346
BCT246       51         107602390
BCT247       121        120235601
BCT248       52         36658571
BCT249       204        94545960
BCT25        58         112822895
BCT250       324        21043424
BCT251       1589       2511957
BCT252       3172       5268484
BCT253       6338       7796625
BCT254       12613      14997742
BCT255       25523      27672627
BCT256       50568      54082661
BCT257       75854      77880014
BCT258       71331      76779932
BCT259       10361      92220014
BCT26        53         111392505
BCT260       5305       94797455
BCT261       3323       102716216
BCT262       125        92772533
BCT263       39         103801273
BCT264       214        102743901
BCT265       6101       97980407
BCT266       22126      93813041
BCT267       21150      21746960
BCT268       71365      73591517
BCT269       3689       102660265
BCT27        46         112848420
BCT270       3947       100740033
BCT271       6493       97476157
BCT272       3883       98429990
BCT273       15707      101790611
BCT274       75034      78994063
BCT275       72775      78849700
BCT276       304        334072
BCT277       75560      78487909
BCT278       72055      77211621
BCT279       72704      74040488
BCT28        57         112994744
BCT280       12790      14741262
BCT281       70923      75332278
BCT282       72168      73787701
BCT283       20237      19244520
BCT284       66490      81159379
BCT285       46708      57969667
BCT286       62164      83223656
BCT287       10706      13796330
BCT288       21192      105772674
BCT289       3579       159679769
BCT29        66         108817610
BCT290       1171       170447602
BCT291       5710       100761657
BCT292       1864       110254173
BCT293       2523       93043718
BCT294       1746       108089358
BCT295       2180       117051249
BCT296       722        116643265
BCT297       974        115395877
BCT298       607        114099175
BCT299       22         115677746
BCT3         45         110044504
BCT30        36         96325907
BCT300       23         119465821
BCT301       23         119289220
BCT302       21         115843073
BCT303       258        125536995
BCT304       29442      89766965
BCT31        40         106881287
BCT32        59         107430269
BCT33        74         111675186
BCT34        55         110045255
BCT35        63         106845594
BCT36        55         109391464
BCT37        53         108650404
BCT38        46         110495229
BCT39        95         109522868
BCT4         59         112453622
BCT40        58         106383657
BCT41        67         109486091
BCT42        125        110095720
BCT43        37         71643089
BCT44        200        111474100
BCT45        54         111189650
BCT46        35         108859141
BCT47        59         107860764
BCT48        56         105257914
BCT49        45         109560296
BCT5         24105      103632157
BCT50        74         109517239
BCT51        63         108817997
BCT52        45         105399191
BCT53        59         110379618
BCT54        70         108888422
BCT55        77         109259381
BCT56        22         22714378
BCT57        67         109336234
BCT58        60         104664634
BCT59        53         102829098
BCT6         13432      19705197
BCT60        56         108908758
BCT61        58         105643854
BCT62        54         109754097
BCT63        72         109941269
BCT64        61         106056484
BCT65        70         111010690
BCT66        36         115917629
BCT67        79         110703954
BCT68        50         110061589
BCT69        61         113995855
BCT7         39658      80452231
BCT70        25         28242590
BCT71        43         109853786
BCT72        50         116699480
BCT73        66         111693041
BCT74        50         111467075
BCT75        53         109197672
BCT76        97         112945696
BCT77        73         112059377
BCT78        80         105609227
BCT79        61         114956262
BCT8         1992       59265649
BCT80        64         115718442
BCT81        53         114897025
BCT82        62         113769294
BCT83        47         110741363
BCT84        21         43870898
BCT85        48         118002347
BCT86        63         115290616
BCT87        248        115434499
BCT88        70         109982609
BCT89        297        115164977
BCT9         7656       93380719
BCT90        63         110836541
BCT91        68         108767418
BCT92        45         109031298
BCT93        61         108655373
BCT94        61         109296173
BCT95        4          12180716
BCT96        57         116195274
BCT97        61         106396448
BCT98        39         113384349
BCT99        59         111542017
ENV1         92455      71794008
ENV10        86259      70390679
ENV11        93077      72832984
ENV12        82353      86609106
ENV13        21807      18677444
ENV14        84753      80845029
ENV15        118347     43030065
ENV16        89134      77093524
ENV17        96415      67754774
ENV18        96026      63236181
ENV19        109652     66846864
ENV2         95826      68803987
ENV20        121936     64272996
ENV21        59519      80371281
ENV22        1966       2640131
ENV23        64036      80463296
ENV24        90219      75817372
ENV25        125172     39265447
ENV26        122785     28945687
ENV27        90671      20905805
ENV28        123097     49753756
ENV29        97826      67184945
ENV3         93787      67808991
ENV30        115025     56511972
ENV31        135879     52802977
ENV32        109145     60809369
ENV33        94636      64591453
ENV34        23317      22728738
ENV35        62536      84995133
ENV36        88722      73276073
ENV37        102896     44274222
ENV38        96867      56282212
ENV39        70673      54653611
ENV4         76089      80468280
ENV40        111227     47246119
ENV41        100821     61070221
ENV42        107049     61675535
ENV43        63690      90606074
ENV44        72539      78870352
ENV45        62024      84275221
ENV46        13559      18442338
ENV47        70511      78327058
ENV48        107795     49575769
ENV49        112481     56191673
ENV5         38917      97322672
ENV50        104687     61475064
ENV51        80593      42557578
ENV52        100598     44028435
ENV53        42863      53351174
ENV54        41971      54594999
ENV55        57499      57081274
ENV56        96504      61607869
ENV57        35104      19508135
ENV58        92149      66866589
ENV59        80785      71288245
ENV6         74154      86657717
ENV60        78506      67769679
ENV61        85961      69915959
ENV62        95754      60369056
ENV63        83263      53427946
ENV64        109664     46034771
ENV65        90166      60778487
ENV66        101124     51563263
ENV67        93854      57092838
ENV68        80584      73549648
ENV69        31798      24665539
ENV7         93277      80053285
ENV70        74047      82695949
ENV71        82786      51571559
ENV72        86261      59357801
ENV73        56654      76501819
ENV74        105225     32133153
ENV75        66763      16864405
ENV76        78504      74283267
ENV77        92043      57770082
ENV78        101486     59823510
ENV79        108153     39898355
ENV8         71537      41203227
ENV80        108226     37675032
ENV81        34316      24490760
ENV82        98816      54317835
ENV83        116351     29438791
ENV84        107389     41610358
ENV85        103822     49824079
ENV86        88763      34293426
ENV87        101692     49948367
ENV88        115045     49750581
ENV89        110106     53743548
ENV9         131421     31025284
ENV90        94043      54853944
ENV91        94339      57990335
ENV92        85387      42460378
ENV93        94115      64523866
ENV94        42433      16484252
EST1         159498     61801009
EST10        168027     72456392
EST100       233458     141786807
EST101       238402     125275700
EST102       190883     104629538
EST103       184966     102305345
EST104       101131     70451144
EST105       160792     120297681
EST106       174163     106396062
EST107       134720     84650800
EST108       63886      23757773
EST109       63358      22277286
EST11        169650     73888436
EST110       63850      23104651
EST111       63871      26893070
EST112       64361      22975223
EST113       64589      24557766
EST114       63579      27051032
EST115       63773      26189708
EST116       64047      27301897
EST117       63896      25162614
EST118       61257      33655518
EST119       122820     62533151
EST12        167839     70447410
EST120       160360     85610332
EST121       187637     92582051
EST122       148680     95604680
EST123       158549     93402429
EST124       131786     85745085
EST125       188279     90228463
EST126       157034     83530636
EST127       157238     84343601
EST128       156707     84843321
EST129       152203     85256800
EST13        68756      33337966
EST130       173769     93240865
EST131       183516     117048765
EST132       202869     102649053
EST133       159683     87283301
EST134       163004     83010951
EST135       142486     83649645
EST136       144808     89832453
EST137       98278      52069739
EST138       172653     97584761
EST139       244036     112746826
EST14        217468     108982070
EST140       155860     84003723
EST141       167358     92277331
EST142       151128     88613667
EST143       133456     81254170
EST144       154969     97375706
EST145       156617     85955892
EST146       124212     63278948
EST147       121182     65033215
EST148       127633     57947290
EST149       127054     51236349
EST15        169667     106000760
EST150       128438     51177791
EST151       115398     43034208
EST152       164021     82736970
EST153       176887     74089486
EST154       162720     110595936
EST155       199582     122326131
EST156       213395     121238984
EST157       175157     97093632
EST158       154459     108164137
EST159       142640     95240899
EST16        181577     113584922
EST160       155111     96480521
EST161       157935     82770262
EST162       139654     78575122
EST163       168591     93709518
EST164       69781      43385480
EST165       150728     92270715
EST166       192365     110546549
EST167       146102     84103376
EST168       142830     72420225
EST169       150308     87669007
EST17        196116     115752374
EST170       191240     104886778
EST171       156733     96078551
EST172       168074     82953671
EST173       126940     86624424
EST174       171171     100382591
EST175       173578     100462049
EST176       121328     67883552
EST177       158117     91085944
EST178       30429      17671689
EST179       170877     103282132
EST18        194432     120873590
EST180       181396     119581108
EST181       143703     116741571
EST182       194433     99359772
EST183       153314     103348882
EST184       154994     101639025
EST185       141187     81726760
EST186       176774     71786007
EST187       150843     84460134
EST188       157414     99900255
EST189       156882     96485853
EST19        157763     113163654
EST190       140870     84007030
EST191       159211     96167069
EST192       146889     94035515
EST193       131478     91560094
EST194       142716     87526263
EST195       137337     89554351
EST196       132644     93992974
EST197       163934     87295786
EST198       174728     96024227
EST199       174085     96902378
EST2         162335     61672666
EST20        189881     100191336
EST200       171959     96533746
EST201       169420     94935193
EST202       172386     95810908
EST203       174112     95379656
EST204       174590     96203151
EST205       13715      7287790
EST206       189437     105533524
EST207       205997     105137228
EST208       172529     102456415
EST209       180702     102076345
EST21        218523     107505098
EST210       202166     123332305
EST211       195654     112834237
EST212       195571     123993396
EST213       138746     93559594
EST214       215438     137233000
EST215       234829     121726538
EST216       161768     105738432
EST217       182463     100789792
EST218       202165     98900693
EST219       132730     95258673
EST22        190257     62068316
EST220       147700     87572434
EST221       210706     116133468
EST222       161782     105322337
EST223       103235     107484856
EST224       153219     103947931
EST225       159109     95526383
EST226       142936     103190574
EST227       224843     104406869
EST228       137205     101008152
EST229       121907     86615156
EST23        138909     39563081
EST230       137909     97920190
EST231       122791     87937821
EST232       143798     89706758
EST233       129917     88650339
EST234       140428     105165424
EST235       132055     93239368
EST236       124276     84110831
EST237       142740     88093086
EST238       156836     120919941
EST239       127067     119217054
EST24        102635     27788949
EST240       139414     103462656
EST241       174784     105992910
EST242       166976     103513194
EST243       154493     99305910
EST244       86506      49577540
EST245       166841     125575766
EST246       143649     106129807
EST247       155620     100204573
EST248       212179     97675955
EST249       187839     112259091
EST25        122481     51005395
EST250       153463     86105732
EST251       217803     27266302
EST252       220374     89765143
EST253       163467     120530764
EST254       175198     102659192
EST255       162382     107949006
EST256       113799     70900469
EST257       155433     113577957
EST258       184997     112292187
EST259       188990     97735164
EST26        214445     97482243
EST260       176329     110269238
EST261       162354     111850011
EST262       230843     108304983
EST263       276032     121267427
EST264       193074     115026654
EST265       187878     36299723
EST266       258549     125940000
EST267       65492      39728369
EST268       153173     97666231
EST269       166008     102205032
EST27        219438     110315416
EST270       166182     114256949
EST271       198024     102914496
EST272       156571     106621832
EST273       196080     115053058
EST274       196808     48838168
EST275       206591     42226200
EST276       181583     103275236
EST277       171102     115310225
EST278       186370     116516037
EST279       126119     72496648
EST28        190581     88625819
EST280       175324     114177098
EST281       170845     74583073
EST282       133352     83117294
EST283       130608     85385608
EST284       155189     102553247
EST285       260789     27544844
EST286       264780     24329995
EST287       148937     104657137
EST288       169546     109663274
EST289       160106     102646177
EST29        158259     69009540
EST290       155894     92349651
EST291       153073     14152739
EST292       209893     74150341
EST293       165145     107757995
EST294       177127     106903885
EST295       154170     98843454
EST296       200215     108103323
EST297       154743     111115231
EST298       166410     101013964
EST299       188050     115294943
EST3         151286     53608977
EST30        171781     69703727
EST300       178999     103058265
EST301       185881     99086288
EST302       184133     64488928
EST303       126547     44862779
EST304       183962     71376275
EST305       184619     69635259
EST306       185628     96241920
EST307       182554     131147739
EST308       145728     84810038
EST309       152945     92432128
EST31        149992     63652937
EST310       131465     100588297
EST311       161051     97312600
EST312       171223     97958340
EST313       150866     96997129
EST314       168219     95559132
EST315       160474     107355727
EST316       100837     70844143
EST317       164574     107967038
EST318       157371     108929746
EST319       178602     151136465
EST32        168732     76282893
EST320       170888     112059985
EST321       141704     75845451
EST322       144016     98183743
EST323       147115     101049725
EST324       134855     90901952
EST325       149245     99477997
EST326       149866     101255842
EST327       177661     110778308
EST328       149026     82698328
EST329       149122     85531471
EST33        175392     67754969
EST330       65955      40602911
EST331       150523     108383026
EST332       161700     97051193
EST333       143740     91461312
EST334       141803     89347211
EST335       203907     111094522
EST336       138722     75684298
EST337       91345      54429249
EST338       130350     85744588
EST339       137141     87063118
EST34        119098     41179372
EST340       125782     80491960
EST341       158901     85232864
EST342       217333     85069441
EST343       171352     87501067
EST344       106654     63726470
EST345       165373     103535447
EST346       146959     89845833
EST347       133010     88559731
EST348       136155     88631617
EST349       185818     121782684
EST35        96367      29586224
EST350       161426     97663715
EST351       153703     78007157
EST352       187990     127478327
EST353       118439     82255922
EST354       73370      44184812
EST355       136732     75236021
EST356       130580     78257386
EST357       147553     58552709
EST358       158748     32261750
EST359       43251      8860477
EST36        96775      30245838
EST360       155609     42677654
EST361       190809     120887403
EST362       238310     113679440
EST363       247501     113101826
EST364       187894     102806797
EST365       141237     91604124
EST366       136580     86831515
EST367       152936     90112347
EST368       190305     117646225
EST369       227707     63722317
EST37        95688      29021543
EST370       177670     111514833
EST371       32534      14304312
EST372       214207     117614240
EST373       204819     121606862
EST374       203755     116464098
EST375       143638     69180492
EST376       198352     122114039
EST377       159035     100689444
EST378       166388     127617617
EST379       183507     145463311
EST38        97555      29505236
EST380       157156     92927674
EST381       164166     105231416
EST382       185699     106493608
EST383       95479      56335488
EST384       205017     111663433
EST385       195517     108717459
EST386       192545     118848383
EST387       191035     124057890
EST388       200868     132546245
EST389       218965     133278091
EST39        97680      30983414
EST390       212654     135001179
EST391       200418     162464250
EST392       214587     143982879
EST393       181018     110599368
EST394       65948      39407900
EST395       192020     104233385
EST396       169654     14902935
EST397       159582     13504389
EST398       157424     26495082
EST399       158848     32002038
EST4         171412     67335226
EST40        28217      7231139
EST400       158764     32196328
EST401       150314     77321357
EST402       175105     102313645
EST403       170331     116484615
EST404       167686     96938938
EST405       155553     108426972
EST406       140565     98067893
EST407       115925     81579488
EST408       154633     97575996
EST409       166772     121257078
EST41        101354     52983819
EST410       163342     98906032
EST411       169154     62458817
EST412       168422     29348148
EST413       160442     107203687
EST414       151595     101296512
EST415       180334     117824530
EST416       139790     76271102
EST417       194658     109945260
EST418       156986     116822057
EST419       133820     91431084
EST42        119679     50944607
EST420       139344     92070064
EST421       620        412250
EST422       147797     92166960
EST423       176474     96825826
EST424       179717     98251092
EST425       146919     90964412
EST426       180420     109780283
EST427       163496     96555917
EST428       109602     75550029
EST429       85697      65399170
EST43        166339     91994018
EST430       100065     67526969
EST431       134683     79170712
EST432       136986     80775337
EST433       133941     82114256
EST434       135813     90089574
EST435       142425     86084824
EST436       51753      27121015
EST437       160085     86802605
EST438       195590     116791659
EST439       126181     81351974
EST44        170623     72307608
EST440       192618     106660650
EST441       178749     84062457
EST442       162510     92724977
EST443       155222     85046501
EST444       208558     121726311
EST445       191947     114664053
EST446       167736     101823192
EST447       147124     109582390
EST448       136319     84963767
EST449       42166      29164885
EST45        167818     85152350
EST450       162939     71839681
EST451       188972     92505582
EST452       209755     83067448
EST453       205260     87373096
EST454       188458     93245489
EST455       181120     107118900
EST456       187732     112602367
EST457       188437     113850920
EST458       204918     138348507
EST459       190136     89874241
EST46        168457     86859060
EST460       171977     78432651
EST461       189907     133001274
EST462       215040     123157704
EST463       172688     109666876
EST464       183171     109459872
EST465       198791     116742685
EST466       137192     97053893
EST467       166099     105406700
EST468       168397     86413896
EST469       161207     89090541
EST47        163575     87986098
EST470       156672     84251228
EST471       157321     82703145
EST472       145200     80422086
EST473       167659     107534876
EST474       184342     109369441
EST475       176820     116547530
EST476       185212     121357739
EST477       180963     113714940
EST478       182585     106354707
EST479       171979     67201353
EST48        162694     83206284
EST480       169690     60247509
EST481       98699      39209493
EST49        160314     91338849
EST5         169493     66369689
EST50        162293     88449590
EST51        157695     99247670
EST52        159760     69998277
EST53        147268     82479784
EST54        72131      47672083
EST55        167521     70086597
EST56        165247     74991905
EST57        164952     91076377
EST58        159202     97091170
EST59        156790     102100352
EST6         172134     67168198
EST60        165072     99236771
EST61        160292     108342569
EST62        171997     80646070
EST63        173905     93372270
EST64        155450     84247975
EST65        148875     81667618
EST66        159084     98571011
EST67        131612     75062296
EST68        150067     91962686
EST69        195872     108737839
EST7         170564     73071258
EST70        181354     95121407
EST71        222270     121811794
EST72        187090     111908612
EST73        203923     120921264
EST74        164638     90823431
EST75        132423     60412453
EST76        137986     67965222
EST77        157781     97832031
EST78        157453     97733847
EST79        142840     78809664
EST8         180019     73158432
EST80        46288      21525084
EST81        164059     100489477
EST82        212712     115142986
EST83        224802     124305934
EST84        200944     94560478
EST85        212093     93366284
EST86        161375     93012447
EST87        144165     87400554
EST88        164649     81025004
EST89        158776     79936737
EST9         168970     69426392
EST90        153570     102338551
EST91        151709     88934425
EST92        131091     84854154
EST93        156093     112957041
EST94        141253     103425213
EST95        142079     101604771
EST96        141253     97651112
EST97        147722     81887569
EST98        178942     111005620
EST99        223818     135594745
GSS1         200936     87992234
GSS10        132676     60724263
GSS100       145434     114442767
GSS101       141763     116184076
GSS102       143261     116672134
GSS103       166570     128263370
GSS104       149025     82048493
GSS105       191436     120801377
GSS106       168728     112791123
GSS107       198746     116490361
GSS108       205237     134898580
GSS109       209604     138169536
GSS11        137126     73876072
GSS110       207354     140810088
GSS111       206097     142300473
GSS112       205162     143530015
GSS113       204925     143949353
GSS114       202025     146602176
GSS115       182171     139434154
GSS116       16999      10163180
GSS117       133164     84216220
GSS118       170165     80218632
GSS119       183871     79354137
GSS12        148408     75889690
GSS120       170036     148147503
GSS121       177747     120674510
GSS122       179422     145661236
GSS123       187615     120669917
GSS124       186870     139167746
GSS125       192430     127209576
GSS126       192032     93283266
GSS127       167559     156558237
GSS128       163626     113989509
GSS129       60894      36833138
GSS13        145642     69077970
GSS130       170924     155391265
GSS131       172236     154355390
GSS132       172285     155047185
GSS133       173669     154061261
GSS134       171880     154918497
GSS135       180286     138244448
GSS136       177778     146362755
GSS137       166232     119407177
GSS138       192388     95146131
GSS139       258614     44192301
GSS14        171167     85471311
GSS140       258272     39801873
GSS141       93069      14316936
GSS142       254550     58910013
GSS143       266302     53698538
GSS144       190431     88897932
GSS145       196772     64265586
GSS146       185069     146363674
GSS147       181726     149596530
GSS148       167299     154580222
GSS149       170987     157779305
GSS15        161590     98195707
GSS150       232935     77220077
GSS151       231030     76723540
GSS152       131132     60288793
GSS153       213637     54260267
GSS154       157555     97574152
GSS155       182942     113535224
GSS156       135785     87096792
GSS157       165173     130020704
GSS158       183702     161464628
GSS159       193931     159491073
GSS16        173175     87177726
GSS160       190374     125589387
GSS161       217120     138274983
GSS162       221520     132815022
GSS163       160693     98931260
GSS164       150123     86026098
GSS165       37410      28664475
GSS166       211853     158059324
GSS167       193130     102603272
GSS168       172161     68129161
GSS169       206239     159865505
GSS17        184004     114253867
GSS170       207855     162100676
GSS171       207176     163853706
GSS172       205397     135061335
GSS173       157102     112116604
GSS174       87032      63853715
GSS175       83577      62785783
GSS176       103113     48365477
GSS177       68934      58595891
GSS178       8571       7692351
GSS179       68591      57924394
GSS18        191866     113864856
GSS180       69224      56650935
GSS181       69460      56187403
GSS182       71202      55998401
GSS183       68561      51865315
GSS184       75915      58209304
GSS185       86540      74277212
GSS186       81317      44384966
GSS187       92266      45108910
GSS188       65131      48539953
GSS189       77811      61666620
GSS19        109267     49024999
GSS190       70214      59194054
GSS191       68204      63291319
GSS192       62731      52925680
GSS193       94994      42346893
GSS194       19509      4537258
GSS195       112930     70870954
GSS196       830        565879
GSS197       23226      28867035
GSS198       109084     70678875
GSS199       84403      34582519
GSS2         182739     92537598
GSS20        181328     101431612
GSS200       35904      22282147
GSS201       103304     62490220
GSS202       102329     63761256
GSS203       104240     67638632
GSS204       82127      41294650
GSS205       83102      54651503
GSS206       95565      61249467
GSS207       107362     78589335
GSS208       106444     76728833
GSS209       106101     79982459
GSS21        166554     114432569
GSS210       104001     80014803
GSS211       75801      50678132
GSS212       105097     63619915
GSS213       109868     66415305
GSS214       105969     59182678
GSS215       68062      37223883
GSS216       69097      38525198
GSS217       38174      18339130
GSS218       85817      46213833
GSS219       97756      56282806
GSS22        169386     97553408
GSS220       94838      49467300
GSS221       96276      55952494
GSS222       41313      23149851
GSS223       114055     43442995
GSS224       116422     39251295
GSS225       108546     52732132
GSS226       108722     67128647
GSS227       101583     78242094
GSS228       57005      34059998
GSS229       96897      36918766
GSS23        186604     125906880
GSS230       96399      37676586
GSS231       97739      35452830
GSS232       95145      39751140
GSS233       33820      15967145
GSS234       103939     66277823
GSS235       94551      61190929
GSS236       95128      60357048
GSS237       94773      60868501
GSS238       75675      70017159
GSS239       80658      68522367
GSS24        192677     129465133
GSS240       36895      34939652
GSS241       82369      27761898
GSS242       82844      26872946
GSS243       83400      25690460
GSS244       19119      5586005
GSS245       16547      7508221
GSS246       94100      60580478
GSS247       97403      65501702
GSS248       96166      65715907
GSS249       106376     69841317
GSS25        177883     105804709
GSS250       91708      45507881
GSS251       91214      49568095
GSS252       75915      41427331
GSS253       90839      57016024
GSS254       89674      61866093
GSS255       88534      63668650
GSS256       89290      62493340
GSS257       9699       6996370
GSS258       87995      63795538
GSS259       90590      62742076
GSS26        184528     106671835
GSS260       94937      59925372
GSS261       74696      63777273
GSS262       84391      78676825
GSS263       82881      80793634
GSS264       69452      51663438
GSS265       114900     62956729
GSS266       108980     55519998
GSS267       107208     51972208
GSS268       99627      44671760
GSS269       109459     48915853
GSS27        170212     149596734
GSS270       98451      44895226
GSS271       79289      63646396
GSS272       72741      72762720
GSS273       63722      53929744
GSS274       60716      47053941
GSS275       32728      24672361
GSS276       60845      46734002
GSS277       61946      49327951
GSS278       84047      86740412
GSS279       82536      88549611
GSS28        188949     147840069
GSS280       77949      74213298
GSS281       84442      64951795
GSS282       60134      48386085
GSS283       60082      48548768
GSS284       79755      51505702
GSS285       81394      61015678
GSS286       46325      27866603
GSS287       94787      57200301
GSS288       93517      59081345
GSS289       93900      58510429
GSS29        150148     104230567
GSS290       94714      57307691
GSS291       83843      51265303
GSS292       103666     69242174
GSS293       104299     74321241
GSS294       109373     68331863
GSS295       106994     71135784
GSS296       38781      26571815
GSS297       111314     66044649
GSS298       97520      60954006
GSS299       106950     56669730
GSS3         175733     88087457
GSS30        191200     131481024
GSS300       93049      72593306
GSS301       82894      88249746
GSS302       78885      94156617
GSS303       52511      30616464
GSS31        21056      14055970
GSS32        195376     126942054
GSS33        217734     116816499
GSS34        219656     114195328
GSS35        220809     112621805
GSS36        214075     122632108
GSS37        196391     154722125
GSS38        192935     145197569
GSS39        193490     73149142
GSS4         167433     85324699
GSS40        186633     96350850
GSS41        187080     123983700
GSS42        173606     161518201
GSS43        12196      7843686
GSS44        183230     99934228
GSS45        172375     121118869
GSS46        183257     123433564
GSS47        188866     120899771
GSS48        75976      66230525
GSS49        170045     100948017
GSS5         51061      30412071
GSS50        166240     102102664
GSS51        166431     101323646
GSS52        181635     120322749
GSS53        183662     115768060
GSS54        181041     122897506
GSS55        187666     112721573
GSS56        187346     135091389
GSS57        177420     103594810
GSS58        194391     118883556
GSS59        180332     129960613
GSS6         161937     84623154
GSS60        15097      13682905
GSS61        171906     138347929
GSS62        162249     111940574
GSS63        162290     111957380
GSS64        158271     107224004
GSS65        156086     128713494
GSS66        170391     142685291
GSS67        176079     114825244
GSS68        202855     127207738
GSS69        193492     110498445
GSS7         165841     79603400
GSS70        244924     126182881
GSS71        161611     107726959
GSS72        157995     117763374
GSS73        162710     124586306
GSS74        162678     124640442
GSS75        173969     108785823
GSS76        191248     140093025
GSS77        18304      11703996
GSS78        196630     124922865
GSS79        169313     110439814
GSS8         165838     89012145
GSS80        199153     130496475
GSS81        210321     89537887
GSS82        190713     96066169
GSS83        133039     93055247
GSS84        145944     117206848
GSS85        139790     117027123
GSS86        142875     113979528
GSS87        144231     119970332
GSS88        141762     115675632
GSS89        109629     91427911
GSS9         138237     67304162
GSS90        149553     122345328
GSS91        147790     117796701
GSS92        144115     113153024
GSS93        142979     115532063
GSS94        144337     119766805
GSS95        148217     121722672
GSS96        147793     117900972
GSS97        146200     121152590
GSS98        146262     121035840
GSS99        146701     120156218
HTC1         25047      27029851
HTC10        70844      69672461
HTC11        72403      69671955
HTC12        28231      33339657
HTC13        67517      60542416
HTC14        69006      69661799
HTC15        51030      38328743
HTC2         16071      36202003
HTC3         16014      36607191
HTC4         16234      35514380
HTC5         15960      40329026
HTC6         16042      37386456
HTC7         53542      31186695
HTC8         31530      19965253
HTC9         60703      77599470
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189997386
HTG117       1548       182671507
HTG118       1576       179541061
HTG119       1382       157855740
HTG12        1452       184004673
HTG120       1590       179393068
HTG121       1587       179603616
HTG122       1580       179595063
HTG123       1598       179568613
HTG124       1603       179517182
HTG125       1582       180855862
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1476       185679630
HTG129       1134       190249540
HTG13        875        191786413
HTG130       1103       184582645
HTG131       4          407375
HTG132       1557       186483382
HTG133       1855       177768696
HTG134       986        186174720
HTG135       1072       192049994
HTG136       1089       193222951
HTG137       602        109520336
HTG138       1031       189469892
HTG139       1055       192678789
HTG14        753        191921309
HTG140       1163       191852916
HTG141       1080       192395765
HTG142       1083       192975115
HTG143       589        103841272
HTG144       1122       192664765
HTG145       1078       192391538
HTG146       1078       192343720
HTG147       1167       191963087
HTG148       2134       191515464
HTG149       1096       192427861
HTG15        745        191963148
HTG150       1077       192076391
HTG151       1089       192444477
HTG152       1037       190320494
HTG153       1425       183042200
HTG154       1733       174708005
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93628      48164281
INV10        48908      92505802
INV100       37923      155535140
INV101       47450      148279075
INV102       31582      35878775
INV103       41258      162193552
INV104       8649       189035299
INV105       14549      181577331
INV106       5295       188760704
INV107       18509      176900436
INV108       34351      158679406
INV109       14344      172158272
INV11        35         174810098
INV110       23577      45955779
INV111       16795      180349455
INV112       21027      172501512
INV113       4891       191046501
INV114       26084      174037919
INV115       14547      181030545
INV116       44397      155376448
INV117       27112      171621394
INV118       19370      174154051
INV119       49371      138775955
INV12        43026      118980642
INV120       29055      84543185
INV121       96245      108547326
INV122       35892      166944993
INV123       23159      177277868
INV124       22654      170374262
INV125       4699       190767649
INV126       29376      152389625
INV127       55624      119361124
INV128       566        40635863
INV129       7358       190633905
INV13        75144      63039866
INV130       51895      153104512
INV131       5607       188059543
INV132       35090      162253206
INV133       3365       19020735
INV134       39813      159668855
INV135       62444      141571579
INV136       19462      30223725
INV137       104664     106635585
INV138       74577      120116541
INV139       12112      167732182
INV14        34982      26533065
INV140       18278      163726949
INV141       13818      94808827
INV142       29262      155753563
INV143       38610      149060814
INV144       51684      139700572
INV145       70877      126444377
INV146       97323      108082698
INV147       125942     86452766
INV148       27987      144315350
INV149       11710      142675953
INV15        84544      65977497
INV150       130        149283764
INV151       25321      121026465
INV16        80686      66724256
INV17        78502      66790464
INV18        49997      46991020
INV19        36850      122230889
INV2         59771      89902088
INV20        283        149271649
INV21        49881      102948310
INV22        77053      55598203
INV23        72035      61775869
INV24        500        324564
INV25        23152      127349623
INV26        6          133712559
INV27        56678      101650230
INV28        74046      50257841
INV29        70467      51178621
INV3         1369       188222232
INV30        76788      54970185
INV31        75554      57245020
INV32        76768      57108738
INV33        73301      54063748
INV34        55356      36910508
INV35        78684      56873209
INV36        74444      55082853
INV37        74455      60669707
INV38        77034      58674521
INV39        56081      37389440
INV4         878        127339729
INV40        77607      56068318
INV41        73844      51811063
INV42        74610      56312581
INV43        76931      57321321
INV44        37226      32128885
INV45        75631      48351886
INV46        73068      44535314
INV47        75218      45543531
INV48        76092      53771002
INV49        27695      19618511
INV5         26268      110067679
INV50        76372      53593368
INV51        74134      44271707
INV52        73334      42922393
INV53        73831      42564982
INV54        27280      16537631
INV55        69254      41118660
INV56        68883      41224348
INV57        68601      41232930
INV58        68672      40815071
INV59        69927      44879673
INV6         77730      71338335
INV60        69359      41760410
INV61        56243      33571502
INV62        64912      48140102
INV63        68530      50889401
INV64        72372      55626381
INV65        69476      54965680
INV66        42036      115951819
INV67        38137      94823553
INV68        81479      126211856
INV69        100429     109691945
INV7         53234      95758571
INV70        116036     96137263
INV71        101319     70777781
INV72        35239      166647152
INV73        30755      171594048
INV74        27724      170864744
INV75        2640       190498229
INV76        6183       191107737
INV77        17837      180141483
INV78        15378      184713635
INV79        6839       167378491
INV8         43832      90511360
INV80        8875       189509571
INV81        15662      184182101
INV82        30722      171526293
INV83        65600      142208408
INV84        21638      22670137
INV85        50224      153584896
INV86        4095       191102716
INV87        11177      184659675
INV88        29153      168751324
INV89        3317       189349389
INV9         80234      71415036
INV90        6330       186171285
INV91        12367      180474553
INV92        39596      157268982
INV93        60755      142074593
INV94        67983      110944176
INV95        93063      112788673
INV96        14244      174036919
INV97        29357      160122987
INV98        66634      130026281
INV99        38635      162651925
MAM1         21062      154718152
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         13955      164819502
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        9          136550477
MAM26        54         7614329
MAM27        215        34073042
MAM28        431        71272130
MAM29        861        68509101
MAM3         20418      31487518
MAM30        1706       2411269
MAM31        6836       6159435
MAM32        79405      74427303
MAM33        31121      118973469
MAM34        75933      62138363
MAM35        68734      72277101
MAM36        64173      77790997
MAM37        46327      72405415
MAM38        8809       182844338
MAM39        696        677995
MAM4         26809      24996773
MAM5         13731      20581346
MAM6         3445       7368893
MAM7         107        699953
MAM8         19         1775631
MAM9         1          275920749
PAT1         222547     70103365
PAT10        124323     102482753
PAT100       178683     3394977
PAT101       178342     3388498
PAT102       178198     3385762
PAT103       178185     3385515
PAT104       132610     2848492
PAT105       342935     8573375
PAT106       188806     88519660
PAT107       111348     132068608
PAT108       3850       194703659
PAT109       131292     110979300
PAT11        98859      64213728
PAT110       158599     54826034
PAT111       224682     34110443
PAT112       250080     15844315
PAT113       180713     63623716
PAT114       51663      26102651
PAT115       114135     110460977
PAT116       137540     83210521
PAT117       164370     99020681
PAT118       158392     103578951
PAT119       137596     115028387
PAT12        141823     62679900
PAT120       42621      28098514
PAT121       193712     81686401
PAT122       150218     108404223
PAT123       356051     11379519
PAT124       257211     57607676
PAT125       138160     48226316
PAT126       322021     22795469
PAT127       155642     102753966
PAT128       132724     110696205
PAT129       128341     121313309
PAT13        103922     59409436
PAT130       21664      184390005
PAT131       144889     112900617
PAT132       171997     96405634
PAT133       44617      171215968
PAT134       9167       47581637
PAT135       33645      178334734
PAT136       153558     109675196
PAT137       178705     90913377
PAT138       136050     115324192
PAT139       120392     123343236
PAT14        102673     49405820
PAT140       8526       8991488
PAT141       155429     101473147
PAT142       184764     88815933
PAT143       182409     85292093
PAT144       174403     93928365
PAT145       28829      20461016
PAT146       147930     108545990
PAT147       160944     101973644
PAT148       185311     90980420
PAT149       231649     49265020
PAT15        120390     52406644
PAT150       203020     47532890
PAT151       277498     9808008
PAT152       220370     46464160
PAT153       107730     2906417
PAT154       270386     21672571
PAT155       186660     61147649
PAT156       109662     106102758
PAT157       47746      9596649
PAT158       87159      87872668
PAT159       78136      95530847
PAT16        108541     62745531
PAT160       144050     78090236
PAT161       168233     70790615
PAT162       121014     93304938
PAT163       103744     84897480
PAT164       166136     46771214
PAT165       270022     5130418
PAT166       269978     5129582
PAT167       269978     5129582
PAT168       237888     4519872
PAT169       269396     5118524
PAT17        47669      17039281
PAT170       235450     25552370
PAT171       203696     47174847
PAT172       12101      424875
PAT173       165310     74498391
PAT174       91504      126583865
PAT175       171359     72072028
PAT176       214402     66356095
PAT177       42873      49259391
PAT178       235138     59544089
PAT179       123750     125093767
PAT18        146771     52594264
PAT180       217504     66591902
PAT181       198097     84199370
PAT182       2346       5855451
PAT183       190271     85554469
PAT184       158609     102172052
PAT185       157481     102983510
PAT186       99253      76900838
PAT187       156209     98316380
PAT188       91682      138752301
PAT189       160779     88041379
PAT19        153714     78039687
PAT190       136985     111168356
PAT191       42350      35878823
PAT192       168931     98953101
PAT193       142774     114661479
PAT194       131583     119360876
PAT195       97976      135115181
PAT196       153486     94355328
PAT197       54686      41121273
PAT198       93110      87244389
PAT199       91788      79966796
PAT2         194517     84670519
PAT20        104716     118087764
PAT200       83782      91661717
PAT201       108692     54197295
PAT202       101026     56660358
PAT203       150189     24631215
PAT204       93817      82459162
PAT205       26010      162900357
PAT206       113938     65759860
PAT207       81619      28134712
PAT208       3631       191518875
PAT209       84408      78157905
PAT21        133760     95339884
PAT210       145069     26290546
PAT211       76929      99953941
PAT212       95332      71448829
PAT213       129838     31394819
PAT214       4941       7291501
PAT215       106322     62280040
PAT216       140008     12598692
PAT217       150515     23979175
PAT218       74138      6340578
PAT219       58028      68766855
PAT22        84658      79569499
PAT220       41081      54488985
PAT221       60875      54847144
PAT222       37721      64051648
PAT223       41404      61065384
PAT224       40778      53269659
PAT225       79940      57624117
PAT226       111537     54516792
PAT227       37063      8158413
PAT228       103405     55692396
PAT229       99422      44580758
PAT23        123520     103391176
PAT230       84104      73950890
PAT231       98253      10042153
PAT232       123244     19683537
PAT233       86785      129976438
PAT234       158937     78754509
PAT235       213344     47012213
PAT236       169348     66530164
PAT237       59815      8716469
PAT238       161863     78377268
PAT239       119782     100490233
PAT24        119457     105503971
PAT240       86768      128899853
PAT241       37958      167204138
PAT242       35970      168659354
PAT243       75398      138092775
PAT244       252325     29172061
PAT245       137107     91854637
PAT246       148267     82348474
PAT247       141919     74970224
PAT248       16883      11381232
PAT249       141695     86763404
PAT25        145018     86742912
PAT250       144995     93151551
PAT251       257285     12186129
PAT252       152526     4584721
PAT253       240738     21500238
PAT254       248574     11702646
PAT255       258799     3881985
PAT256       76619      1149285
PAT257       258799     3881985
PAT258       253598     6415258
PAT259       183006     43408049
PAT26        174985     64376643
PAT260       57090      1826880
PAT261       96023      21414304
PAT262       36374      149540976
PAT263       17414      176266090
PAT264       155889     8152794
PAT265       33561      148872633
PAT266       31808      82257068
PAT267       5177       9379909
PAT268       37903      57481578
PAT269       37752      57968298
PAT27        72020      1800500
PAT270       37840      57577626
PAT271       37917      57289516
PAT272       60383      56854488
PAT273       128111     36839772
PAT274       36341      18094901
PAT275       136400     84788618
PAT276       257637     3864555
PAT277       231203     18136935
PAT278       162705     79319463
PAT279       174410     68021286
PAT28        102083     77370348
PAT280       93069      50708971
PAT29        93953      87559125
PAT3         171992     95904578
PAT30        119906     61672670
PAT31        96693      78977196
PAT32        128053     54918329
PAT33        92447      51197942
PAT34        117827     69179372
PAT35        119660     35930895
PAT36        121818     44323310
PAT37        94326      86760285
PAT38        147251     22244922
PAT39        149444     31041846
PAT4         153752     106058463
PAT40        114661     49976550
PAT41        33897      46161678
PAT42        95722      83166454
PAT43        100230     70746430
PAT44        135982     39560964
PAT45        143800     35449233
PAT46        123840     64322888
PAT47        104449     81149035
PAT48        93089      74613582
PAT49        113259     66580350
PAT5         57129      23913162
PAT50        65583      54917178
PAT51        135191     107998311
PAT52        167082     97033437
PAT53        116397     127556980
PAT54        196343     76723060
PAT55        80303      127991082
PAT56        27631      180872621
PAT57        185409     93066654
PAT58        274258     6856450
PAT59        129447     31627433
PAT6         170645     91912459
PAT60        161320     77719729
PAT61        92639      89107951
PAT62        106090     74957466
PAT63        122369     64032804
PAT64        68017      30416474
PAT65        70748      109764944
PAT66        87946      82759037
PAT67        92971      78935157
PAT68        93164      72444136
PAT69        93383      75087244
PAT7         154876     88271671
PAT70        115770     60532287
PAT71        102747     9942058
PAT72        175928     10547489
PAT73        171510     10872561
PAT74        171496     10866737
PAT75        99864      86225363
PAT76        99         196466297
PAT77        67         192869889
PAT78        103        195600591
PAT79        1132       196318332
PAT8         131121     96964630
PAT80        97604      5772661
PAT81        151009     9636510
PAT82        151022     9621259
PAT83        151024     9622125
PAT84        151021     9620837
PAT85        94628      88047763
PAT86        92256      94526763
PAT87        37562      34676379
PAT88        83459      93185861
PAT89        15567      180450135
PAT9         129261     101026635
PAT90        164891     19209740
PAT91        178944     3399936
PAT92        177434     3371246
PAT93        175305     3330795
PAT94        101401     1926619
PAT95        169165     12412132
PAT96        178699     3395281
PAT97        178691     3395129
PAT98        178677     3394863
PAT99        140786     2674934
PHG1         5811       104196301
PHG2         3020       106203259
PHG3         2939       97965708
PLN1         59766      93435562
PLN10        47561      48046934
PLN100       76186      67714131
PLN101       71949      76790537
PLN102       79926      65131654
PLN103       7884       7655568
PLN104       77962      63292517
PLN105       75144      68284673
PLN106       81592      59168962
PLN107       81411      58469613
PLN108       24103      26963582
PLN109       73370      62792513
PLN11        71547      76899904
PLN110       72081      70330627
PLN111       64118      83473233
PLN112       57096      64800003
PLN113       91610      52450084
PLN114       74406      67865733
PLN115       71284      68173573
PLN116       40789      48266426
PLN117       70505      70733739
PLN118       61347      78981261
PLN119       62718      81062977
PLN12        39815      50751925
PLN120       33661      32661797
PLN121       69517      73247146
PLN122       64428      75293022
PLN123       62669      80309788
PLN124       26727      35789878
PLN125       57601      87633778
PLN126       59965      80395675
PLN127       47240      72248282
PLN128       62104      85867221
PLN129       11938      121373111
PLN13        38808      63030477
PLN130       75         195190201
PLN131       19513      166896931
PLN132       11874      154426252
PLN133       6          176139136
PLN134       16621      128387719
PLN135       5          186225412
PLN136       1847       182602655
PLN137       40608      85275323
PLN14        25598      117915242
PLN15        21197      110640707
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        1473       11877350
PLN2         74481      77619981
PLN20        23259      121287391
PLN21        6071       150261554
PLN22        1195       166515226
PLN23        1459       167290703
PLN24        29         162241774
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        21959      107206286
PLN3         36163      105299101
PLN30        66923      69640223
PLN31        29605      31678658
PLN32        76765      76032502
PLN33        36342      41231203
PLN34        57312      72149876
PLN35        28690      28924684
PLN36        2644       102424090
PLN37        3          73585790
PLN38        30         105815221
PLN39        280        132334401
PLN4         1367       177804842
PLN40        99         128334245
PLN41        276        130077458
PLN42        162        128540143
PLN43        96         78236510
PLN44        155        127341809
PLN45        140        128801654
PLN46        171        128629066
PLN47        168        134392902
PLN48        201        152936626
PLN49        273        194235260
PLN5         1845       186016576
PLN50        273        194974546
PLN51        274        194874299
PLN52        129        195680113
PLN53        29         176679145
PLN54        7          177736082
PLN55        105        163748185
PLN56        880        136987360
PLN57        1822       37190449
PLN58        7181       18795412
PLN59        14346      29953091
PLN6         1848       194273109
PLN60        18734      133874150
PLN61        77717      74503474
PLN62        96408      58592367
PLN63        34279      32440633
PLN64        80157      71431115
PLN65        77560      75763694
PLN66        80017      70143655
PLN67        81434      74696701
PLN68        60043      34068776
PLN69        98781      55112459
PLN7         1688       194277347
PLN70        82275      68243332
PLN71        44625      98672015
PLN72        5504       152835432
PLN73        11882      165587691
PLN74        29507      120346017
PLN75        53406      102420241
PLN76        17714      12653084
PLN77        80803      72355840
PLN78        17664      12940450
PLN79        49499      72634721
PLN8         1831       193322220
PLN80        25059      110563611
PLN81        13564      89762114
PLN82        1          774434471
PLN83        8227       28428618
PLN84        1858       148969943
PLN85        2          135217911
PLN86        2          155188403
PLN87        2          140023111
PLN88        2          154604167
PLN89        2          148753627
PLN9         49136      106380974
PLN90        3          173772618
PLN91        3          178836778
PLN92        3          176344173
PLN93        3          195539469
PLN94        12431      129466187
PLN95        81783      65444844
PLN96        92313      57806470
PLN97        23053      15614674
PLN98        77256      71112373
PLN99        69882      84171271
PRI1         23034      59762327
PRI10        1254       178692891
PRI11        865        105120773
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22384      144319360
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2080       192530869
PRI23        5915       184823618
PRI24        11048      27927635
PRI25        27935      79140033
PRI26        59722      83843892
PRI27        36281      82259492
PRI28        8758       172032991
PRI29        2265       191511011
PRI3         1439       174314309
PRI30        1665       190764297
PRI31        2075       192251373
PRI32        2195       191150383
PRI33        13091      162158571
PRI34        2067       170809233
PRI35        56436      88263163
PRI36        4477       9299778
PRI37        32154      63605650
PRI38        20538      119329276
PRI39        18692      150583835
PRI4         1276       185669146
PRI40        67704      85012590
PRI41        50233      89169276
PRI42        41718      84042477
PRI43        47255      95768626
PRI44        26884      100976749
PRI45        28651      109110050
PRI46        22892      105447380
PRI47        21149      48001117
PRI48        23090      123852730
PRI49        37366      110410557
PRI5         1337       184500937
PRI50        38825      76017256
PRI51        1          229594237
PRI52        1          190673448
PRI53        1          197221778
PRI54        19306      163276896
PRI55        39679      74545157
PRI6         1180       180111971
PRI7         1229       180255349
PRI8         1219       179122541
PRI9         1372       174797659
ROD1         37494      132461565
ROD10        990        182141245
ROD11        313        59221860
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15169      159111693
ROD2         907        176074185
ROD20        20965      153339910
ROD21        1216       193805576
ROD22        1007       158474097
ROD23        15256      168408012
ROD24        37600      68952807
ROD25        20073      114214095
ROD26        1529       193330721
ROD27        150580     18422422
ROD28        75240      78242495
ROD29        83713      53138720
ROD3         910        173137629
ROD30        52816      61919830
ROD4         900        173814565
ROD5         921        174674771
ROD6         964        177140666
ROD7         974        179619503
ROD8         968        181286279
ROD9         1001       181574078
STS1         85256      36747730
STS10        57907      44420409
STS11        48921      37511590
STS12        57924      43637361
STS13        64061      42739168
STS14        93170      34131915
STS15        104293     26506307
STS16        10768      2915732
STS17        103700     27504029
STS18        97621      33595220
STS19        96610      34549559
STS2         84142      49927708
STS20        71196      25121130
STS3         65861      25926514
STS4         77854      37074403
STS5         9142       5360707
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55705      37758824
SYN1         52644      71007480
SYN2         43736      80656881
SYN3         23838      124595057
SYN4         4593       176416683
SYN5         4587       176331540
SYN6         4592       176402547
SYN7         10323      162875560
SYN8         56837      72958605
SYN9         14982      28126273
TSA1         119079     37787968
TSA10        18501      20932212
TSA100       76680      52659255
TSA101       66774      66687697
TSA102       63892      75957536
TSA103       86991      55453747
TSA104       51740      27880810
TSA105       74245      86358066
TSA106       80229      75622518
TSA107       84801      72305810
TSA108       77881      83686531
TSA109       94375      51986778
TSA11        134170     34616677
TSA110       99157      69089270
TSA111       59230      97228833
TSA112       109175     49378845
TSA113       63354      68310026
TSA114       80812      88891396
TSA115       70536      71912167
TSA116       57870      119426084
TSA117       5003       6824267
TSA118       106689     67779914
TSA119       93410      83369889
TSA12        59768      19488440
TSA120       98615      76609458
TSA121       88033      68056906
TSA122       84942      58892567
TSA123       77606      62175202
TSA124       82433      76719447
TSA125       98411      60355080
TSA126       94492      42586906
TSA127       76549      54458912
TSA128       42472      39761343
TSA129       59626      61176103
TSA13        64542      58862448
TSA130       59047      61657426
TSA131       59168      62167042
TSA132       71956      78379950
TSA133       87818      51643326
TSA134       63336      64766777
TSA135       2563       1147163
TSA136       77745      34626570
TSA137       74689      66831444
TSA138       81079      78598444
TSA139       74692      64675647
TSA14        91996      62507406
TSA140       41882      34789042
TSA141       87600      70235611
TSA142       89003      68194525
TSA143       84656      77065314
TSA144       76791      81310397
TSA145       12038      10028761
TSA146       104187     53670971
TSA147       80878      61177338
TSA148       69693      78323809
TSA149       73196      67845845
TSA15        87656      43266725
TSA150       86992      75471245
TSA151       89428      70000229
TSA152       62311      102880653
TSA153       95611      74148270
TSA154       20799      14551082
TSA155       82974      63616708
TSA156       83472      63790182
TSA157       78941      73480275
TSA158       76936      75992422
TSA159       93256      58483267
TSA16        76021      85945541
TSA160       100927     67777228
TSA161       35508      24274059
TSA162       103445     64539230
TSA163       94920      75734700
TSA164       80355      64233867
TSA165       30552      47121787
TSA166       51839      98295419
TSA167       46917      107683976
TSA168       44952      111436512
TSA169       42000      117073120
TSA17        79282      72813794
TSA170       39479      121890914
TSA171       37678      125330444
TSA172       30670      109097872
TSA173       78905      65671407
TSA174       61760      78088578
TSA175       65825      57454871
TSA176       40183      19203236
TSA177       38342      27295147
TSA178       35785      38621286
TSA179       34467      33162251
TSA18        86990      44505259
TSA180       31670      56857624
TSA181       31446      57845848
TSA182       39266      23134620
TSA183       40382      18182813
TSA184       41061      15174943
TSA185       41459      13408377
TSA186       41699      12346210
TSA187       26552      7560175
TSA188       41889      11506042
TSA189       41935      11303163
TSA19        73713      88531920
TSA190       41981      11096976
TSA191       42054      10770114
TSA192       42099      10570948
TSA193       42146      10365212
TSA194       43309      10362207
TSA195       69616      80129578
TSA196       26923      63171712
TSA197       89415      47258677
TSA198       47220      118089707
TSA199       86115      55982924
TSA2         112857     41270825
TSA20        66317      50611440
TSA200       79788      68179642
TSA201       4209       7000727
TSA202       51803      113422564
TSA203       44468      125297442
TSA204       37716      136219910
TSA205       63686      93740297
TSA206       62741      93126523
TSA207       46334      60938611
TSA208       62968      91356653
TSA209       75264      70251649
TSA21        81010      82050811
TSA210       48708      114790470
TSA211       81060      60457833
TSA212       48578      115504480
TSA213       79665      62922125
TSA214       71228      77140870
TSA215       52435      59143202
TSA216       80932      60001620
TSA217       40964      127412427
TSA218       88534      47058145
TSA219       61937      92459996
TSA22        62981      84302128
TSA220       79675      61576520
TSA221       88145      48373235
TSA222       55802      72353627
TSA223       71004      77849450
TSA224       68819      81280831
TSA225       85636      49751087
TSA226       66528      82429296
TSA227       91281      39406050
TSA228       62631      88834556
TSA229       52061      26280651
TSA23        85927      72676195
TSA24        99505      51808436
TSA25        58964      18378917
TSA26        85797      70106183
TSA27        120080     38852195
TSA28        135074     34047115
TSA29        52642      68387687
TSA3         109733     40830795
TSA30        47693      62712379
TSA31        2568       4358627
TSA32        60987      81840924
TSA33        92736      66826706
TSA34        109036     50277160
TSA35        106046     49573929
TSA36        101812     53917489
TSA37        104284     47753675
TSA38        25389      16338232
TSA39        66195      59263498
TSA4         110492     47447995
TSA40        92195      67722162
TSA41        92653      62162134
TSA42        80016      85985823
TSA43        99476      49896159
TSA44        113588     34208526
TSA45        95224      67534051
TSA46        13727      8550688
TSA47        94376      35380174
TSA48        77496      35938873
TSA49        106331     43405855
TSA5         78313      23627515
TSA50        113836     45499687
TSA51        29689      20438208
TSA52        103698     51338286
TSA53        101105     54210094
TSA54        97800      59154259
TSA55        81457      86094158
TSA56        69662      30955177
TSA57        90365      71288560
TSA58        97520      54422413
TSA59        60100      105474646
TSA6         111583     58975350
TSA60        86932      65069884
TSA61        78619      70637275
TSA62        83058      72217122
TSA63        82797      72052194
TSA64        68995      90904935
TSA65        90775      66751306
TSA66        75897      84474882
TSA67        71863      73185394
TSA68        68804      60806344
TSA69        84870      78036163
TSA7         87421      57901423
TSA70        85128      78006974
TSA71        70319      97838883
TSA72        85540      69665112
TSA73        84998      51586540
TSA74        102424     68703465
TSA75        87429      59046111
TSA76        103691     57030248
TSA77        73563      72856703
TSA78        78601      44515996
TSA79        87334      79220475
TSA8         104450     72517643
TSA80        91719      69206004
TSA81        78362      53147378
TSA82        78400      56954579
TSA83        97317      60069251
TSA84        38937      36173906
TSA85        88948      76782378
TSA86        95034      55397472
TSA87        110915     44811175
TSA88        97305      57964555
TSA89        65129      97030273
TSA9         109298     60842426
TSA90        15369      14817152
TSA91        101299     55496095
TSA92        91074      53959118
TSA93        93807      43529343
TSA94        85784      74015406
TSA95        73184      72093605
TSA96        39929      46730597
TSA97        77159      80203977
TSA98        77312      55431136
TSA99        84109      38689281
UNA1         331        203865
VRL1         64919      70746367
VRL10        43229      72883414
VRL11        60387      70062724
VRL12        61058      72933250
VRL13        66159      68245108
VRL14        48615      64912441
VRL15        62746      70819748
VRL16        57096      72671204
VRL17        63477      63566919
VRL18        57012      73288990
VRL19        52422      66622524
VRL2         66459      66418789
VRL20        54662      72255031
VRL21        58375      71316022
VRL22        56073      73180331
VRL23        55169      73828683
VRL24        28387      46052878
VRL25        52393      75250020
VRL26        37906      81557337
VRL27        47593      74880643
VRL28        47918      74094137
VRL29        49005      76576611
VRL3         70092      63560618
VRL30        13356      24589523
VRL31        49433      77664773
VRL32        42643      86666521
VRL33        41487      83022528
VRL34        48572      79210418
VRL35        36538      87874927
VRL36        3936       10618846
VRL37        38121      90057889
VRL38        43823      82484439
VRL39        46246      76887312
VRL4         68171      65168040
VRL40        44367      83165222
VRL41        43637      82165978
VRL42        43864      79007844
VRL43        40599      82140582
VRL44        48483      86605903
VRL45        26663      25489845
VRL5         68646      68679759
VRL6         19518      24664291
VRL7         47936      77148735
VRL8         46495      71634496
VRL9         43814      71160830
VRT1         67775      78095741
VRT10        1319       193366908
VRT11        8963       180750180
VRT12        3137       102130897
VRT13        13369      172251922
VRT14        5825       185117490
VRT15        3795       188803260
VRT16        49451      115678769
VRT17        79238      69224076
VRT18        77245      66380614
VRT19        20255      15012016
VRT2         1997       193076660
VRT20        71598      76307981
VRT21        44712      123203096
VRT22        77153      63328189
VRT23        79200      62127489
VRT24        81630      58065198
VRT25        35671      24574188
VRT26        102780     66113550
VRT27        81131      56361439
VRT28        85590      58032330
VRT29        62902      47210043
VRT3         48043      120936935
VRT30        90677      54043263
VRT31        76012      57707055
VRT32        8547       7329977
VRT33        74695      58301796
VRT34        55781      44910007
VRT35        80839      56883232
VRT36        75548      58941481
VRT37        78830      59630150
VRT38        47828      16748845
VRT39        109939     52960668
VRT4         24781      148628463
VRT40        77148      65207224
VRT41        37548      18667802
VRT42        90475      52462478
VRT43        86412      60459608
VRT44        7198       182344475
VRT45        54         189339586
VRT46        91         190616920
VRT47        228        191044449
VRT48        451        192360110
VRT49        1008       192833141
VRT5         39157      100925152
VRT50        6978       186813896
VRT51        86920      93803924
VRT52        177067     28429798
VRT53        53955      90444098
VRT54        3242       189215331
VRT55        9          178794778
VRT56        10         196480447
VRT57        11         184541365
VRT58        28         196498040
VRT59        389        196385145
VRT6         72858      66451741
VRT60        1315       195608731
VRT61        2566       194640733
VRT62        3378       193090756
VRT63        19514      76016943
VRT7         31810      63617988
VRT8         30160      115749293
VRT9         1265       193440277

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 217.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

24081372 18753084043   Homo sapiens
9879964  10226970619   Mus musculus
2197185   6528462354   Rattus norvegicus
2228095   5428300422   Bos taurus
4186689   5209461198   Zea mays
3298293   5070412211   Sus scrofa
1346791   3235807630   Hordeum vulgare subsp. vulgare
1728994   3190941577   Danio rerio
72        2590574434   Ovis canadensis canadensis
1812678   1942577632   Triticum aestivum
205292    1836337349   Cyprinus carpio
745763    1746253197   Solanum lycopersicum
1378427   1643221838   Oryza sativa Japonica Group
327068    1595510956   Apteryx australis mantelli
258052    1436154350   Strongylocentrotus purpuratus
462929    1336057555   Macaca mulatta
117800    1305820917   Escherichia coli
490289    1264377796   Spirometra erinaceieuropaei
1588051   1250005261   Xenopus tropicalis
2583125   1212019116   Arabidopsis thaliana

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for release prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690


3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          December 15 2016

                NCBI-GenBank Flat File Release 217.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ04).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Clark K, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW.
   GenBank. Nucleic Acids Res. 44(D1):D67-72 (2016)

   DOI:   10.1093/nar/gkv1276
   PMID:  26590407
   PMCID: PMC4702903.

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Clark, K. et al, Nucleic Acids Res. 44(D1), D67-72 (2016)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 217.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Michael Kornbluh, Jim Ostell, Vasuki Palanigobu,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Kamen Todorov, Eugene Yaschenko,
	Sergey Zhdanov, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center